https://s.turbifycdn.com/aah/optacticalgear/link-to-gear-retention-tracks-22.jpglink.ssprsmrskmar1https://s.turbifycdn.com/aah/optacticalgear/link-to-gear-retention-tracks-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-gear-retention-tracks-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-glock-mos-plate-15.jpglink.aiacp1r1https://s.turbifycdn.com/aah/optacticalgear/link-to-glock-mos-plate-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-glock-mos-plate-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-helmet-rail-adapter-11.jpglink.suheliled3wh11https://s.turbifycdn.com/aah/optacticalgear/link-to-helmet-rail-adapter-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-helmet-rail-adapter-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4340.jpglink.eainopgunbew1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4091.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4092.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4343.jpglink.nopvwr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4095.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4096.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4341.jpglink.nobnwr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4093.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4094.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4344.jpglink.nopvwr11https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4099.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4100.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4342.jpglink.noeobinvgwr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4097.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4098.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-j-arm-15.jpglink.baorcoonemos1https://s.turbifycdn.com/aah/optacticalgear/link-to-j-arm-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-j-arm-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1019.jpglink.crprjpc20mua1https://s.turbifycdn.com/aah/optacticalgear/newitem1-998.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-999.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1020.jpglink.crprjpc20mub1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1000.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1001.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4345.jpglink.crprjpc20mut1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4101.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4102.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-jpc-2-0-parts-11.jpglink.crprjpc201https://s.turbifycdn.com/aah/optacticalgear/link-to-jpc-2-0-parts-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-jpc-2-0-parts-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4346.jpglink.cotatrroosh1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4103.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4104.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-lightcap-and-scopecap-size-chart-11.jpglink.onehucoli1https://s.turbifycdn.com/aah/optacticalgear/link-to-lightcap-and-scopecap-size-chart-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-lightcap-and-scopecap-size-chart-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-low-profile-shoulder-straps-15.jpglink.twnemimapmoa1https://s.turbifycdn.com/aah/optacticalgear/link-to-low-profile-shoulder-straps-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-low-profile-shoulder-straps-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4347.jpglink.maloasarca201https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4105.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4106.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4348.jpglink.maloarca20ve1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4107.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4108.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4351.jpglink.crprlvsplho1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4113.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4114.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4349.jpglink.crprlvstaco1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4109.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4110.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4350.jpglink.crprlvsovcom1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4111.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4112.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4353.jpglink.vesy8roca40i1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4117.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4118.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4352.jpglink.vesygasmapof1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4115.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4116.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mha-leg-strap-11.jpglink.trnocomohoad1https://s.turbifycdn.com/aah/optacticalgear/link-to-mha-leg-strap-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mha-leg-strap-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-universal-retention-kit-17.jpglink.spsymifichmk1https://s.turbifycdn.com/aah/optacticalgear/link-to-universal-retention-kit-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-universal-retention-kit-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4354.jpglink.spsymifichmk11https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4119.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4120.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mini-map-11.jpglink.twnelowprshs1https://s.turbifycdn.com/aah/optacticalgear/link-to-mini-map-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mini-map-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4355.jpglink.trnocomhaleg1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4121.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4122.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mount-base-15.jpglink.ardeofopbapl1https://s.turbifycdn.com/aah/optacticalgear/link-to-mount-base-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mount-base-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-nightcap-battery-pouch-13.jpglink.crprni1https://s.turbifycdn.com/aah/optacticalgear/link-to-nightcap-battery-pouch-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-nightcap-battery-pouch-12.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4356.jpglink.l3habinivide1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4123.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4124.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4357.jpglink.eobiwwig24mo11https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4125.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4126.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4358.jpglink.crprmotrarse1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4127.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4128.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4359.jpglink.opnfea1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4129.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4130.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1021.jpglink.ardeofopmoba1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1002.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1003.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4360.jpglink.gaxec1proch1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4131.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4132.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-pack-zip-on-panel-maritime-12.jpglink.crprjpc20mas1https://s.turbifycdn.com/aah/optacticalgear/link-to-pack-zip-on-panel-maritime-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-pack-zip-on-panel-maritime-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4361.jpglink.pedetr5mapla1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4133.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4134.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-triple-5-56-mag-placard-aor1-11.jpglink.pedelowprslp1https://s.turbifycdn.com/aah/optacticalgear/link-to-triple-5-56-mag-placard-aor1-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-triple-5-56-mag-placard-aor1-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4362.jpglink.modlitepl350r1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4135.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4136.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4363.jpglink.crprlvpr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4137.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4138.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4364.jpglink.mauwchriggen1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4139.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4140.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4365.jpglink.sukminwhlihe1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4366.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4367.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-sara-sordin-adapters-15.jpglink.untamakit1https://s.turbifycdn.com/aah/optacticalgear/link-to-sara-sordin-adapters-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-sara-sordin-adapters-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4368.jpglink.vesyscliqufl1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4141.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4142.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4369.jpglink.vesysclicu1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4143.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4144.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-sight-mount-plate-15.jpglink.baorcoonemom1https://s.turbifycdn.com/aah/optacticalgear/link-to-sight-mount-plate-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-sight-mount-plate-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-tosight-mount-plates-11.jpglink.baorcoonemoj1https://s.turbifycdn.com/aah/optacticalgear/link-tosight-mount-plates-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-tosight-mount-plates-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4370.jpglink.xgoliascotfr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4145.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4146.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-slickster-components-13.jpglink.fecosl1https://s.turbifycdn.com/aah/optacticalgear/link-to-slickster-components-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-slickster-components-12.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4371.jpglink.edshdeesdsl11https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4147.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4148.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-slr-gb-7-pin-micro-gas-block-19.jpglink.hode5nabar1https://s.turbifycdn.com/aah/optacticalgear/link-to-slr-gb-7-pin-micro-gas-block-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-slr-gb-7-pin-micro-gas-block-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4373.jpglink.sobrm4up2wyp1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4151.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4152.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4372.jpglink.som4brup5chf1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4149.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4150.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4374.jpglink.spsyasbapaco1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4153.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4154.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4375.jpglink.spsyjspo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4155.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4156.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4376.jpglink.ssprmmo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4377.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4378.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-37.jpglink.untahotbupir1https://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-38.jpglink.momolisupl1https://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4379.jpglink.untahotbumr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4157.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4158.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4380.jpglink.vesylawenplc1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4159.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4160.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4381.jpglink.maapcwimepa1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4161.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4162.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-swiftclip-rigs-and-vests-19.jpglink.mauwgenivert1https://s.turbifycdn.com/aah/optacticalgear/link-to-swiftclip-rigs-and-vests-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-swiftclip-rigs-and-vests-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4382.jpglink.es5trkymagpo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4169.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4170.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4386.jpglink.es11kymagpo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4167.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4168.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4385.jpglink.es5sikytamag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4171.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4172.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4383.jpglink.es33kymagpo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4163.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4164.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4384.jpglink.es5dokytamag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4165.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4166.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4387.jpglink.es5dokyshmag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4175.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4176.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-tactical-tailor-fight-light-malice-clip-short-34.jpglink.es5sikymimag1https://s.turbifycdn.com/aah/optacticalgear/link-to-tactical-tailor-fight-light-malice-clip-short-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-tactical-tailor-fight-light-malice-clip-short-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1024.jpglink.esdopigapkyp1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1008.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1009.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1022.jpglink.esdopikymagp1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1006.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1007.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1023.jpglink.essipikymagp1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1004.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1005.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4389.jpglink.es5sikyshmag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4177.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4178.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4390.jpglink.es5trkymimag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4179.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4180.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4388.jpglink.es5trkyshmag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4173.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4174.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem2-305.jpglink.shcoramelin11https://s.turbifycdn.com/aah/optacticalgear/newitem2-287.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem2-288.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-the-shaw-concepts-ram-elastic-inserts-9.jpglink.shcoarcplv31https://s.turbifycdn.com/aah/optacticalgear/link-to-the-shaw-concepts-ram-elastic-inserts-7.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-the-shaw-concepts-ram-elastic-inserts-8.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem2-306.jpglink.spsylbvexkit1https://s.turbifycdn.com/aah/optacticalgear/newitem2-289.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem2-290.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1025.jpglink.eog43manomor1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1010.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1011.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4391.jpglink.eog33manomor1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4181.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4182.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-unity-tactical-fast-omni-mount-22.jpglink.eog45manomor1https://s.turbifycdn.com/aah/optacticalgear/link-to-unity-tactical-fast-omni-mount-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-unity-tactical-fast-omni-mount-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4392.jpglink.agteweexbahe1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4183.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4184.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1026.jpglink.agopmasfheco1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1012.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1013.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-uw-gen-iv-chest-rig-15.jpglink.exmaremedpof1https://s.turbifycdn.com/aah/optacticalgear/link-to-uw-gen-iv-chest-rig-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-uw-gen-iv-chest-rig-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4393.jpglink.hep1leiiiast1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4284.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4285.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-junction-box-crane-connector-r-10.jpglink.wiraxelowpo1https://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-junction-box-crane-connector-r-8.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-junction-box-crane-connector-r-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-raid-xe-low-power-r-11.jpglink.wijuboxcrcor1https://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-raid-xe-low-power-r-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-raid-xe-low-power-r-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4394.jpglink.blfogetrkitn11https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4185.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4186.jpghttps://s.turbifycdn.com/aah/optacticalgear/noname2-40.jpgcustom-itemoptacticalgear-pagefootwearLowa Footwear1lozemk2gtxmilozemk2midlozegtxmidlozegtxmidtflozemidtfbo1https://s.turbifycdn.com/aah/optacticalgear/noname2-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/noname2-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-32.jpgcustom-itemoptacticalgear-pagenoname20005512631235Lowa Zephyr GTX MidLowa Boots111This Zephyr model features open eye-hooks at the top for easier on/off, and to allow additional lacing techniques to be used. - Upper: Split Leather/Fabric
- Lining: GORE-TEX Extended Comfort – Tech Performance
- Insole: ATC
- Midsole: Double Injection DuraPU®
- Outsole: LOWA Cross II
- Stabilizer: Medium
- Weight: 550 g/Single Shoe This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-41.jpgLowa Boots
https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-tf-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-tf-65.jpgcustom-itemoptacticalgear-pagenoname21613105370XXX235Lowa Zephyr GTX Mid TFLowa Boots111• Upper Material Split Grain Leather & Fabric
• Construction Slip Lasted - Injected PU Midsole
• Lacing Hardware Fabric Loops and Closed Hooks
• Monowrap Frame® MONOWRAP® Stability Frame
• Lining GORE-TEX® Vision 3LY
• Insole ATC Footbed
• Midsole Double Injection DuraPU™
• Sole LOWA Cross II
• Stabilizer Soft
• Country of Origin Slovakia
• Weight Per Pair (lb) 2.42
• Resolable No Sizing: True to size, Lowa recommends ordering the same size as your standard street shoe size. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-tf-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-tf-78.jpgLowa Boots
https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mid-tf-boots-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mid-tf-boots-69.jpgcustom-itemoptacticalgear-pagenoname21613105350731225Lowa Zephyr Mid TF BootsLowa Boots111• Upper Material: Split Grain Leather
• Construction Slip Lasted - Injected PU Midsole
• Lining: Wicking Polyester Synthetic
• Lacing Hardware Fabric Loops & Open Hooks
• Monowrap Frame®: MONOWRAP® Stability Frame
• Midsole: Injected DuraPU™
• Insole ATC Footbed
• Sole: LOWA Cross II
• Stabilizer: Soft
• Country of Origin: Slovakia
• Weight Per Pair (lb) 2.13
• Resolable: No Sizing: True to size, Lowa recommends ordering the same size as your standard street shoe size. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mid-tf-boots-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mid-tf-boots-82.jpgLowa Boots
https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-gtx-mid-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-gtx-mid-34.jpgcustom-itemoptacticalgear-pagenoname2161-3108550265Lowa Zephyr MK2 GTX MidLowa Boots111Features:
• Upper : Split Leather/CORDURA®
• Lining : GORE-TEX Professional
• Insole: Kinetic Z
• Midsole: Double Injection DuraPU®
• Outsole: LOWA® X-TRAC® MILITARY
• Weight: 1.26lbs / Single Shoe
• Country of Origin: Slovakia Sizing: True to size, Lowa recommends ordering the same size as your standard street shoe size. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-gtx-mid-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-gtx-mid-47.jpgLowa Boots
https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-mid-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-mid-17.jpgcustom-itemoptacticalgear-pagenoname2161-3108570731235Lowa Zephyr MK2 MidLowa Boots111Features:
• Upper: Split Leather/CORDURA®
• Lining: Moisture-Wicking Textile
• Insole: Kinetic Z
• Midsole: Double Injection DuraPU®
• Outsole: LOWA® X-TRAC® MILITARY
• Weight: 1.24lbs / Single Shoe
• Country of Origin: Slovakia Sizing: True to size, Lowa recommends ordering the same size as your standard street shoe size. These boots are Coyote in color. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-mid-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-mid-30.jpgLowa Boots
https://s.turbifycdn.com/aah/optacticalgear/lrrp-vietnam-44.jpgcustom-itemoptacticalgear-pagegearloadoutsLRRP Team Member Vietnam (6 man team) 1960's-70's16 fragmentation grenades
1 concussion grenade
2 CS grenades
2 claymores
3 strobes/ team
2 signal panels/ team
2 mirrors/ team
3 compasses/ team
3 pen flares/ team
3 smoke grenades/ team
2 penlights/ team
1 SOI/ team
poncho liner
foot powder
socks
FA kit
FA bag/ team
Sling rope and link
2 radios/ team
1 emergency radio/ team
2 batteries/ radio
2 handsets/ radio
1 field expedient antennae/ team
5 days rations
8 days rations in monsoon season
water purification
Camo stick
5 quarts water Source: Inside the LRRPs: Rangers in Vietnam, Michael Lee Lanning, Ballantine Books, 1988 ]]>
1https://s.turbifycdn.com/aah/optacticalgear/lrrp-vietnam-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/lrrp-vietnam-43.jpg
https://s.turbifycdn.com/aah/optacticalgear/luminae-anything-pouch-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-anything-pouch-17.jpgcustom-itemoptacticalgear-pagenewitemsXX-LDST1435Luminae Anything PouchLuminae111The Luminae Anything pouch is designed to fit....anything. Using an ingenious retention adjustment method, the Anything Pouch will fit most small items from a compass to a coffee flask. Being able to use the same pouch to hold different caliber magazines or other small items stops you having to swap out pouches depending on what system/equipment you're using. This Pouch will hold most small items and most magazine styles, from 5.56 to 7.62NATO. The pouch is fixed using 2 x rows of Molle Made from Genuine Multicam Elastic and Fabrics the pouch is designed to offer ultimate flexibility to the user. 1https://s.turbifycdn.com/aah/optacticalgear/luminae-anything-pouch-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-anything-pouch-30.jpgLuminaehttps://s.turbifycdn.com/aah/optacticalgear/luminae-garmin-foretrex-gps-mount-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-garmin-foretrex-gps-mount-21.jpgcustom-itemoptacticalgear-pagelandnavigationXX-LDST1029.99Luminae Garmin Foretrex GPS Mount Luminae111Luminae Foretrex GPS Mount MKII is a protective mount for the Garmin foretrex 301/401/601. its design allows you to view and operate your GPS leaving your hands free for other tasks. 1https://s.turbifycdn.com/aah/optacticalgear/luminae-garmin-foretrex-gps-mount-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-garmin-foretrex-gps-mount-33.jpgLuminaehttps://s.turbifycdn.com/aah/optacticalgear/luminae-otb-pouch-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-otb-pouch-18.jpgcustom-itemoptacticalgear-pagebeltpouchesXXLDST2865Luminae OTB PouchLuminae111This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/luminae-otb-pouch-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-otb-pouch-30.jpgLuminaehttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-system-43.jpgcustom-itemoptacticalgear-pageweacM-LOK Accessories1mamracoty2msmamracoty2hamawckwicokitmamracoty1redshdeesdefgardehastmrtrnocogrstletrnocopogrsttrnocogrmruntahotbumrardefistmrardeinmrkrdegrhastfokrdegrtebastmabastmknarcombastsmamhastkitrmamafanfogrrmammvvegrruntadivfgmamporamamqdslmor1ardeqdmomrkrdegrmlqdmomabifor19pir(R)=ITEM WILL NOT BE SHIPPED OUT OF UNITED STATES, NO EXCEPTIONS1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-system-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-system-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/m16-ar-15-shoot-off-muzzle-cover-40.jpgitem.optacticalgear-pageotweclki8A20.5M16 / AR-15 Shoot Off Muzzle CoverOPT111Available in Tan and Black colors. Works on A2, Panther, Yankee Hill flash hiders Does not fit the Cav-comp Keeps dirt and dust out of the barrel. We have these in stock, in quantity, for large scale discounts call us at 1-919-818-3649 or email customer service at optactical@yahoo.com1https://s.turbifycdn.com/aah/optacticalgear/m16-ar-15-shoot-off-muzzle-cover-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/m16-ar-15-shoot-off-muzzle-cover-50.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/m4-ar-buttstocks-58.jpgcustom-itemoptacticalgear-pageweacM4 / AR Buttstocks, and Accessories1lawtafoadgenmadtcastmirmagpulctrmamoeslcastmsunandshcachgesu42brwibulbeunbuforarlbeunbuforar1lbeuncaleresfocodecnfrfocodeesrmaasqdamslathpgstockcuff1https://s.turbifycdn.com/aah/optacticalgear/m4-ar-buttstocks-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/m4-ar-buttstocks-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/ar-lower-receiver-parts-and-upgrades-55.jpgitem.optacticalgear-pageweacM4 / AR Grips and AccessoriesGear]]>1edshdegrgrmamoek2grmamograrrmamoeslgrarrmamoeargrrmamoegrarrmaentrguNO EXCEPTIONS]]>1https://s.turbifycdn.com/aah/optacticalgear/ar-lower-receiver-parts-and-upgrades-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/ar-lower-receiver-parts-and-upgrades-54.jpgGear]]>https://s.turbifycdn.com/aah/optacticalgear/m4-ar-upgrades-44.jpgcustom-itemoptacticalgear-pageweacM4 / AR Lower Reciver Parts, and Triggers1gogeslfitmafhrfcorcmrsoli2trl2srsoblstkitrmaesksearrawetaamsasebaorco1mosarbaorunsasearfocodeesrfocodecnfrfocodetgfrbaorenbocargemabocarmabaasdebadrlawtafoadgengesusessatrralgdequmitrqmaasqdamslatsoa5bukitrgesu42brwibukrdegrm4reexkrdegra5reexknarcocotrguknarcoammaremamoeentrgupmaentrguThese were built specifically for AR type rifles.1https://s.turbifycdn.com/aah/optacticalgear/m4-ar-upgrades-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/m4-ar-upgrades-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/m4-ar-upper-receivers-and-parts-43.jpgcustom-itemoptacticalgear-pageweacM4 / AR Upper Receivers, Handguards, Barrels, and Parts1gearusupregrhode11mod2comosushwiunrahode11mod1cohodecomod1ursobrm4up2wypsom4brup5chfsom4coup513colm4coup511chodearbocagrhodebocagrrsobc5158caphsobcg5158cahhodepilorarhodebaor5archodesplomrachodesplomrahfocodelowsnasostfouprhodeau2stuprhodemod1uprehodem4uprerso2prsprgrbahode5nabarhodelowprgasslrrigbpinmikrdegrgasblrsoliamchha5araweraamchharaweraamchha1geaichharbaorgen3amchsuso4flhirsuwacltiflhisuwaflhisuadsonoxmude59hsusfsusomubrrmaenejpocorracotoarupreknarcoupresr1knarcoupresrzevarwelo9in1https://s.turbifycdn.com/aah/optacticalgear/m4-ar-upper-receivers-and-parts-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/m4-ar-upper-receivers-and-parts-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/mack-s-ear-seals-soft-flanged-earplugs-41.jpgitem.optacticalgear-pagehepr263600054.993.99Mack's Ear Seals Soft Flanged EarplugsMack's Ear Plugs111Product Details: Reusable, washable, dual purpose earplugs Seals out noise with a noise reduction rating of 27 decibels (when used as directed) for power tools, loud concerts, shooting, racing events, etc. Seals out water – Swim, shower, bathe, water sports, etc. Detachable cord – Conveniently hang plugs around your neck in environments where noise comes and goes Quickly and easily remove the cord for water activities. Super soft seal rings – Incredibly soft for extreme comfort. Dual durometer design – Two plastics used in the molding process allow for ease of insertion and unmatched comfort. Made in the U.S.A. 1https://s.turbifycdn.com/aah/optacticalgear/mack-s-ear-seals-soft-flanged-earplugs-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/mack-s-ear-seals-soft-flanged-earplugs-50.jpgMack's Ear Plugshttps://s.turbifycdn.com/aah/optacticalgear/mag-pouch-upgrades-36.jpgcustom-itemoptacticalgear-pageoptopmapoMag Pouch Upgrades1es5kyinhastmapoinespikyinssprputa1https://s.turbifycdn.com/aah/optacticalgear/mag-pouch-upgrades-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/mag-pouch-upgrades-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/mag-pod-base-plate-for-gen3-pmag-3-pack-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/mag-pod-base-plate-for-gen3-pmag-3-pack-r-46.jpgcustom-itemoptacticalgear-pagemainco148-8866327.9524.95Mag-Pod Base Plate for GEN3 PMAG (3-Pack) (R)Multitasker111• Compatible with GenM3 PMAG®
• Field expedient monopod for enhanced prone stability
• Ergonomic shape for improved grip during reloading
• SPACEFRAME docking slot for NANO/NANO2 Tool (sold separately)
• 15% Glass fiber reinforced PA6 nylon
• Double injection molded TPU based for improved traction on hard surfaces.
• SOLD AS 3-PACK MOE® and PMAG® are registered trademarks of Magpul Industries Corp. No endorsement expressed nor implied. NOTE: Designed ONLY to fit Magpul Gen 3 PMAGs. PMAG not included.]]>
1https://s.turbifycdn.com/aah/optacticalgear/mag-pod-base-plate-for-gen3-pmag-3-pack-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mag-pod-base-plate-for-gen3-pmag-3-pack-r-58.jpgMultitasker
https://s.turbifycdn.com/aah/optacticalgear/magazines-and-accessories-56.jpgitem.optacticalgear-pageweacMagazines and Accessories1glfamagen533glfamagen415glfamagen517mapm21glgl9xmapm17gl9glgmapm15gl9gl1tatabapadkitttifibapadkiblknarcosrmamaam17sg9sigmapmdarmapm30argenm2crprmasof3mapm30argenm1mapm30argenmcam1maweducomabaplforgepNO EXCEPTIONS]]>1https://s.turbifycdn.com/aah/optacticalgear/magazines-and-accessories-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/magazines-and-accessories-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-amag-17-sg9-sig-p320-m17-r-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-amag-17-sg9-sig-p320-m17-r-19.jpgcustom-itemoptacticalgear-pagemainco49MAG133134.95Magpul AMAG 17 SG9 - SIG P320/M17 (R) Magpul111• Caliber: 9x19mm Parabellum
• Platform: SIG P320™/M17™
• Capacity: 17 rounds
• Materials: Heat-treated, stainless-steel alloy body and spring with polymer floorplate and follower
• Weight: 3.2 oz / 89 g
• Compatibility: The AMAG 17 SG9 is compatible with all full-size, compact, and sub-compact variants of the SIG P320/M17/M18 platform CORROSION-RESISTANT, STAINLESS-STEEL MAGAZINE BODY
High-visibility, controlled-tilt follower
Stainless-steel spring for longevity and durability CAPACITY INDICATORS IN ONE-ROUND INTERVALS STARTING AT FIVE ROUNDS FLARED, EASILY REMOVEABLE FLOORPLATE FOR MAINTENANCE
Paint pen dot matrix panel on the bottom to allow for identification marking This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-amag-17-sg9-sig-p320-m17-r-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-amag-17-sg9-sig-p320-m17-r-31.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-armorer-s-wrench-ar15-m4-r-36.jpgcustom-itemoptacticalgear-pagebrtokimaarwrarr79.9575.95Magpul Armorers Wrench (R)Magpul111Features:
American-made with US steel
Heat-treated steel construction with manganese phosphate finish
USGI barrel nut wrench
Free-float tube barrel nut wrench
1/2" torque wrench/breaker bar interface
Armorer's hammer
Rifle-length/Entry-length receiver extension wrench
USGI castle nut wrench, usable with aftermarket end plates such as the ASAP® and ASAP®-QD
3/4" wrench for most flash hiders/muzzle brakes
USGI torque spec references
Bottle opener Specifications:
Armorer's Wrench – AR15/M4
Weight: 1.1 lb.
Length, maximum: 11.7 in.
Handle Thickness: 0.35 in. ITAR Restricted: International Traffic in Arms Regulations Controlled Product]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-armorer-s-wrench-ar15-m4-r-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-armorer-s-wrench-ar15-m4-r-43.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-asap-qd-ambidextrous-sling-attachment-point-qd-r-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-asap-qd-ambidextrous-sling-attachment-point-qd-r-43.jpgcustom-itemoptacticalgear-pagem4arbuttstocks49MAG52929.9528.45Magpul ASAP QD - Ambidextrous Sling Attachment Point QD (R)Magpul111Features
-Accepts any push-button QD sling swivel as well as the Magpul QDM
-Durable steel construction
-Case hardened and finished with Melonite™ for extreme resistance to wear and corrosion
-Works with both mil-spec and commercial-spec carbine receiver extensions (buffer tubes) NOTE: The ASAP QD is NOT compatible with A1/A2 fixed stocks as well as any other similarly mounted stock such as the Magpul PRS®, UBR®, and MOE® Rifle Stocks. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-asap-qd-ambidextrous-sling-attachment-point-qd-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-asap-qd-ambidextrous-sling-attachment-point-qd-r-56.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-barricade-stop-m-lok-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-barricade-stop-m-lok-17.jpgcustom-itemoptacticalgear-pagemamsy49MAG129524.95Magpul Barricade Stop - M-LOKMagpul111The Magpul Barricade Stop is a rugged hand stop that allows the shooter to brace their firearm off barricades or field expedient shooting rests to create a stable platform for more accurate shots. The Barricade Stop is constructed of a polymer body that’s fit with a hardened, QPQ-treated steel plate insert. The steel plate is heavily textured for aggressive contact with your shooting rest. It’s also slightly curved for optimized contact on uneven surfaces, giving you the ability to pivot your firearm while maintaining contact and control. Compatible with octagonal M-LOK Handguards. Hybrid polymer and metal construction Textured, QPQ-treated steel face for increased hardness and corrosion resistance Made in the USA. 1https://s.turbifycdn.com/aah/optacticalgear/magpul-barricade-stop-m-lok-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-barricade-stop-m-lok-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-battery-assist-device-bad-r-38.jpgitem.optacticalgear-pagem4arupgrades49MAG98032.9531.3Magpul Battery Assist Device BAD (R)Magpul111Developed from the operational experience of the Magpul® Dynamics team, the B.A.D. Lever™ (Battery Assist Device) is designed to considerably improve the speed and efficiency of the AR15/M16 bolt catch. The B.A.D. Lever™ quickly addresses reloading and malfunction clearance shortcomings of AR15/M16 platforms by extending a paddle to the right side of the weapon, allowing manipulation of the bolt stop from the fire control/ready position with the right-hand trigger finger. Made in USA Features - Fits standard mil-spec forged AR15/M16 lower receivers - Thin, anti-snag profile and textured surface still allows for traditional manipulation of the bolt catch while maintaining unobstructed access to the trigger - Easy attachment to the existing bolt catch paddle via one screw - Machined from durable billet 6061-T6 aluminum with mil-spec finishing - MIL-A-8625F, Type III, Class 2 hard anodizing with manganese phosphate on the screw per MIL-DTL-16232G - Torx® mounting screw with Nyloc® blue patch prevents back out under recoil, Torx® wrench included1https://s.turbifycdn.com/aah/optacticalgear/magpul-battery-assist-device-bad-r-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-battery-assist-device-bad-r-48.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-bipod-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-bipod-for-1913-picatinny-rail-24.jpgcustom-itemoptacticalgear-pagemamsy49MAG941129.95109.45Magpul Bipod (R)Magpul111Innovative, Adjustable, & Easy to Use Deploying and adjusting the Magpul Bipod is quick and easy. Spring-tensioned legs stow neatly forward and snap down and lock into place with one hand. Leg extensions slide and lock securely with the push of a button on any of the seven half-inch spaced locking detents. The legs extend a full four inches, from 6.3” to 10.3”. An industry-exclusive 50° of total tilt and 40° of total pan are controlled by a glove-friendly knurled tool-less bipod locking knob located between the extended legs, allowing easy adjustment between shots. Additionally, the Magpul Bipod has the exclusive ability to lock pan at 0° while maintaining full tilt functionality. Smooth & Unobtrusive From the drawing board, the Magpul Bipod was designed to be barely noticed until needed. Folded, the streamlined housing and legs fit neatly under the barrel and are just under 2.3” deep and 3.3” wide. In addition, anodized surfaces and tight, precision tolerances mitigate squeaks and rattles. Functional Feet The Magpul Bipod has many features that are also useful even when it is in the stowed position. A soft rubber bipod locking knob cap is attached to the locking knob gives users a steady, non-marring forward rest while the bipod is folded. Additionally, its staggered soft rubber feet hold fast on a variety of shooting surfaces and are easily removed with a roll pin punch. Should users choose to change feet, the Magpul Bipod’s legs accept most Atlas pattern bipod replaceable feet, except for the Atlas 5-H style. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-bipod-for-1913-picatinny-rail-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-bipod-for-1913-picatinny-rail-31.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-ctr-carbine-stock-r-50.jpgitem.optacticalgear-pagem4arbuttstocks49MAG31_64.9561.7Magpul CTR Carbine Stock (R)Magpul111-Mounts on mil-spec sized carbine receiver extension tube (not included) from manufacturers such as Colt, Armalite, S&W, LMT, and others (please see the note below)
-Supplemental friction lock minimizes accuracy robbing wobble*
-Sloping cheek weld combines a slim profile with user comfort
-Shielded release latch prevents snagging and accidental operation
-Premium chrome-silicon lock spring provides positive locking and long service life
-Side mounting slots accept optional cheek risers for NON AR15/M4 applications
-Removable 0.30" Rubber Butt-Pad offers an anti-slip surface and increases impact protection
-Compatible with Magpul ASAP®, ASAP® QD and other receiver-mount sling attachments Sling Mounts:
-Rear - Push-button QD swivel sling mount accommodates up to 1.5" swivels (ambidextrous)
-Rear/Bottom - 1.25" sling loops
-Toe - Lanyard hole for custom para-cord rigs SPECIFICATIONS:
-Weight: 8.8 oz.
-Weight, w/receiver extension: 12.8
-Length, max: 6.9 in.
-LOP Adjustment Range: 3.3 in.
-LOP, M4 Collapsed: ~10.7 in.
-LOP, M4 Extended: ~14.0 in. Friction lock performance may vary depending on the host receiver extension's dimensional tolerances. Specifications based on standard-length (flat-back) M4 Carbine receiver extension and may vary depending on tube manufacturer. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-ctr-carbine-stock-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-ctr-carbine-stock-r-60.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-large-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-large-16.jpgcustom-itemoptacticalgear-pagemadapo49MAG115524.9523.7Magpul DAKA Can - LargeMagpul111Features
•Larger can with new upgrades
•Larger form for expanded storage
•High-density foam lining for more protection
•Crush, dust, chemical, UV and weather resistant
•High-strength injection molded polymer with durable external reinforced rib design
•Protective positive friction lid closure with durable steel hinge pin Technical Specifications
•External height: 6.4 in.
•Internal height: 6.0 in.
•External width: 3.3 in.
•Internal width: 2.7 in.
•External length: 3.0 in.
•Internal length: 2.6 in.
•Internal volume: ~ 44 cu in ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-large-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-large-30.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-2-0-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-2-0-46.jpgcustom-itemoptacticalgear-pagemadapo49MAG122319.9518.95Magpul DAKA Can 2.0 Magpul111Technical Specifications
•External height: 6.4 in.
•External width: 2.7 in.
•External length: 2.8 in. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-2-0-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-2-0-60.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-essential-wallet-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-essential-wallet-45.jpgcustom-itemoptacticalgear-pagemadapo49MAG75816.9516.1Magpul DAKA Essential WalletMagpul111• Made of reinforced polymer fabric with anti-slip texture
•Permanent, RF welded seams
•Wallet is 4.13” x 2.75” and just 3mm thin
•Holds 3–7 standard Credit/ID/Access cards comfortably
•Slim profile reduces printing in pocket
•Suitable for EDC (everyday carry) and travel
•Rounded corners ease pocket entry and exit
•Extremely durable
•Chemical resistant
•Non-hygroscopic ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-essential-wallet-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-essential-wallet-58.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-everyday-wallet-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-everyday-wallet-45.jpgcustom-itemoptacticalgear-pagemadapo49MAG76324.9523.7Magpul DAKA Everyday WalletMagpul111• Windowed ID pocket
• Center divider pocket for bills and notes
• 10% larger than the Magpul DAKA Essential Wallet and holds 3-7 cards comfortably
• Slim profile eliminates printing
• Suitable for EDC and travel
• Reinforced polymer fabric with anti-slip texture
• Welded construction creates permanent impenetrable seals
• Chemical resistant / Non-hygroscopic
• Dimensions: 4.2” x 2.84” ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-everyday-wallet-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-everyday-wallet-58.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-large-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-large-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG124522.9521.8Magpul DAKA Lite Pouch - LargeMagpul111• Zipper Length: 10 inches
• Dimensions: 13 x 9 inches
• Weight: 41 grams]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-large-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-large-58.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-medium-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-medium-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG124418.9518Magpul DAKA Lite Pouch - MediumMagpul111• Zipper Length: 9 inches
• Dimensions: 12 x 7 inches
• Weight: 30 grams]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-medium-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-medium-58.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-small-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-small-47.jpgcustom-itemoptacticalgear-pagemadapo49MAG124314.9514.2Magpul DAKA Lite Pouch - SmallMagpul111• Zipper Length: 6 inches
• Dimensions: 9 x 6 inches
• Weight: 20 grams This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-small-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-small-61.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-large-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-large-45.jpgcustom-itemoptacticalgear-pagemadapo49MAG85827.9526.55Magpul DAKA Pouch - LargeMagpul111FEATURES
-Large Pouch size 9"x13"
-Reinforced polymer fabric with anti-slip texture
-Welded construction creates permanent impenetrable seals
-YKK AquaGuard® water repellant zipper
-550 paracord with heat shrink tubing for enhanced grip, even with gloves
-Paint pen dot matrix debossed into body for identification marking
-Carabiner attachment points This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-large-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-large-59.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-medium-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-medium-45.jpgcustom-itemoptacticalgear-pagemadapo49MAG85722.9521.8Magpul DAKA Pouch - MediumMagpul111FEATURES
-Medium Pouch size 7"x12"
-Reinforced polymer fabric with anti-slip texture
-Welded construction creates permanent impenetrable seals
-YKK AquaGuard® water repellant zipper
-550 paracord with heat shrink tubing for enhanced grip, even with gloves
-Paint pen dot matrix debossed into body for identification marking
-Carabiner attachment points This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-medium-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-medium-59.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-small-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-small-45.jpgcustom-itemoptacticalgear-pagemadapo49MAG85619.9518.95Magpul DAKA Pouch - SmallMagpul111dakavideoFEATURES
-Small Pouch size 6"x9"
-Reinforced polymer fabric with anti-slip texture
-Welded construction creates permanent impenetrable seals
-YKK AquaGuard® water repellant zipper
-550 paracord with heat shrink tubing for enhanced grip, even with gloves
-Paint pen dot matrix debossed into body for identification marking
-Carabiner attachment points Note: this is not a MOLLE/PALS pouch. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-small-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-small-59.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouches-20.jpgcustom-itemoptacticalgear-pagegepuutpoMagpul DAKA Pouches1madawawipolamadawawipomemadawawiposmmadacan20madacanlamadaeswamadaevwamadalipolamadalipomemadaliposmmadapolamadapomemadaposmmadatalamadataoutmadautormadavopomadawipolamadawipomemadawiposm1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouches-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouches-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-take-out-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-take-out-36.jpgcustom-itemoptacticalgear-pagemadapo49MAG116129.9528.45Magpul DAKA TakeoutMagpul111REINFORCED POLYMER FABRIC
• Made of reinforced polymer-infused fabric with anti-slip texture for secure handling
• Strong RF welded construction that creates permanent, impenetrable seals
• Chemical resistant and non-hygroscopic MULTI-FUNCTION QUICK RELEASE BUCKLES
• Buckles provide a secure connection wherever you hang the Takeout and also act as a carrying handle
• FDE Magpul DAKA Takeout end view with buckled straps that can also act as carry handles 550 PARACORD & HEAT SHRINK TUBING FOR ENHANCED GRIP ON AQUAGUARD ZIPPER
• Rugged but easy to open and close zipper Tech Specs:
• Zipper length: 11.5 in.
• External height: 6.25 in.
• External width: 4.0 in.
• External length: 7.75 in.
• Internal volume: 3.5L EXPORT NOTICE: This is an item controlled for export by the Export Administration Regulations (EAR) under the Commerce Control List (CCL). These controls take the form of export regulations and license requirements. As part of the express consideration provided for receipt of Magpul's goods, technical data and/or services, you, our customer, acknowledge that the export, re-export or other transfer, directly or indirectly, of the goods, technical data and/or services provided by Magpul in violation of U.S. law is prohibited. Customers acquiring controlled goods, technical data and/or services from Magpul shall be responsible for obtaining any necessary U.S. or other government authorization required to ensure compliance with applicable export laws.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-take-out-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-take-out-46.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-takeout-large-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-takeout-large-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG119744.9542.7Magpul DAKA Takeout - LargeMagpul111litotafeviREINFORCED POLYMER FABRIC
• Made of reinforced polymer-infused fabric with anti-slip texture for secure handling
• Strong RF welded construction that creates permanent, impenetrable seals
• Chemical resistant and non-hygroscopic MULTI-FUNCTION QUICK RELEASE BUCKLES
• Buckles provide a secure connection wherever you hang the Takeout, Large and also act as a carrying handle 550 PARACORD & HEAT SHRINK TUBING FOR ENHANCED GRIP ON AQUAGUARD ZIPPER
• Rugged but easy to open and close zipper Specs:
• Zipper length: 18.5 in.
• External height: 9.0 in.
• External width: 6.5 in.
• External length: 12.0 in.
• Internal volume: 8.88 L EXPORT NOTICE: This is an item controlled for export by the Export Administration Regulations (EAR) under the Commerce Control List (CCL). These controls take the form of export regulations and license requirements. As part of the express consideration provided for receipt of Magpul's goods, technical data and/or services, you, our customer, acknowledge that the export, re-export or other transfer, directly or indirectly, of the goods, technical data and/or services provided by Magpul in violation of U.S. law is prohibited. Customers acquiring controlled goods, technical data and/or services from Magpul shall be responsible for obtaining any necessary U.S. or other government authorization required to ensure compliance with applicable export laws.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-takeout-large-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-takeout-large-58.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-utility-organizer-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-utility-organizer-58.jpgcustom-itemoptacticalgear-pagemadapo49MAG124029.9528.45Magpul DAKA Utility OrganizerMagpul111Technical Specifications
•Overall size of 4.5” x 7.5” x 1.75”
•Includes one zippered mesh pocket (6.75" x 3.75"), two vertical pockets (min. 4" x 3.75"), and three elastic pass-throughs (1" x 1.25")
•Useful as a tool kit, first aid kit, admin pouch, travel kit, or electronics case
•Polymer-infused material with welded construction creates permanent, impenetrable seals 
•Carabiner attachment point
•Chemical-resistant and non-hygroscopic
•YKK AQUAGUARDWATER-REPELLANT ZIPPER
•550 paracord with heat shrink tubing for enhanced grip, even with gloves]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-utility-organizer-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-utility-organizer-72.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-volume-pouch-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-volume-pouch-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG110129.9528.45Magpul DAKA Volume PouchMagpul111lidavopoviREINFORCED POLYMER FABRIC WITH ANTI-SLIP TEXTURE
• Our unique material protects your stuff from exposure, moisture, and from getting lost
• Chemical resistant and non-hygroscopic
• Paint pen dot matrix debossed into body for identification marking WELDED CONSTRUCTION AND YKK AQUAGUARD® ZIPPER
• Impenetrable seals on all sides and a water repellent zipper ensure secure, environment-proof storage
• Large carabiner attachment point 550 PARACORD & HEAT SHRINK TUBING FOR ENHANCED GRIP
• Rugged but easy to open and close zipper Tech Specs:
• Carabiner Attachment: Standard screw gate / wire gate Carabiner
• Zipper length: 7.5"
• External height: 10.5"
• External width: 8.5"
• Internal volume: 3L ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-volume-pouch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-volume-pouch-58.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-large-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-large-18.jpgcustom-itemoptacticalgear-pagepacocobawaba49MAG133934.95Magpul DAKA Waterproof Window Pouch - Large Magpul111• RUGGED, 100% WATERPROOF YKK ZIPPER THAT'S EASY-TO-OPEN AND CLOSE
• STRONG RF WELDED CONSTRUCTION THAT CREATES PERMANENT, IMPENETRABLE SEALS
• Overall dimensions: 9 x 13 in.
• External height: 9.0 in.
• Internal height: 8.75 in.
• External width: 13.0 in.
• Internal width:12.75 in.
• Internal volume: 3.18L ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-large-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-large-30.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/newitem1-964.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-963.jpgcustom-itemoptacticalgear-pagepacocobawaba49MAG133829.95Magpul DAKA Waterproof Window Pouch - MediumMagpul111• RUGGED, 100% WATERPROOF YKK ZIPPER THAT'S EASY-TO-OPEN AND CLOSE
• STRONG RF WELDED CONSTRUCTION THAT CREATES PERMANENT, IMPENETRABLE SEALS
• Overall dimensions: 7 x 12 in.
• External height: 7.0 in.
• Internal height: 6.75 in.
• External width: 12.0 in.
• Internal width: 11.75 in.
• Internal volume: 1.45L ]]>
1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1014.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1015.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-small-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-small-18.jpgcustom-itemoptacticalgear-pagepacocobawaba49MAG133724.95Magpul DAKA Waterproof Window Pouch - SmallMagpul111• RUGGED, 100% WATERPROOF YKK ZIPPER THAT'S EASY-TO-OPEN AND CLOSE
• STRONG RF WELDED CONSTRUCTION THAT CREATES PERMANENT, IMPENETRABLE SEALS
• Overall dimensions: 6 x 9 in.
• External height: 6.0 in.
• Internal height: 5.75 in.
• External width: 9.0 in.
• Internal width: 8.75 in.
• Internal volume: 45L ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-small-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-small-30.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-large-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-large-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG99630.9529.4Magpul DAKA Window Pouch - LargeMagpul111• Reinforced polymer fabric with anti-slip texture
• Window for easy organization
• RF welded construction that creates permanent, impenetrable seals
• YKK AquaGuard® water repellant zipper
• 550 paracord with heat shrink tubing for enhanced grip, even with gloves
• Chemical resistant and non-hygroscopic
• Paint pen dot matrix debossed into body for identification marking
• Carabiner attachment points Specs:
• 9” X 13”
• Zipper opening: 10"]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-large-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-large-58.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-medium-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-medium-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG99525.9524.95Magpul DAKA Window Pouch - MediumMagpul111• Reinforced polymer fabric with anti-slip texture
• Window for easy organization
• RF welded construction that creates permanent, impenetrable seals
• YKK AquaGuard® water repellant zipper
• 550 paracord with heat shrink tubing for enhanced grip, even with gloves
• Chemical resistant and non-hygroscopic
• Paint pen dot matrix debossed into body for identification marking
• Carabiner attachment points Specs:
• Overall: 7” X 12”
• Zipper opening: 8.5”]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-medium-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-medium-58.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-small-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-small-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG99421.9520.85Magpul DAKA Window Pouch - SmallMagpul111• Reinforced polymer fabric with anti-slip texture
• Window for easy organization
• RF welded construction that creates permanent, impenetrable seals
• YKK AquaGuard® water repellant zipper
• 550 paracord with heat shrink tubing for enhanced grip, even with gloves
• Chemical resistant and non-hygroscopic
• Paint pen dot matrix debossed into body for identification marking
• Carabiner attachment points Specs:
• Overall: 6” X 9”
• Zipper opening: 5.75"]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-small-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-small-58.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-dt-carbine-stock-mil-spec-r-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-dt-carbine-stock-mil-spec-r-17.jpgcustom-itemoptacticalgear-pagem4arbuttstocks49MAG137764.9561.7Magpul DT Carbine Stock Mil-Spec (R)Magpul111• Platform: AR10, AR15, M4, M16, M110, SR25
• Compatibility: Mil-Spec sized carbine receiver extension tube (not included) from manufacturers such as Colt, LMT, Ruger, S&W, SIG, and others*
• LOP, M4 Collapsed: ~10.6 in.
• LOP, M4 Extended: ~13.9 in.
• LOP Adjustment Range: 3.3 in.
• Length, max: 7.0 in.
• Height, max: 5.3 in.
• Weight: 9.7 oz.
• Weight, w/ receiver extension: ~13.7 oz.
• Width, max: 1.6 in. *Specifications based on standard-length (flat-back) M4 Carbine receiver extension and may vary depending on tube manufacturer. NOTE: There are two basic sizes of M4 Carbine receiver extensions (buffer tubes): Mil-Spec and Commercial-Spec. The DT Carbine Stock will only fit with the common Mil-Spec tube.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-dt-carbine-stock-mil-spec-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-dt-carbine-stock-mil-spec-r-30.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-trigger-guard-r-33.jpgitem.optacticalgear-pagem4arupgrades49MAG01522.9521.8Magpul Enhanced Aluminum Trigger Guard (R)Magpul111The Enhanced Trigger Guard is an aluminum drop in replacement for the M16/AR15 weapons platform. It features a shallow “V” shape for better use of gloves in tactical shooting or cold weather operations. The Enhanced Trigger Guard is non-folding, has rounded edges, and fills the annoying “gap” at the rear of the standard trigger guard.1https://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-trigger-guard-r-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-trigger-guard-r-40.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-ejection-port-cover-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-ejection-port-cover-r-44.jpgcustom-itemoptacticalgear-pagem4arupreandp49MAG120614.9514.2Magpul Enhanced Ejection Port Cover (R)Magpul111The Enhanced Ejection Port Cover is a drop-in upgrade designed to provide an improved installation process, physical strength, and corrosion resistance over the standard USGI ejection port cover. Traditional stamped-steel ejection ports are malleable, prone to corrosion, and require tools to install. The Enhanced Ejection Port Cover snaps into place easily without having to remove your hand guard or barrel nut, wind any loose springs, or adjust small e-clips. Constructed of impact-resistant injection molded polymer, it is corrosion resistant and will not bend or deform from impacts. Compatible with USGI-pattern AR15 upper receivers that accept USGI ejection port covers Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-ejection-port-cover-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-ejection-port-cover-r-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-esk-selector-ar-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-esk-selector-ar-17.jpgcustom-itemoptacticalgear-pagem4arupgrades49MAG125449.95Magpul ESK Selector - ARMagpul111Designed for Mil-Spec AR-pattern lower receivers. Not compatible with select fire receivers. Three user-configurable levers for ambidextrous use Reversible steel axle allows for 60 or 90-degree selector throw Constructed of high-strength polymer and corrosion-resistant steel Easy drop-in installation Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-esk-selector-ar-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-esk-selector-ar-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-blue-mirror-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-blue-mirror-43.jpgcustom-itemoptacticalgear-pagemagpuleyewear49MAG11470012020149139Magpul Explorer - Black Frame - Polarized Bronze Lens - Blue MirrorMagpul111thprcanexyou14RUGGED AND RELIABLE
- Casual style includes a more relaxed wrap & flexibility at the temples for all-day wear
- Outstanding impact resistance, even at low temperatures
- Chemical and stress-crack resistant
- UV resistant SIMPLE LOOK, ADVANCED PROTECTION
- Though not rated to Z87.1 due to the wrap and shape of the Explorer, the lens and frames were engineered to the same ballistic impact protection standards as our other eyewear
- Lenses provide high velocity impact protection
- Frames are constructed of TR90NZZ, combining lightweight construction with dependable ballistic protection PREMIUM FEATURES BUILT IN
- Oleophobic treatment of lenses provides liquid & other chemical protection + scratch resistance
- Anti-reflective coating on inside of lenses minimizes distracting reflections
- Coated stainless steel pins provide simple but dependable hinge functionality COMFORTABLE AND COMPATIBLE WITH YOU AND YOUR GEAR
- Padded low profile temples integrate smoothly under helmets, communication headsets and over the ear hearing protection while providing comfort with rubber nose and temple pads
- Rubber nose and temple pads are overmolded to the frame for durability
- Frames and lenses suited for medium-sized faces ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-blue-mirror-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-blue-mirror-56.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-gold-mirror-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-gold-mirror-43.jpgcustom-itemoptacticalgear-pagemagpuleyewear49MAG11470012030139129Magpul Explorer - Black Frame - Polarized Bronze Lens - Gold MirrorMagpul111thprcanexyou15RUGGED AND RELIABLE
- Casual style includes a more relaxed wrap & flexibility at the temples for all-day wear
- Outstanding impact resistance, even at low temperatures
- Chemical and stress-crack resistant
- UV resistant SIMPLE LOOK, ADVANCED PROTECTION
- Though not rated to Z87.1 due to the wrap and shape of the Explorer, the lens and frames were engineered to the same ballistic impact protection standards as our other eyewear
- Lenses provide high velocity impact protection
- Frames are constructed of TR90NZZ, combining lightweight construction with dependable ballistic protection PREMIUM FEATURES BUILT IN
- Oleophobic treatment of lenses provides liquid & other chemical protection + scratch resistance
- Anti-reflective coating on inside of lenses minimizes distracting reflections
- Coated stainless steel pins provide simple but dependable hinge functionality COMFORTABLE AND COMPATIBLE WITH YOU AND YOUR GEAR
- Padded low profile temples integrate smoothly under helmets, communication headsets and over the ear hearing protection while providing comfort with rubber nose and temple pads
- Rubber nose and temple pads are overmolded to the frame for durability
- Frames and lenses suited for medium-sized faces ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-gold-mirror-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-gold-mirror-56.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-gray-lens-silver-mirror-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-gray-lens-silver-mirror-43.jpgcustom-itemoptacticalgear-pagemagpuleyewear49MAG11470011110139129Magpul Explorer - Black Frame - Polarized Gray Lens - Silver MirrorMagpul111thprcanexyou13RUGGED AND RELIABLE
- Casual style includes a more relaxed wrap & flexibility at the temples for all-day wear
- Outstanding impact resistance, even at low temperatures
- Chemical and stress-crack resistant
- UV resistant SIMPLE LOOK, ADVANCED PROTECTION
- Though not rated to Z87.1 due to the wrap and shape of the Explorer, the lens and frames were engineered to the same ballistic impact protection standards as our other eyewear
- Lenses provide high velocity impact protection
- Frames are constructed of TR90NZZ, combining lightweight construction with dependable ballistic protection PREMIUM FEATURES BUILT IN
- Oleophobic treatment of lenses provides liquid & other chemical protection + scratch resistance
- Anti-reflective coating on inside of lenses minimizes distracting reflections
- Coated stainless steel pins provide simple but dependable hinge functionality COMFORTABLE AND COMPATIBLE WITH YOU AND YOUR GEAR
- Padded low profile temples integrate smoothly under helmets, communication headsets and over the ear hearing protection while providing comfort with rubber nose and temple pads
- Rubber nose and temple pads are overmolded to the frame for durability
- Frames and lenses suited for medium-sized faces ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-gray-lens-silver-mirror-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-gray-lens-silver-mirror-56.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-eyewear-36.jpgcustom-itemoptacticalgear-pagesugo1maexblfrpogrmaexblfrpobr1maexblfrpobrmarafdefrpogmarablfrpobr1https://s.turbifycdn.com/aah/optacticalgear/magpul-eyewear-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-eyewear-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-gl-enhanced-magazine-well-for-glock-19-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-gl-enhanced-magazine-well-for-glock-19-r-46.jpgcustom-itemoptacticalgear-pagestweliandmo49MAG9X024.9523.7Magpul GL Enhanced Magazine Well for Glock 19 (R)Magpul111Reduced capacity 10 rd factory Glock magazines have several dimensional differences which may interfere with any magazine well, including the Magpul GL Enhanced Magazine Well.. Some combinations of certain pistol production lots may have slight interference with older (greater than 10 years old) generations of Glock factory magazines, and some aftermarket base plates may not fit. FEATURES:
• Fits G19, G23, G32, G38
• Gen 3 and 4 Models available
• Large ramp area for easier reloading
• External dimensions ensure minimal printing when carrying concealed
• Reinforced polymer construction
• Compatible with Magpul, and most OEM or aftermarket magazine floor plates
• Compatible with most common after-market magazine extensions
• Easy installation
• Not compatible with factory Glock reduced capacity 10 rd magazines Made in U.S.A.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-gl-enhanced-magazine-well-for-glock-19-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-gl-enhanced-magazine-well-for-glock-19-r-60.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-hand-stop-kit-r-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-hand-stop-kit-r-41.jpgcustom-itemoptacticalgear-pagemamsy49MAG60824.9523.75Magpul M-LOK Hand Stop Kit (R)Magpul111FEATURES
-Light weight, low-profile M-LOK slot index point for improved weapon control
-Forward stop to prevent the shooter’s hand from reaching the hot front sight assembly or muzzle
-Aggressive TSP Texture for enhanced weapons control ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-hand-stop-kit-r-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-hand-stop-kit-r-55.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-qd-sling-mount-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-qd-sling-mount-r-53.jpgcustom-itemoptacticalgear-pageramoslat49MAG60619.9518.95Magpul M-LOK QD Sling Mount (R)Magpul111-Mounts to all M-LOK compatible hand guards and forends
-Accepts any push-button QD swivel as well as the Magpul QDM
-Machined from Mil-Spec annodized aluminum for durability and light weight
-Beveled edges reduce snagging
-Anti-rotation design prevents swivels from spinning SPECIFICATIONS
-Weight: 0.5 oz.
-Length, Max: 1.3 in..
-Width, Max: 0.6 in.
-Height, From Surface of Hand Guard: 0.4 in. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-qd-sling-mount-r-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-qd-sling-mount-r-67.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-1-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-1-r-44.jpgcustom-itemoptacticalgear-pagemamsy49MAG60216.9516.1Magpul M-LOK Rail Cover - Type 1 (R)Magpul111Includes two Covers per package. Features:
• 9.5” in length
• Compatible with all M-LOK systems
• Enhanced gripping surface
• Includes two Covers per package
• Low profile and light weight Made in U.S.A.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-1-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-1-r-58.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-covers-type-2-half-slot-24.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-covers-type-2-half-slot-22.jpgcustom-itemoptacticalgear-pagemamsy49MAG136515.95Magpul M-LOK Rail Covers - Type 2 Half Slot Magpul1111https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-covers-type-2-half-slot-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-covers-type-2-half-slot-35.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-afg-angled-fore-grip-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-afg-angled-fore-grip-r-44.jpgcustom-itemoptacticalgear-pagemamsy49MAG59826.9525.6Magpul M-LOK™ AFG® - Angled Fore Grip (R)Magpul111The Magpul M-LOK AFG (Angled Fore Grip) is the result of research and refinements done to the original AFG and AFG-2. By integrating the direct-attach M-LOK mounting system with minimalist construction we were able to produce a high strength grip that only weighs 1.2 ounces, including hardware. Allowing for a wider range of mounting location options, the M-LOK AFG is ¾" shorter than the AFG-2 while maintaining a similar gripping surface area. Even though the M-LOK AFG is more compact than its predecessors it continues to take into account natural body mechanics to provide a comfortable and stable user interface that reduces fatigue and allows for more precise weapon control. By positioning the shooter's hand high on the centerline of the bore, unlike conventional vertical fore grips, the M-LOK AFG helps mitigate recoil and control the weapon to facilitate faster, more accurate follow-up shots. All hardware necessary for attachment directly to M-LOK Slots on either aluminum or polymer hand guards and forends is included. Made in U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-afg-angled-fore-grip-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-afg-angled-fore-grip-r-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-mvg-vertical-grip-r-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-mvg-vertical-grip-r-45.jpgcustom-itemoptacticalgear-pagemamsy49MAG59722.9521.8Magpul M-LOK™ MVG® Vertical Grip (R)Magpul111The M-LOK MVG is a light weight, inexpensive vertical foregrip that attaches directly to M-LOK compatible hand guards and forends with no additional Picatinny rails required. Made from the same high quality polymer as other Magpul products, the M-LOK MVG uses the new Magpul TSP texture for positive control in all environments. With rounded contours and a shorter length, it has been optimized for use with the "thumb break method" of shooting and can also be used as a traditional vertical foregrip. All hardware necessary for attachment directly to M-LOK Slots on either aluminum or polymer hand guards and forends is included. Made in U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-mvg-vertical-grip-r-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-mvg-vertical-grip-r-59.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-polymer-rails-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-polymer-rails-35.jpgcustom-itemoptacticalgear-pagemamsy49MAG59X10.9510.4Magpul M-LOK™ Polymer Rails (R)Magpul111Designed for use with all M-LOK compatible Hand Guards and Forends, M-LOK Polymer Rail Sections provide a cost effective method of attaching various 1913 Picatinny spec rail-mounted accessories such as lights, vertical grips, etc. Injection molded from a proprietary reinforced composite for enhanced strength and durability while remaining lightweight, Rail Sections also feature beveled ends to reduce snagging and eliminate sharp corners and edges. All hardware necessary for attachment directly to M-LOK Slots on either aluminum or polymer hand guards and forends is included. 3 Slots, max overall length of 1.6 in. 5 Slots, max overall length of 2.5 in. 7 Slots, max overall length of 3.3 in. 9 Slots, max overall length of 4.1 in. 11 Slots, max overall length of 4.9 in. Made in U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-polymer-rails-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-polymer-rails-45.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-2-m-lok-slot-system-r-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-2-m-lok-slot-system-r-47.jpgcustom-itemoptacticalgear-pagemamsy49MAG60312.9512.3Magpul M-LOK™ Rail Cover Type 2 M-LOK Slot System (R)Magpul111M-LOK Type 2 Rail Covers are low-profile, two-piece covers that install directly onto most M-LOK aluminum hand guards (non polymer). These M-LOK Covers are non-orientation specific which allow the user to mount them in any direction desired without affecting function, feature beveled contours to minimize potential snagging, utilizes our TSP texture for additional grip, and protrudes only slightly more than 1/8" from the mounting surface to maintain a low-profile. The center locking tab is pre-scored to allow the user to snap off sections and mix and match colors for a customized look. Includes six panels, each covering one M-LOK slot. Made in U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-2-m-lok-slot-system-r-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-2-m-lok-slot-system-r-61.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-3-rear-sight-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-3-rear-sight-16.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG116759.9556.95Magpul MBUS 3 Rear Sight (R)Magpul111Features
• The MBUS 3 Rear Sight sits at standard AR-height when deployed and includes a windage adjustable, rapid-select aperture system.
• Ambidextrous push-button deployment and rapid-select rear aperture system
• 0.55” high when folded and 1.38” wide at widest point
• Standard AR-height when deployed
• Polymer construction, smaller size provides light weight and resists operational abuse
• Clamps to most MIL-STD-1913 PICATINNY RAILS
• Made in the USA. Technical Specifications
• Position: Rear
• Height above rail, stowed: ~0.55 in.
• Platform: AR10, AR15, M4, M16, M110, SR25
• Weight, w/ hardware: 1 ounce
• Other Specs: Center of aperture to top of rail: 1.41 in.
WINDAGE ADJUSTMENT
~0.5 MOA (0.606”/100m) per click with a 14.5" sight radius
~0.4 MOA (0.439”/100 m) per click with a 20" sight radius]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-3-rear-sight-25.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-3-rear-sight-26.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-front-r-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-front-r-60.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG27594.9590.2Magpul MBUS Pro - Back-Up Sight – Front (R)Magpul111• All steel construction
• Case hardened and finished with a ferritic nitrocarburizing process for extreme resistance to wear and corrosion
• Mounts on any MIL-STD-1913 Picatinny/STANAG 4694 rail including receiver-height gas blocks
• Elevation adjustment knob – no tools required
• Positive detents in both the up and down positions as well as on the elevation knob
• Standard AR sight height when deployed Specifications
• MBUS Pro – Front
• Weight, w/ hardware: 1.51 oz.
• Height above rail, stowed: ~0.43" max
• Length, stowed: 1.6" Color: black Front Sight only. Rear Sight sold separately.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-front-r-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-front-r-74.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-rear-r-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-rear-r-60.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG276114.95109.2Magpul MBUS Pro - Back-Up Sight – Rear (R)Magpul111• All steel construction
• Case hardened and finished with a ferritic nitrocarburizing process for extreme resistance to wear and corrosion
• Mounts on any MIL-STD-1913 Picatinny/STANAG 4694 rail
• Windage adjustable with low-profile knob – no tools required
• Positive detents in both the up and down positions
• Standard AR sight height when deployed Specifications:
• MBUS Pro – Rear
• Weight, w/ hardware: 1.80 oz.
• Height above rail, stowed, at mid-point: ~0.37"
• Length, stowed: 2.1"
• Aperture height over rail: 1.41"
• Small aperture dia.: 0.07"
• Large aperture dia.: 0.19" Color: black Rear Sight only. Front Sight sold separately.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-rear-r-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-rear-r-74.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-front-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-front-r-42.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG52599.9594.95Magpul MBUS Pro Offset Sight - Front (R)Magpul111-All steel construction
-Case hardened and finished with Melonite QPQ™ for extreme resistance to wear and corrosion
-Mounts on any MIL-STD-1913 Picatinny/STANAG 4694 rail including receiver-height gas blocks
-Elevation adjustment knob – no tools required
-Positive detents in both the up and down positions as well as on the elevation knob
-Standard AR height over bore when deployed, 45 deg. offset right-hand side
-Weight, w/ hardware: 1.8 oz.
-Height above rail at clamp: ~0.18"
-Length, stowed: 1.9" ELEVATION ADJUSTMENT ~1 MOA (1.131"/100m) per click with a 14.5" sight radius ~0.7 MOA (0.820"/100m) per click with a 20" sight radius Color: black ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-front-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-front-r-56.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-rear-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-rear-r-42.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG526119.95113.95Magpul MBUS Pro Offset Sight - Rear (R)Magpul111-All steel construction
-Case hardened and finished with Melonite QPQ™ for extreme resistance to wear and corrosion
-Mounts on any MIL-STD-1913 Picatinny/STANAG 4694 rail
-Windage adjustable with low-profile knob – no tools required
-Positive detents in both the up and down positions
-Standard AR height over bore when deployed, 45 deg. offset right-hand side SPECIFICATIONS: MBUS Pro Offset – Rear
-Weight, w/ hardware: 2.0 oz.
-Height above rail at clamp: ~0.18"
-Length, stowed: 2.0"
-Small aperture dia.: 0.07"
-Large aperture dia.: 0.19" WINDAGE ADJUSTMENT:
~0.5 MOA (0.566"/100m) per click with a 14.5" sight radius
~0.4 MOA (0.410"/100m) per click with a 20" sight radius This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-rear-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-rear-r-56.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-front-r-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-front-r-51.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG24739.9537.95Magpul MBUS® Sight Front (R)Magpul111FEATURES
-Impact resistant polymer construction provides light weight and resists operational abuse
-Spring-loaded flip up sight easily activated from either side or by pressing the top
-Detent and spring pressure keeps sight erect but allows for unobstructed folding under impact, etc.
-Clamps to most any MIL-STD-1913 Picatinny/STANAG 4694 railed hand guard* and provides the same height-over-bore as standard A2 irons
-Protective wings shield the spring-locking A2 front sight post
-Elevation adjustment tool included, but most aftermarket A2 front sight adjustment tools may be used as well SPECIFICATIONS
-Weight, w/ hardware: 1.2 oz.
-Height above rail, stowed: ~0.51 in.
-Length, stowed: 2.6 in.
-Length, deployed: 1.5 in. ELEVATION ADJUSTMENT
- ~1.6 MOA (1.886"/100m) per click with a 14.5" sight radius
- ~1.2 MOA (1.367"/100m) per click with a 20" sight radius *NOTE:
Cannot be mounted to a railed gas block due to excess heat issues. Front MBUS must be mounted to a railed fore end on the same plane as the receiver rail. Because of this the sight is also not compatible with MOE Hand Guards.
]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-front-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-front-r-65.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-rear-r-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-rear-r-51.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG24857.9549.95Magpul MBUS® Sight Rear (R)Magpul111FEATURES
-Impact resistant polymer construction provides light weight and resists operational abuse
-Spring-loaded flip up sight easily activated from either side or by pressing the top
-Detent and spring pressure keeps sight erect but allows for unobstructed folding under impact, etc.
-Clamps to MIL-STD-1913 Picatinny/STANAG 4694 receiver rail and provides the same height-over-bore as standard A2 irons
-Protective wings shield the dual, same plane flip apertures
-Sight can still be folded with either large or small aperture in position
-Detent knob easily and positively adjusts windage SPECIFICATIONS
-Weight, w/ hardware: 1.3 oz.
-Height above rail, stowed: ~0.51 in.
-Center of aperture to top of rail: 1.42 in.
-Length, stowed: 2.6 in.
-Length, deployed: 1.5 in. WINDAGE ADJUSTMENT
- ~0.7 MOA (0.754"/100m) per click with a 14.5" sight radius
- ~0.5 MOA (0.547"/100m) per click with a 20" sight radius ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-rear-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-rear-r-65.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-grip-ar15-m16-r-40.jpgitem.optacticalgear-pagem4accessories49MAG41624.9523.7Magpul MOE + Grip AR15/M16 (R)Magpul111The MOE+ Grip combines reinforced polymer body construction with comfortable, wrap-around rubber overmolding for maximum weapon control in adverse environments. With a similar shape to a 'medium' sized MIAD, this AR15/M16 drop-in design features a hard-polymer bottom edge to reduce the possibility of equipment snags or grip damage. The MOE+ Grip accepts optional storage cores for gear stowage and includes a basic grip cap. All mounting hardware included. NOTE: This grip will function properly with 7.62 NATO AR10/SR25 style of rifles but, depending on the make of the rifle, may or may not leave a gap between the 'beaver tail' and the receiver. This gap is purely aesthetic and will not affect function. Made in U.S.A. 1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-grip-ar15-m16-r-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-grip-ar15-m16-r-50.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-ar15-m16-grip-r-43.jpgitem.optacticalgear-pagem4accessories49MAG41519.9518.95Magpul MOE AR15/M16 Grip (R)Magpul111The Magpul Original Equipment Grip (MOE) is a cost-effective drop-in replacement for the standard pistol grip on AR15/M16 rifles. Designed with improved ergonomics and an anti-slip texture, the MOE Grip accepts standard Magpul MIAD storage cores, and is compatible with the Magpul Enhanced Aluminum Trigger Guard. Will not work with AR10® / SR25 style rifles without modification. MOE Grip includes a basic core plug and installation hardware. Features: • Hand-filling beavertail and positive anti-slip texture • One-piece construction sized the same as a MIAD grip with the A1 style (F1) front-strap and medium (B2) back-strap • Basic storage core cap is replaceable with standard MIAD cores Specifications • Weight: .182 pounds Colors: Flat Dark Earth, Olive, Black1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-ar15-m16-grip-r-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-ar15-m16-grip-r-53.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-enhanced-trigger-guard-polymer-ar15-m4-r-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-enhanced-trigger-guard-polymer-ar15-m4-r-17.jpgcustom-itemoptacticalgear-pagem4arupgrades49MAG11869.959.45Magpul MOE Enhanced Trigger Guard Polymer - AR15/M4 (R)Magpul111The MOE (Magpul Original Equipment) Enhanced Trigger Guard is a polymer drop-in replacement for the AR15 / M4 weapons platform. This upgraded trigger guard is easily installed without the use of specialized tools, using three set screws to secure it to the lower receiver. This eliminates the need to install a roll pin with a hammer and punch and greatly reduces the chance of any damage to the receiver due to improper installation or out-of-spec receivers. The MOE Enhanced Trigger Guard has an ergonomic and enlarged design to accommodate use with gloves or when shooting in cold environments and fills the annoying "gap" at the rear of the standard trigger guard. Also works well with most 7.62x51 AR platforms, but some custom fitting may be required. All mounting hardware included. Made in the U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-enhanced-trigger-guard-polymer-ar15-m4-r-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-enhanced-trigger-guard-polymer-ar15-m4-r-31.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-grip-ar15-m4-r-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-grip-ar15-m4-r-17.jpgcustom-itemoptacticalgear-pagem4accessories49MAG52220.9519.9Magpul MOE K2 Grip AR15/M4 (R)Magpul111Technical Specifications
• Platform: AR10, AR15, M4, M16, M110, SR25
• Grip Angle: 17 degrees
• Height, receiver to bottom: 4.1 in.
• Thickness, max: 1.2 in.
• Weight, w/ hardware: 2.9 oz.
• Other Specs: *NOTE: This grip will function properly with 7.62 NATO AR10/SR25 style of rifles but, depending on the make of the rifle, may or may not leave a gap between the backstrap's 'beaver tail' and the receiver. This gap is purely aesthetic and will not affect function.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-grip-ar15-m4-r-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-grip-ar15-m4-r-31.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-xl-grip-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-xl-grip-46.jpgcustom-itemoptacticalgear-pagem4accessories49MAG116523.9522.75Magpul MOE K2-XL GripMagpul111Technical Specifications
•Approximately 25% larger than MOE-K2 Grip
•More vertical angle provides optimal hand position for modern shooting techniques
•Design supports proper trigger finger placement
•Not compatible with current grip cores Made in the U.S.A.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-xl-grip-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-xl-grip-60.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-rvg-rail-vertical-grip-r-39.jpgitem.optacticalgear-pagepiraandgesmr49MAG41224.9523.7Magpul MOE RVG Rail Vertical Grip (R)Magpul111Designed for use with milspec 1913 Picatinny rail hand guards, the RVG is a basic, light weight, cost-effective vertical fore grip. Shape is ergonomically designed for use as a traditional vertical grip. It has also been optimized for use with the "thumb break method" of shooting as taught by Magpul DynamicsSM. Includes a custom fitted universal mounting rail and all mounting hardware. Made in U.S.A. Colors: Flat Dark Earth, Olive, Black1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-rvg-rail-vertical-grip-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-rvg-rail-vertical-grip-r-49.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-carbine-stock-mil-spec-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-carbine-stock-mil-spec-r-46.jpgcustom-itemoptacticalgear-pagem4arbuttstocks49MAG34764.9561.7Magpul MOE SL Carbine Stock Mil-Spec (R)Magpul111FEATURES
-Mounts on mil-spec sized carbine receiver extension tube (not included) from manufacturers such as Colt, LMT, Ruger, S&W, SIG, and others
-Sloping cheek weld combines a slim profile with user comfort
-Dual-side release latch provides easy adjustment while remaining anti-snag
-Premium chrome-silicon lock spring provides positive locking and long service life
-Internal anti-rattle feature minimizes wobble on receiver extension tube
-Rubber butt-pad offers an anti-slip surface and increases impact protection
-Rollover on the toe allows for easier shoulder transitions and better fit when using body armor
-Compatible with Magpul ASAP®, ASAP® QD, and other receiver-mount sling attachments -Sling Mounts:
-Rear – Integral push-button QD swivel sling mount accommodates up to 1.5" swivels (ambidextrous)
-Rear/Bottom - 1.25" sling loop Made in U.S.A. NOTE: This stock is meant for Mil-Spec receiver extensions/buffer tubes only. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-carbine-stock-mil-spec-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-carbine-stock-mil-spec-r-60.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-grip-ar15-m4-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-grip-ar15-m4-r-42.jpgcustom-itemoptacticalgear-pagem4accessories49MAG53920.9519.9Magpul MOE SL Grip AR15/M4 (R)Magpul111FEATURES
-Replacement for AR15/M4 pistol-grip*
-More vertical grip angle than standard A2 grips
-Beavertail backstrap for enhanced ergonomics
-Slimmer thickness for a slightly smaller feel
-Aggressive TSP texture (Trapezoidal Surface Projections) for positive weapon control in all environments SPECIFICATIONS
-MOE SL Grip
-Weight, w/hardware: 2.8 oz.
-Height, receiver to bottom: 4.0 in.
-Thickness, max: 1.1 in. *NOTE: This grip will function properly with 7.62 NATO AR10/SR25 style of rifles but, depending on the make of the rifle, may or may not leave a gap between the backstrap's 'beaver tail' and the receiver. This gap is purely aesthetic and will not affect function. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-grip-ar15-m4-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-grip-ar15-m4-r-56.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-ms4-dual-qd-sling-gen2-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-ms4-dual-qd-sling-gen2-45.jpgcustom-itemoptacticalgear-pagesiposl49MAG51869.9566.95Magpul MS4 Dual QD Sling GEN2Magpul111Features
-Heavy-duty push-button QD sling swivels for both one and two-point attachment
-Durable, precision-cast steel QD D-Ring allows for quick transition from one to two-point mode and is finished with Melonite for extreme resistance to wear and corrosion
-Custom 1.25 inch wide nylon webbing material is strong and wear resistant while remaining anti-chaff for user comfort
-Low-profile adjustment Slider for adding or removing sling tension in two-point mode with a single-hand
-Colored webbing has Near Infrared (NIR) treatment to reduce IR signature Sling Mounting -REAR/FRONT - Compatible with buttstocks, end plates, receivers, and hand guards that have a QD socket as well as the Magpul ASAP®-QD, RSA®-QD, MSA™-QD, and shotgun Forward Sling Mounts This Item is Excluded from Limited Sale Coupon Codes ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-ms4-dual-qd-sling-gen2-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-ms4-dual-qd-sling-gen2-59.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-15-gl9-glock-19-magazine-r-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-15-gl9-glock-19-magazine-r-49.jpgcustom-itemoptacticalgear-pagemainco49MAG55014.9514.2Magpul PMAG 15 GL9 - GLOCK 19 Magazine (R)Magpul111-Compatible with all compact and sub-compact 9mm Glock handguns
-Durable, lightweight, and extremely stiff polymer construction
-High visibility controlled-tilt follower
-Long life stainless steel spring for corrosion resistance
-Flared, easily removable floor plate
-Dot matrix panel for magazine marking and identification
-Full magazine indicator windows on both sides of body
-Drops free loaded or unloaded Color: black This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-15-gl9-glock-19-magazine-r-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-15-gl9-glock-19-magazine-r-61.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-17-gl9-glock-g17-r-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-17-gl9-glock-g17-r-58.jpgcustom-itemoptacticalgear-pagemainco49MAG54614.9514.2Magpul PMAG 17 GL9 – GLOCK G17 (R)Magpul111This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-17-gl9-glock-g17-r-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-17-gl9-glock-g17-r-70.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-21-gl9-glock-9x19mm-parabellum-r-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-21-gl9-glock-9x19mm-parabellum-r-36.jpgcustom-itemoptacticalgear-pagemainco49MAG66119.9518.95Magpul PMAG 21 GL9 – GLOCK 9x19mm (R)Magpul111FEATURES
-Compatible with all full-size, compact, and sub-compact 9mm double-stack Glock handguns
-Durable, lightweight, and extremely stiff polymer construction
-High visibility controlled-tilt follower
-Long life stainless steel spring for corrosion resistance
-Flared, easily removable floor plate
-Dot matrix panel for magazine marking and identification
-Magazine indicator windows on both sides of body at 10, 15, and 21 rounds remaining
-Drops free loaded or unloaded This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-21-gl9-glock-9x19mm-parabellum-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-21-gl9-glock-9x19mm-parabellum-r-45.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m2-moe-5-56x45mm-nato-r-43.jpgcustom-itemoptacticalgear-pagemainco49MAG57112.9512.3Magpul PMAG 30 AR/M4 GEN M2 MOE 5.56x45mm NATO (R)Magpul111FEATURES
-Impact and crush resistant polymer construction
-Constant-curve internal geometry for smooth feeding
-Anti-tilt, self-lubricating follower for increased reliability
-USGI-spec stainless steel spring for corrosion resistance and field compatibility
-Textured gripping surface and flared floorplate for positive magazine handling and easy disassembly This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m2-moe-5-56x45mm-nato-r-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m2-moe-5-56x45mm-nato-r-51.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-r-67.jpgcustom-itemoptacticalgear-pagemainco49MAG55714.9514.2Magpul PMAG 30 AR/M4 GEN M3 (R)Magpul111• Next-generation impact and crush resistant polymer construction
• Modified dimensions allow for wider compatibility with non Colt-spec platforms
• Constant-curve internal geometry for smooth feeding
• Anti-tilt, self-lubricating follower for increased reliability
• Long life USGI-spec stainless steel spring
• Over-travel insertion stop on the spine
• Ribbed gripping surface and new aggressive front and rear texture for positive magazine handling
• Paint pen dot matrix panels on the bottom of the body to allow for identification marking
• Flared floorplate aids magazine handling and disassembly yet is slim enough for use with many double and triple pouches
• Pop-off Impact/Dust Cover to minimize debris intrusion and for additional protection in storage and transit Made in the USA. NOTE - Sand color is a very light shade of tan. It is designed so the user can dye or spray paint the magazine to a desired color/pattern. This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-r-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-r-75.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-window-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-window-r-62.jpgcustom-itemoptacticalgear-pagemainco4955617.9517.05Magpul PMAG 30 AR/M4 GEN M3 - WINDOW (R)Magpul111• Next-generation impact and crush resistant polymer construction
• Modified dimensions allow for wider compatibility with non Colt-spec 'STANAG 4179' platforms
• Constant-curve internal geometry for smooth feeding
• Anti-tilt, self-lubricating follower for increased reliability
• Long life USGI-spec stainless steel spring, black-oxide coated (MIL-DTL-13924D)
• Anti-glare translucent MagLevel windows on both sides of the body along with a painted indicator on the spring allows for easy determination of rounds remaining from 1 to 30
• Over-travel insertion stop on the spine
• Ribbed gripping surface and new aggressive front and rear texture for positive magazine handling
• Paint pen dot matrix panels on the bottom of the body to allow for identification marking
• Flared floorplate aids magazine handling and disassembly yet is slim enough for use with many double and triple pouches
• Pop-off Impact/Dust Cover to minimize debris intrusion and for ammunition protection in storage and transit This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-window-r-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-window-r-74.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-d-60-ar-m4-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-d-60-ar-m4-45.jpgcustom-itemoptacticalgear-pagemainco49MAG576134.95128.2Magpul PMAG D-60 AR/M4 (R)Magpul111This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-d-60-ar-m4-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-d-60-ar-m4-54.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-black-frame-polarized-bronze-lens-gold-mirror-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-black-frame-polarized-bronze-lens-gold-mirror-34.jpgcustom-itemoptacticalgear-pagemagpuleyewear49MAG11450011110125115Magpul Radius - Black Frame - Polarized Gray Lens - Silver Mirror - Ballistic RatedMagpul111thprcanexyou19RUGGED AND RELIABLE
- Designed to combine rugged strength and flexibility with maximum overall coverage
- Outstanding impact resistance, even at low temperatures
- Chemical and stress-crack resistant
- UV resistant SUPERIOR PROTECTION
- The lens and frame combination of the Radius is ballistic rated to Z87+ and MIL-PRF 32432 standards
- Lenses meet high velocity impact protection and safety ratings
- Frames are constructed of TR90NZZ, combining lightweight construction and extreme ballistic protection PREMIUM FEATURES BUILT-IN
- Oleophobic treatment of lenses provides liquid & other chemical protection + scratch resistance.
- Anti-reflective coating on inside of lenses minimizes distracting reflections
- Coated stainless steel pins provide simple but dependable hinge functionality COMFORTABLE AND COMPATIBLE WITH YOU AND YOUR GEAR
- Padded low profile temples integrate smoothly under helmets, communication headsets and over the ear hearing protection while providing comfort with rubber nose and temple pads
- Rubber nose and temple pads are overmolded to the frame for durability
- Fits medium to large faces]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-radius-black-frame-polarized-bronze-lens-gold-mirror-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-black-frame-polarized-bronze-lens-gold-mirror-44.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-radius-fde-frame-polarized-gray-lens-silver-mirror-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-fde-frame-polarized-gray-lens-silver-mirror-34.jpgcustom-itemoptacticalgear-pagemagpuleyewear49MAG11452451110125115Magpul Radius - FDE Frame - Polarized Gray Lens - Silver Mirror - Ballistic RatedMagpul111thprcanexyou20RUGGED AND RELIABLE
- Designed to combine rugged strength and flexibility with maximum overall coverage
- Outstanding impact resistance, even at low temperatures
- Chemical and stress-crack resistant
- UV resistant SUPERIOR PROTECTION
- The lens and frame combination of the Radius is ballistic rated to Z87+ and MIL-PRF 32432 standards
- Lenses meet high velocity impact protection and safety ratings
- Frames are constructed of TR90NZZ, combining lightweight construction and extreme ballistic protection PREMIUM FEATURES BUILT-IN
- Oleophobic treatment of lenses provides liquid & other chemical protection + scratch resistance.
- Anti-reflective coating on inside of lenses minimizes distracting reflections
- Coated stainless steel pins provide simple but dependable hinge functionality COMFORTABLE AND COMPATIBLE WITH YOU AND YOUR GEAR
- Padded low profile temples integrate smoothly under helmets, communication headsets and over the ear hearing protection while providing comfort with rubber nose and temple pads
- Rubber nose and temple pads are overmolded to the frame for durability
- Fits medium to large faces]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-radius-fde-frame-polarized-gray-lens-silver-mirror-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-fde-frame-polarized-gray-lens-silver-mirror-44.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-rail-sling-attachment-r-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-rail-sling-attachment-r-51.jpgitem.optacticalgear-pageramoslat49MAG50229.9528.45Magpul RSA - Rail Sling Attachment (R)Magpul111The RSA provides a forward sling attachment point for the Magpul MS2 or MS3 and other clip-in systems. Made from precision cast black manganese phosphatized steel, the RSA attaches to any MIL-STD-1913 Picatinny/STANAG 4694 rail. The RSA has been proven to withstand stress tests of over 300 pounds yet weighs a mere 1.26 ounces. Made in U.S.A. Features •All cast steel construction •Mil-spec black manganese phosphate finish •Works on any standard 1913 Picatinny-spec rail1https://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-rail-sling-attachment-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-rail-sling-attachment-r-65.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-qd-rail-sling-attachment-qd-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-qd-rail-sling-attachment-qd-17.jpgcustom-itemoptacticalgear-pageramoslat49MAG33729.9528.45Magpul RSA QD - Rail Sling Attachment QDMagpul111Details
• Compatible with 1913 rails
• Low Profile, Unobtrusive Design - The RSA's design is optimized for comfortable two-point sling use while maintaining easy push-button access
• Secure Attachment Point - Provides a forward sling attachment point for the MS4 and other QD swing swivel systems Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-qd-rail-sling-attachment-qd-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-qd-rail-sling-attachment-qd-30.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-tejas-gun-belt-el-original-1-5-inch-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-tejas-gun-belt-el-original-1-5-inch-47.jpgcustom-itemoptacticalgear-pageriggersbelts49MAG73394.9590.2Magpul Tejas El Original Hybrid Gun Belt 2.0Magpul111Made in the USA. FEATURES:
• Top grade bullhide leather exterior layer and supportive but flexible reinforced polymer interior
• Gun belt rigidity with dress belt comfort offers stretch and sag free performance
• Removable chrome plated buckle with branded "tool-free" fasteners
• Standard 1.5" wide and 0.25" thick to fit most belt loops and holsters
• Eight holes with 3/4" spacing for a wide yet precise adjustment range BELT SIZING:
DO NOT order your waist size or pants size! Lay an existing belt out flat and from where the leather folds at the point where the buckle is attached, measure to the hole that you typically use. Please remember when ordering to take into account any holster or accessory that may be worn. For in-between measurements use the next size up as our belts will not stretch over time. We size our belts from the fold in the leather to the #5 adjustment hole. CARE AND MAINTENANCE:
While the inner polymer layer of our belt is largely maintenance free, the outer layer will need to be cared for like any other quality leather item.
• Do not roll up your belt unnecessarily tight when not in use
• When putting your belt on, avoid bending it back over the buckle more than 90 degrees when tightening as this may strain the leather and weaken the stitching
• While our belts will not stretch due to the reinforced polymer inner layer, avoid using leather softeners such as Neatsfoot or Mink oil
• If necessary, a quality paste-style leather preservative may be used to maintain the leather surface
• If the surface is ever scratched down to the natural beige leather the appropriate shade of shoe polish will help restore the color ]]>
1https://s.turbifycdn.com/aah/optacticalgear/magpul-tejas-gun-belt-el-original-1-5-inch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-tejas-gun-belt-el-original-1-5-inch-57.jpgMagpul
https://s.turbifycdn.com/aah/optacticalgear/magpul-wck-wire-control-kit-m-lok-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-wck-wire-control-kit-m-lok-17.jpgcustom-itemoptacticalgear-pagemamsy49MAG129619.95Magpul WCK - Wire Control Kit - M-LOKMagpul111The Magpul WCK (Wire Control Kit) provides a fast, secure, and clean way to manage light and laser wires to create a more streamlined forend on your rifle. The WCK ships with six easy-to-install M-LOK-compatible assemblies. Each assembly is a half-slot size to allow for precise positioning and can route cables straight through, at 90 degrees, or at 180 degrees to accommodate different variations. This kit can be reconfigured as your setup changes, removing the need to reapply tape or zip ties. The WCK is compatible with metal M-LOK handguards and may not fit all polymer handguards. The WCK can route standard gauge cables. Designed and intended for light/laser cable management Half-slot size allows for precise positioning Can be reconfigured multiple times Six (6) assemblies per package Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/magpul-wck-wire-control-kit-m-lok-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-wck-wire-control-kit-m-lok-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-modular-rail-covers-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-modular-rail-covers-61.jpgitem.optacticalgear-pagepiraandgesmr49MAG41011.9511.35Magpul XTM Enhanced Rail PanelsMagpul111 The XTM Enhanced Rail Panels are low-profile, two-piece covers that attach anywhere on a 1913 Picatinny rail without having to remove previously mounted accessories. Replacing the original XTM Panels, The Enhanced XTM Panels feature an aggressive anti-slip texture and dual-side routing clips for retention of light/laser cables. The design and reinforced material construction ensure the panels will remain in place under all operating conditions, but allows for easy removal using the tips of two rounds when necessary. Each set comes with four (4) two-piece panels which will cover ONE side of a carbine rail. Made in U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-modular-rail-covers-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-modular-rail-covers-71.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-hand-stop-kit-1913-picatinny-r-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-hand-stop-kit-1913-picatinny-r-47.jpgcustom-itemoptacticalgear-pagepiraandgesmr49MAG51119.9518.95Magpul XTM Hand Stop Kit 1913 Picatinny (R)Magpul111This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-hand-stop-kit-1913-picatinny-r-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-hand-stop-kit-1913-picatinny-r-61.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/marco-demo-video-11.jpglink.blfogetebepo1https://s.turbifycdn.com/aah/optacticalgear/marco-demo-video-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/marco-demo-video-10.jpglink.blfogemamali1https://s.turbifycdn.com/aah/optacticalgear/mayflower-velocity-systems-chest-rigs-30.jpgcustom-itemoptacticalgear-pagevestsMayflower / Velocity Systems Chest Rigs1mauwchriggenmapuuwgenvipmauwgenvspfrma5hychrigexmaremedpofmauwgenivert1https://s.turbifycdn.com/aah/optacticalgear/mayflower-velocity-systems-chest-rigs-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-velocity-systems-chest-rigs-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-groin-protector-carrier-with-level-iiia-soft-armor-r-46.jpgitem.optacticalgear-pagedysoar50VS-DP-MF180173Mayflower / Velocity Systems LE Groin Protector with Level IIIA Soft Armor (R)Mayflower111• Fits: Mayflower Low Profile Armor and Assault Carriers (LPAC and LPAAC)
• Attachment: Quick Release Buckles
• Size Carrier: One Size
• All materials and workmanship are 100% made in the USA Dyneema Ballistic Specifications:
• NIJ Certified: Type/Level III-A
• Ballistic Material: 100% Dyneema
• Ballistic Panel Thinness: 0.22 inches
• Weight: 0.99 lbs./sq.ft
• Fragmentation: Meets/Exceeds USSOCOM & IOTV requirements Made in the USA. O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. There are no returns or exchanges on body armor items This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-groin-protector-carrier-with-level-iiia-soft-armor-r-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-groin-protector-carrier-with-level-iiia-soft-armor-r-53.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-24-hour-assault-pack-fixed-shoulder-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-24-hour-assault-pack-fixed-shoulder-44.jpgcustom-itemoptacticalgear-pageassaultpacks50MF-APF143134Mayflower 24 Hour Assault Pack - Fixed ShoulderMayflower111This model also includes adjustable shock cord on the front face (Not Pictured) for compression and to stow an outer garment for easy accessibility. Features:
• Lightweight and slim for CQB environments
• 24 hour dismounted operations
• Standalone assault pack with fixed shoulder straps
• Sleeve and hanger for 2L (50oz.) hydration bladder (not included); small hose pass thru slot at the top of the pack
• Small cell phone / sensitive items pocket
• PALS webbing on exterior sides for adding additional pouches
• All buckles are ITW-Nexus IR
• Dimensions: L16”x W9”x D5”
• Volume: Approximately 10 Liters Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-24-hour-assault-pack-fixed-shoulder-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-24-hour-assault-pack-fixed-shoulder-60.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-48-hour-assault-pack-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-48-hour-assault-pack-44.jpgcustom-itemoptacticalgear-pageassaultpacks50MF-49FS184159Mayflower 48 Hour Assault PackMayflower111• 3 storage pockets
• Breathable Mesh with padding along the backside of the pack
• Padded shoulder straps with soft tweave stretch material on the inner face for added comfort
• Removable sternum strap
• Internal water bladder pocket
• Internal zipper pocket for small accessories
• Open top bottle pocket on the right side includes a bungee cord with adjustable loop to slip over the top of water bottles for extra security with quick access
• 3 rows of PALS webbing on left side
• Small section of velcro loop for patches or IFF
• Side tension straps to compress unused space in the pack
• Dimensions: L18”x W11”x D6”
• 100% Made in the USA]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-48-hour-assault-pack-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-48-hour-assault-pack-60.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-5-56-hybrid-chest-rig-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-5-56-hybrid-chest-rig-41.jpgcustom-itemoptacticalgear-pagemavesychri50MF-CR7187172Mayflower 5.56 Hybrid Chest RigMayflower111• Low profile, light weight general purpose chest rig
• Carries four 5.56mm magazines (6.8mm or similar sized)
• Three general purpose pouches
• Three rows of PALS webbing on sides of chest rig
• Built in map pocket with a VELCRO® Brand closure
• Loops to route antennas, wires and hydration bladder tubing
• Four one inch ITW-Nexus side release buckles
• Designed to mount to front of Low-Profile Armor Carrier
• Comes with the new gen adjustable-height Standard H-Harness with vertical loops for PTT's (Pictured is the old gen)
• 100% Made in the USA ]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-5-56-hybrid-chest-rig-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-5-56-hybrid-chest-rig-55.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-apc-with-mesh-padding-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-apc-with-mesh-padding-57.jpgcustom-itemoptacticalgear-pagemarcasplcaaa50MF-PC276239.99Mayflower APC with Mesh PaddingMayflower111litoswplandr1Custom Patterns in Multicam Arid, Multicam Tropic, and M81 Woodland available in limited quantities! The Mayflower / Velocity Systems Assault Plate Carrier (APC) is designed to provide the wearer with a high degree of mobility while providing ample surface area for mounting mission essential pouches. The upper front of the APC contains an integral admin pouch with internal elastic loops to retain pens, pencils, chemlites or similar items. There is an additional pocket in front of the admin pouch to hold quick access documents like maps/index cards. The front lower half of the APC has a kangaroo pouch sized to hold up to three M4 sized magazines. A triple M4 pouch insert is available separately to fit this integrated pouch. This vest is also SwiftClip compatible to quickly attach chest rigs and placards. New slimline should pads are made from stretchable Tweave material that allows for slings, hydration tubing and communications wiring to fit through the pad easily. Slim design for greater range of motion and less chafing along neck line. Foam padding for comfort on the underside of pad. The APC features removable SwiftClip® Buckles on the front panel and velcro loop on the 3 rows of MOLLE along the bottom half of the front panel of the carrier to allow the individual to mount various chest rigs and placards directly to the carrier. This configuration allows the individual to use the same loadout with or without armor or have multiple chest rigs configured for different mission requirements. Cummerbund Features:
• Integrated PALS webbing
• Inner side of cummerbund features elastic pockets on each side to hold M4 mags, radios, tourniquets, etc.
• Cummerbund is made to Soft armor inserts, and can also fit thin 6x6 inch side plates in a separate pocket (may require an additional retainer strap to secure the top of a hard plate). Use same size Velocity Systems soft armor cummerbund insert as the size of the cummerbund.
• Adjustable for different waist sizes and features elastic ends for some stretch to allow easy breathing. Plate Sizing:
The APC is available in two sizes; Small/Medium and Large/XLarge. The plate pockets are sized to accommodate stand alone or in-conjunction SAPI or Swimmer cut plates. The S/M APC will fit small and medium SAPI, or Shooter/Swimmer Cut 10”x12” sized plates. The L/XL APC will fit large and extra-large SAPI plates. Cummerbund Sizing:
Cummerbund has a wide range of adjustment, when in doubt go with the larger cummerbund size, as your armor will increase the diameter of the carrier once inserted. Most users who wear a Medium SAPI plate will need the Medium Cummerbund.

• Small Cummerbund: 5 Columns of MOLLE per side (Normally Small SAPI Plate Users)
• Medium Cummerbund: 6 Columns of MOLLE per side (Normally Medium or Large SAPI Plate Users)
• Large Cummerbund: 8 Columns of MOLLE per side (Normally Large or XL SAPI Plate Users) Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-apc-with-mesh-padding-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-apc-with-mesh-padding-70.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-assault-back-panel-type-1-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assault-back-panel-type-1-69.jpgitem.optacticalgear-pageassaultpacks50VS-MF-BP-XX182176Mayflower Assault Back Panel Type 1 MOD 2 - Helium WhisperMayflower111The Assault Back Panel Type 1 Mod 2 HW features Blue Force Gear's Helium Whisper ultra-light weight backing for greater weight savings and a slimmer profile. Designed to carry the minimum amount of kit for a short duration dismounted mission. The main body has been redesigned to carry a greater variety of 50-70 oz water bladders; the upper zippered pouch is designed to hold the SOCOM issued NVG protective insert, the bottom pouch is designed as a re-moveable medical pouch. The re-moveable medical pouch features internal elastic retainers, a flat Velcro external pouch and elastic on the bottom to hold a tourniquet. Small velcro loop square is sewn on the pouch for adding a Red Cross patch. The attachment is via the PALS compatible Helium Whisper system. All workmanship is 100% made in the USA. Fabric: 500D Cordura, Helium Whisper backing material.1https://s.turbifycdn.com/aah/optacticalgear/mayflower-assault-back-panel-type-1-80.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assault-back-panel-type-1-81.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assaulter-arm-board-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assaulter-arm-board-54.jpgitem.optacticalgear-pagewrdoho50VS-AAB-MF4037.99Mayflower Assaulter Arm BoardMayflower111The Assaulter Arm Board is designed to have schematics, target photos or comms procedures readily available. The Assaulter Arm Board provides three viewable surfaces; a flap which is viewable on both sides and the base. All materials and workmanship are 100% made in the USA. Material: 500D Cordura1https://s.turbifycdn.com/aah/optacticalgear/mayflower-assaulter-arm-board-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assaulter-arm-board-68.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-cummerbund-pals-22.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-cummerbund-pals-with-6-x-6-plate-pocket-37.jpgitem.optacticalgear-pagecaac150VS-CBN384Mayflower Cummerbund - MOLLE VersionMayflower111Sizing: Based on Chest Measurement (measure from under your arm pits), if you are in between sizes or need more space, go up to the larger size.
-Small (32”-44”): 5 columns of MOLLE per side
-Medium (40”-50”): 6 columns of MOLLE per side
-Large (44”-54”): 8 columns of MOLLE per side
-X-Large (50”-60”): 10 columns of MOLLE per side There is a wide amount of adjustment on the cummerbunds. All materials and workmanship are 100% made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-cummerbund-pals-with-6-x-6-plate-pocket-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-cummerbund-pals-with-6-x-6-plate-pocket-45.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-hodge-defense-universal-case-96.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-hodge-defense-universal-case-95.jpgcustom-itemoptacticalgear-pageblah50MF-HGC249219.95Mayflower Hodge Defense Universal Case V2Mayflower111What is the difference between V1 and V2?
With the growing popularity of LPVOs among end users, OPT had Mayflower add a middle strap to the bag, due to billowing created by the larger optics. Universal Case Options:
• Universal Case Only: Just the rifle case
• Universal Case and Hodge Bolt Carrier Group - Chrome Carrier Key Model Package Deal: Get 10% off both items when bundled together! (you save over $40 when bundled) Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-hodge-defense-universal-case-104.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-hodge-defense-universal-case-105.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-armor-carrier-89.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-armor-carrier-88.jpgitem.optacticalgear-pagemaveclqaco50 VS-CMF-LPAC268232Mayflower Low Profile Armor Carrier with Divider CummerbundMayflower111litolpsoar1Now includes the Low-Profile Elastic Cummerbund with Dividers (2 Divider Pockets per side)! The Mayflower Low-Profile Armor Carrier (LPAC) is designed to provide the wearer with a high degree of mobility while providing an acceptable amount of soft armor coverage, or both soft and hard armor coverage. The hard armor plates are contained in pockets attached to the outside of the soft armor carrier allowing the soft armor to mold to the wearers body for long duration mission comfort. The back side of the front panel features elastic retainers for routing wires. The Low-Profile Armor Carrier features webbing for use with Removable ITW-Nexus SwiftClip Buckles on the front of the vest to allow the individual to mount various Chest Rigs and Placards directly to the carrier. This configuration allows the individual to use the same loadout with or without armor or have multiple chest rigs configured for different mission requirements. The vest also includes a front kangaroo pouch that accepts our magazine inserts. The LPAC comes with a Low-Profile Elastic Cummerbund and features removable buckles to attach a groin/lap panel (sold separately). All materials and workmanship are 100% made in the USA. Features:
• Features 3D spacer mesh padding along the inner face of the plate pockets for comfort and ventilation
• Compatible with SwiftClip Chest Rigs and Placards (SwiftClips on the front are removable)
• Low-Profile Elastic Cummerbund with Dividers for quick don/doff and secure fit while moving/fighting, also ensures no interference with duty belt access. Cummerbund features 2 x Divider Pockets per side to fit M4 sized mags, radios, medical and other similar sized items. Can be replaced with the Mayflower MOLLE Cummerbund (sold separately) for load and armor carriage
• Integrated Drag Handle
• MOLLE webbing along the lower rear portion of the carrier for attaching IFAK/Medical Kit and other mission essentials
• Stretchable shoulder pads made from soft Tweave material offer greater range of motion and less chafing along the neck line. Foam padding for comfort on the underside of the pad, with the ability to run wiring and tubes through the pad itself
• Material: 500D Cordura This vest is designed to fit proprietary soft armor inserts (see link below). Some other brands of soft armor may fit depending on size. Approximate dimensions of front and back panels:
Medium:
• Front Panel: Height Lowest part of the V portion of the neck = 14”, Height Tallest part of the V portion = 15.5”
• Front Panel Thinnest Width = 11", Widest Width = 22”
• Back Panel: Height = 16"
• Back Panel: Thinnest Width = 12", Widest Width =” x 22.5” Large:
• Front Panel: Height Lowest part of the V portion of the neck = 14.5”, Height Tallest part of the V portion = 16”
• Front Panel Thinnest Width = 11", Widest Width = 24.5”
• Back Panel: Height = 17"
• Back Panel: Thinnest Width = 12.5", Widest Width = 24.5” XL:
• Front Panel: Height Lowest part of the V portion of the neck = 15”, Height Tallest part of the V portion = 17”,
• Front Panel Thinnest Width = 11.5", Widest Width = 26.5”
• Back Panel: Height = 18"
• Back Panel: Thinnest Width = 13", Widest Width =” x 26” ]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-armor-carrier-99.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-armor-carrier-100.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-assault-armor-carrier-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-assault-armor-carrier-69.jpgitem.optacticalgear-pagemaveclqaco50 VS-CMF-LPAAC335285Mayflower Low-Profile Assault Armor Carrier with Mesh PaddingMayflower111litolpsoarThis vest now includes 3D spacer mesh padding along the inner face of the front and back panels for comfort and ventilation! The Low-Profile Assault Armor Carrier (LPAAC) is designed to provide the wearer with a high degree of mobility while providing an acceptable amount of armor coverage. The hard armor plates are contained in pockets attached to the outside of the soft armor carrier allowing the soft armor to mold to the wearers body for long duration mission comfort. The front panel wings contain 3 rows x 3 columns of MOLLE webbing on the front side to secure radio pouches and other close to the body gear, and small elastic retainers on the back side to route wiring. The cummerbund is adjustable to allow for climatic changes and also for girth adjustments for the wearing of side armor plates. The cummerbund has integral pockets for 6" x 6" hard armor side plates and inner features elastic pockets on each side to hold M4 mags, radios, tourniquets and other similar sized gear. The LPAAC features removable SwiftClip® Buckles and velcro loop on the front of the vest to allow the individual to mount various chest rigs and placards directly to the carrier. This configuration allows the individual to use the same loadout with or without armor or have multiple chest rigs configured for different mission requirements. All materials and workmanship are 100% made in the USA. Also features removable buckles to attach a groin/lap panel (sold separately). Material: 500D Cordura Soft Tweave Stretch Padded Shoulder Sleeves now included. This vest is designed to fit proprietary soft armor inserts (see link below). Some other brands of soft armor may fit depending on size. Approximate dimensions of front and back panels:
Medium:
• Front Panel: Height Lowest part of the V portion of the neck = 14”, Height Tallest part of the V portion = 15.5”
• Front Panel Thinnest Width = 11", Widest Width = 22”
• Back Panel: Height = 16"
• Back Panel: Thinnest Width = 12", Widest Width =” x 22.5” Large:
• Front Panel: Height Lowest part of the V portion of the neck = 14.5”, Height Tallest part of the V portion = 16”
• Front Panel Thinnest Width = 11", Widest Width = 24.5”
• Back Panel: Height = 17"
• Back Panel: Thinnest Width = 12.5", Widest Width = 24.5” XL:
• Front Panel: Height Lowest part of the V portion of the neck = 15”, Height Tallest part of the V portion = 17”,
• Front Panel Thinnest Width = 11.5", Widest Width = 26.5”
• Back Panel: Height = 18"
• Back Panel: Thinnest Width = 13", Widest Width =” x 26” ]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-assault-armor-carrier-80.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-assault-armor-carrier-81.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-low-vis-blowout-kit-helium-whisper-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-vis-blowout-kit-28.jpgcustom-itemoptacticalgear-pageinmedpoipo50MF-LVBOK103Mayflower Low-Vis Blowout Kit - Helium WhisperMayflower111Accessories shown not included. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-low-vis-blowout-kit-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-vis-blowout-kit-36.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-iv-ert-placard-80.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-iv-ert-placard-79.jpgcustom-itemoptacticalgear-pagemavesychri50UWGENIV-ERT203149.95Mayflower Modified Gen IV PlacardMayflower111litoswriandvCustom Patterns in Multicam Arid, Multicam Tropic, and M81 Woodland available in limited quantities! Multicam Arid, Multicam Tropic, and M81 Woodland options feature standard flap closures on the center double pistol pouches. Developed specifically for a Federal Law Enforcement Emergency Response Team, this placard is an upgraded and shortened version of the UW GEN IV Chest Rig designed work as a SwiftClip placard. This placard can directly attach to the front of any SwiftClip compatible armor carriers from Mayflower, Velocity Systems, and other companies. Features and Upgrades:
• Quad M4 Placard for holding 4 x 5.56 NATO Magazines
• Velcro-opening Admin Pocket behind the rifle magazines, large opening across the entire width and length of the placard
• 2 x Pistol Magazine pouches in the middle with flip-down flaps, which can secure open on the front of the pouches (Multicam Arid, Multicam Tropic, and M81 Woodland options feature standard flap closures on the center double pistol pouches)
• 2 x Small General Purpose Pouches for GPS units, full-size flashbangs, batteries, and other similar sized ancillaries
• 2 x Pistol/Flashlight/Multi-Tool pouches along the edges of the placard
• Elastic Retainers: 1 on each side and 2 on the bottom of the placard for securing tourniquets, antennas, etc.
• 3 x Webbing Loops along each side of the placard that can be used to secure the sides via the SwiftClip Kit (not necessary for most carriers, provides added security).
• 500D Cordura material. Back side of placard is completely velcro hook material. Placard only, all magazines and other items pictured not included. Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-iv-ert-placard-90.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-iv-ert-placard-91.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-patch-48.jpgitem.optacticalgear-pagegrpa50VSPatchMF65Mayflower PatchMayflower1111https://s.turbifycdn.com/aah/optacticalgear/mayflower-patch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-patch-57.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-quad-5-56-placard-93.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-quad-5-56-placard-91.jpgcustom-itemoptacticalgear-pagemaveclqaco50MF-Q556Plac-XX95Mayflower Quad 5.56 PlacardMayflower111Custom Patterns in Multicam Arid, Multicam Tropic, and M81 Woodland available in limited quantities! The Quad 5.56 Placard is meant to be a smaller, lighter alternative to a full chest rig, and allows the end user to quickly change weapon systems without changing the rest of his/her operational equipment (radio, PTT, med etc). The Quad 5.56 Placard holds four 5.56 magazines with an adjustable shock cord retention system. The front of the placard also has three general purpose pouches, and a loop panel on the center pouch flap for ID Patches. The placard has upward facing male buckles to clip into a SwiftClip system on the chest of the APC or LPAC/LPAAC, Velocity Systems Lightweight Place Carrier or other carriers with SwiftClip systems. The back face of the placard has hook to mate with loop on the front chest flap of the carrier. All materials and workmanship are 100% made in the USA. NOTE: Your carrier must have Swift Clip/QASM attachment points on the front panel and Velcro Loop on the front flap portion in order to secure the placard in place effectively. For Maylflower/Velocity Systems Carriers, you may need to move Swift Clips on front panel down one column of webbing for best fit. Magazines and patch not included. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-quad-5-56-placard-102.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-quad-5-56-placard-103.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-r-c-assault-plate-carrier-apc-and-accessories-79.jpgcustom-itemoptacticalgear-pageplatecarriers1maapcwimepamaveclqacomacupawi6x6p1https://s.turbifycdn.com/aah/optacticalgear/mayflower-r-c-assault-plate-carrier-apc-and-accessories-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-r-c-assault-plate-carrier-apc-and-accessories-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-small-general-purpose-pouch-helium-whisper-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-small-general-purpose-pouch-36.jpgitem.optacticalgear-pagegepuutpo50VSSGPMF3028Mayflower Small General Purpose Pouch - Helium WhisperMayflower111The Small General Purpose Pouch is designed to hold a variety of small rectangular and irregular shaped items; GPS, firing systems, signal kits, cell phone, cameras etc. All materials and workmanship are 100% made in the USA. Now featuring Blue Force Gear Helium Whisper backing and MOLLE straps for ultra-light weight and slim design. Approximate Dimensions: 5 x 3.25 x 1.5 inches1https://s.turbifycdn.com/aah/optacticalgear/mayflower-small-general-purpose-pouch-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-small-general-purpose-pouch-43.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-swift-clip-kit-35.jpgitem.optacticalgear-pagehastd3rianda50VS-Swift2219.99Mayflower SwiftClip® KitMayflower1111https://s.turbifycdn.com/aah/optacticalgear/mayflower-swift-clip-kit-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-swift-clip-kit-42.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-tourniquet-retainer-40.jpgitem.optacticalgear-pagetourniquets50VSCATMF7Mayflower Tourniquet RetainerMayflower111This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-tourniquet-retainer-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-tourniquet-retainer-49.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-triple-5-56-mag-insert-for-apc-40.jpgitem.optacticalgear-pagekapoin50VS-5.56Insert-MF-CB35Mayflower Triple 5.56 Mag Insert for APCMayflower111This item is compatible with S&S Precision Pull Tabs. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-triple-5-56-mag-insert-for-apc-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-triple-5-56-mag-insert-for-apc-49.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-chest-rig-gen-iv-117.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-chest-rig-gen-iv-115.jpgitem.optacticalgear-pagemavesychri50VSCRMF1209199Mayflower UW Chest Rig Gen IVMayflower111litoremedpofCustom Patterns in Multicam Arid, Multicam Tropic, and M81 Woodland available in limited quantities! The UW Vest Gen IV is a low-profile mission focused vest built to be ambidextrous and designed to carry the following: 4 ea 5.56mm magazines, 2 pistol magazines, up to 2 small radios (PRC-152/MBITR) as well as two GP pockets. Additionally, the H style harness features loops to route antennas, comms wires and hydration bladder tubing. Elastic is provided for cable management and antenna relocation. All buckles are ITW-Nexus IR and all materials and workmanship are 100% made in the USA. The difference between the Gen III and the Gen IV is the total detachability of the harness on the Gen IV so the vest can integrate with Mayflowers body armor carriers. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-chest-rig-gen-iv-129.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-chest-rig-gen-iv-130.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-v-split-front-chest-rig-90.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-v-split-front-chest-rig-88.jpgcustom-itemoptacticalgear-pagemavesychri50MF-CR9-XX287Mayflower UW GEN V Split Front Chest RigMayflower1112 x Double 5.56 inserts
2 x Double 7.62x51 inserts
2 x Double 7.62x39 inserts
1 x Zipper pocket top insert
1 x IFAK insert Magazines and medical bandages not included. Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-v-split-front-chest-rig-101.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-v-split-front-chest-rig-102.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mayflower-pusher-uw-gen-vi-pusher-chest-rig-91.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-pusher-uw-gen-vi-pusher-chest-rig-90.jpgcustom-itemoptacticalgear-pagemavesychri50MF-UW-GenVI240Mayflower UW Gen VI "Pusher" Chest RigMayflower111Custom Patterns in Multicam Arid, Multicam Tropic, and M81 Woodland available in limited quantities! The Pusher Chest Rig (UW GEN VI) was designed as a no frills load carriage solution for individuals that had a very specific load out to carry but also had to be able to quickly switch weapon platforms. The Pusher was designed to carry the following: issue radio (PRC-152, PRC-148, Motorola, or others), four rifle magazines (M4, 7.62x51 or 7.62x39 utilizing different inserts), pistol magazine, med kit or SAT Antenna and a multitude of smaller items in the front four pouches. The body features an internal map pocket. The shoulder straps are 3" wide to provide longer term comfort during extended mountain patrolling and are adjustable for height on the front of the straps. All buckles are ITW-Nexus and all materials and workmanship are 100% made in the USA. Shoulder Strap height is adjusted by removing the detachable female-end Swift Clip buckles and re-attaching to the webbing at desired height. Chest Rig includes:
2 x Double 5.56 inserts
2 x Double 7.62x51 inserts
2 x Double 7.62x39 inserts
1 x Quad-fold IFAK insert
1 x GP Zipper Pocket top insert Material: 500D Cordura body, Hypalon shoulder straps.
NOTE - Multicam-Tropic colors feature 500D Cordura Shoulder Straps. Magazines, radios, patches and medical bandages not included. Made in the USA. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/mayflower-pusher-uw-gen-vi-pusher-chest-rig-100.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-pusher-uw-gen-vi-pusher-chest-rig-101.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-hot-tamale-less-lethal-coin-purse-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-hot-tamale-less-lethal-coin-purse-41.jpgcustom-itemoptacticalgear-pageknandsh11410-HT-XX36.95Mean Gene Leather Hot Tamale V1 Coin PurseMean Gene Leather111The legality of owning, carrying or using this product depends on state and local laws and ordinances. Each consumer should be familiar with the state and local laws in the consumer’s jurisdiction before purchasing, carrying or using this product. Note - Brown color option is shown in the smaller inset picture labeled as "Brown" (lighter color).]]>1https://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-hot-tamale-less-lethal-coin-purse-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-hot-tamale-less-lethal-coin-purse-51.jpgMean Gene Leatherhttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-shooters-belt-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-shooters-belt-55.jpgcustom-itemoptacticalgear-pageriggersbelts1142150BX89.9580.95Mean Gene Leather Shooters Belt - Double StitchedMean Gene Leather111-1.5 width
-Double Stitched for Strength, stitching color matches belt color. **Sizing is determined by size of pants you wear. We take in consideration of added lengths to assure proper fit. For best results in sizing, determine your pants waist size from a new pair of blue jeans as they are more accurate. Waistbands of worn pants tend to stretch.** Hand made in the USA by the man himself.]]>
1https://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-shooters-belt-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-shooters-belt-65.jpgMean Gene Leather
https://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-victory-aegis-belt-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-victory-aegis-belt-68.jpgcustom-itemoptacticalgear-pageriggersbelts1143150XX125115Mean Gene Leather Victory Aegis Belt - Gen 2 Buckle - Double StitchedMean Gene Leather111New Gen 2 Polymer Buckles are now being used. All metal Gen 1 buckles are not manufactured anymore. Gen 2 buckles are much lighter in weight and do not jingle while dawning. Also more Airport friendly. The MGL “Victory Aegis” Belt utilizes the Ares Gear LLC. Aegis Buckle. These belts are constructed with a dual layer of top grain leather. Giving a desirably stable belt to support holsters-either OWB or IWB- yet comfortable to the feel. Its combination of the two layers of 7/8oz and 8/9oz leather delivers just over a 1/4” thickness. The Victory Aegis belt is reinforced between the two layers to add strength and reduce the amount of stretching as time passes. Each layer is laminated together with industrial strength adhesives, as well as sewn together with #277 bonded threads. Chicago screws to secure the Aegis buckle. The MGL Victory Aegis belt is handmade using US leather. The outer layer is dyed while the inner layer has a clear finish. Finally, the edges are burnished, edge dyed and the belt is then rubbed down by hand with Ray Holes Saddle Butter. Available only in 1.5″ width. **Sizing is determined by size of pants you wear. We take in consideration of added lengths to assure proper fit. For best results in sizing, determine your pants waist size from a new pair of blue jeans as they are more accurate. Waistbands of worn pants tend to stretch.** Features:
• Stitching: Double Stitch
• Thread Color: Matches belt color
• Reinforced between leather layers for sturdy gun belt level stiffness
• New Gen 2 Polymer Buckle for reduced weight and noise Hand made in the USA by the man himself.]]>
1https://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-victory-aegis-belt-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-victory-aegis-belt-78.jpgMean Gene Leather
https://s.turbifycdn.com/aah/optacticalgear/mechanix-fastfit-gloves-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-fastfit-gloves-62.jpgcustom-itemoptacticalgear-pagegloves44MFF19.9917.49Mechanix FastFit GlovesMechanix Wear111FEATURES 1. Form-fitting TrekDry® material with MultiCam® camouflage helps keep hands cool and comfortable. 2. Elastic cuff provides a secure fit with easy on/off flexibility. 3. Reinforced thumb and index finger provide added durability. 4. Durable synthetic palm. 5. Anatomically designed two-piece palm eliminates material bunching. 6. Nylon cord loop provides convenient glove storage. 7. Machine washable. ]]>1https://s.turbifycdn.com/aah/optacticalgear/mechanix-fastfit-gloves-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-fastfit-gloves-76.jpgMechanix Wearhttps://s.turbifycdn.com/aah/optacticalgear/mechanix-original-glove-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-original-glove-66.jpgitem.optacticalgear-pagegloves44MG31.9926.99Mechanix Original GloveMechanix Wear111Designed and manufactured to take on the toughest tasks you can throw at it, our Original Glove provides a winning combination of versatility and performance. The Clarino Synthetic Leather palm and fingertips extends the life of the glove while the Thermal Plastic Rubber hook and loop cuff closure and two-way stretch Spandex top provides a perfect fit. Imported Sizing: Small = 8 Medium = 9 Large = 10 XLarge = 11 2XLarge = 12 Large picture is Multicam color, small picture is Camo color.1https://s.turbifycdn.com/aah/optacticalgear/mechanix-original-glove-79.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-original-glove-80.jpgMechanix Wearhttps://s.turbifycdn.com/aah/optacticalgear/mechanix-specialty-0-5mm-tactical-gloves-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-specialty-0-5mm-tactical-gloves-44.jpgcustom-itemoptacticalgear-pagegloves44MSD-72-XXX3529.99Mechanix Specialty 0.5mm Tactical GlovesMechanix Wear111• Low-profile Thermoplastic Rubber (TPR) closure provides a secure fit to the wrist.
• Lightweight TrekDry® conforms to the back of the hand to reduce heat build-up and perspiration.
• Anatomical stitch darts conform to the natural curvature of the hand to create a precision fit.
• Expandable flex joints improve trigger finger mobility.
• High-dexterity 0.5mm AX-Suede™ provides precision feel and high dexterity.
• Nylon carrier loops.
• Machine washable. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/mechanix-specialty-0-5mm-tactical-gloves-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-specialty-0-5mm-tactical-gloves-58.jpgMechanix Wear
https://s.turbifycdn.com/aah/optacticalgear/medical-29.jpgitem.optacticalgear-pageindexMedical / Survival1medicalpatchestourniquetsbandagesinmedpoipomedicalpackssukiandtobe7horetonarquli1https://s.turbifycdn.com/aah/optacticalgear/medical-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/medical-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/medical-packs-50.jpgitem.optacticalgear-pagemesuhyMedical Packs1spsydebagtam9asmebaGreat for all things medical, but also great for those who need their gear very well organized and retained during movement, such as EOD, Geologists, Photographers, Electronic Surveillance Teams, etc...]]>1https://s.turbifycdn.com/aah/optacticalgear/medical-packs-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/medical-packs-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/medical-patches-50.jpgcustom-itemoptacticalgear-pagepaemMedical Patches1bloodtypetapesredcrosspatchspviirmecrparedcrredcrreha4papa1https://s.turbifycdn.com/aah/optacticalgear/medical-patches-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/medical-patches-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-4-x-8-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-4-x-8-48.jpgcustom-itemoptacticalgear-pagecaac1XXCP60Microbat Systems Candy 4 x 8Microbat Systems111Velcro Hook Attachment. This is NOT a MOLLE Pouch. The Candy Pouch is the first product ever designed by Microbat Systems, being the bigger brother of the Candy Micro. The Candies dimensions are 4"x8" with a 2"x7" Loop Velcro strip on the frontside. With similar features to the Candy Micro, the Candy gives the user a larger space to work with, allowing for higher capacity storage. It is ideal for storage of batteries, chem-lights, disposable strobes, critical medical supplies and navigational information/ tools. The Candy is intended for use on the front or back of chest rigs and plate carriers, however it can also be used for compartmentalization and interior storage for packs, etc. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-4-x-8-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-4-x-8-61.jpgMicrobat Systemshttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-micro-4-x-4-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-micro-4-x-4-48.jpgcustom-itemoptacticalgear-pagecaac1XXCPM40Microbat Systems Candy Micro 4 x 4Microbat Systems111Velcro Hook Attachment. This is NOT a MOLLE Pouch. The Candy Micro is a Velcro backed 4"x4" pouch with a 4"x2" Loop Velcro strip on the frontside for identifier patches. The Candy Micro has nearly unlimited uses, Micro's can fill roles of exterior organization of critical items on Chest Rigs and Plate Carriers, compartmentalization inside backpacks or supplemental storage on the upper sleeves of combat shirts. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-micro-4-x-4-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-micro-4-x-4-61.jpgMicrobat Systemshttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-mid-4-x-6-36.jpgcustom-itemoptacticalgear-pagecaac1XXCPMM50Microbat Systems Candy Mid 4 x 6Microbat Systems111Velcro Hook Attachment. This is NOT a MOLLE Pouch. The Candy Mid is the Middle Size Candy, Intermediately Between the Candy and Candy Micro. The Mid's dimensions are 4"x6" with a 2"x6" Loop Velcro strip on the frontside. With similar features to the Candy Micro and Candy, the Candy Mid gives the End User an Admin Compatible Pouch for Most Plate Carriers, It's ideal for storage of batteries, chem-lights, disposable strobes, critical medical supplies and navigational information/ tools. The CandyMid is intended for use on the front or back of chest rigs and plate carriers, however it can also be used for compartmentalization and interior storage. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-mid-4-x-6-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-mid-4-x-6-45.jpgMicrobat Systemshttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-chameleon-wrap-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-chameleon-wrap-48.jpgcustom-itemoptacticalgear-pageshvescbaXXCW40Microbat Systems Chameleon WrapMicrobat Systems111 Designed to Quickly and Efficiently Change the Figure and Pattern of the End Users Weapon System, Chameleon Wrap uses High Strength Elastic Bungee Loops and Hooks to Quickly Attach to Any Part of the Front and Rear end of the Weapon. If Multiple Chameleon Wraps Are bought they can be Changed to a Mix of Color ways to Best Fit the End Users Environment. Length: approximately 5 feet Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/microbat-systems-chameleon-wrap-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-chameleon-wrap-62.jpgMicrobat Systemshttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-vampire-flathead-counterweight-31.jpgcustom-itemoptacticalgear-pageheacandweXXVFC60Microbat Systems Vampire Flathead CounterweightMicrobat Systems111This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/microbat-systems-vampire-flathead-counterweight-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-vampire-flathead-counterweight-40.jpgMicrobat Systemshttps://s.turbifycdn.com/aah/optacticalgear/military-morons-write-up-11.jpglink.crpraiheta3h1https://s.turbifycdn.com/aah/optacticalgear/military-morons-write-up-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/military-morons-write-up-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-g-i-3-pack-t-shirts-for-issued-uniforms-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-g-i-3-pack-t-shirts-46.jpgitem.optacticalgear-pagetshirts46M280/319.9917.99MJ SOFFE Adult G.I. 3-Pack T-Shirts for Issued UniformsMJ SOFFE111The preferred T-Shirt of the military in tropical environments. Tan/OCP goes with New Scorpion Pattern ACUs, Sand goes with UCP ACUs, Olive for USMC. •Adult size •50% Cotton, 50% Polyester jersey •Lightweight 4 ounce fabric •Crewneck •Sold as a pack of 3 shirts Made in the USA1https://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-g-i-3-pack-t-shirts-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-g-i-3-pack-t-shirts-53.jpgMJ SOFFEhttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-tricot-running-shorts-ranger-panties-39.jpgitem.optacticalgear-pageshorts46M02014.9912.99MJ SOFFE Adult Tricot Running Shorts (Ranger Panties)MJ SOFFE111sizechartCommonly referred to as "Silkies" or "Ranger Panties" •Adult size •100% lightweight nylon tricot •Running short •Liner brief •Inside key pocket •2 - 2¼ inch inseam on all sizes •Covered elastic waistband •Colors: Black, Olive, Navy, Tan/OCP1https://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-tricot-running-shorts-ranger-panties-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-tricot-running-shorts-ranger-panties-49.jpgMJ SOFFEhttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-performance-shorts-33.jpgcustom-itemoptacticalgear-pageshorts46031M19.9917.99MJ SOFFE Infantry ShortsMJ SOFFE111• 100% poly Sorbtek shell
• 100% poly liner brief
• Moisture management technology
• Dries 4 times faster than cotton
• 4 way stretch fabric
• 4" inseam
• Inside ID pocket]]>
1https://s.turbifycdn.com/aah/optacticalgear/mj-soffe-performance-shorts-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-performance-shorts-40.jpgMJ SOFFE
https://s.turbifycdn.com/aah/optacticalgear/keeppower-18350-1200mah-protected-button-top-2-pack-36.jpgcustom-itemoptacticalgear-pagebach135183502PK20Modlite 18350 1200mAh Protected Button Top - 2 PackModlite111Specifications:
- Typical Capacity: 1200 mAh
- Nominal Voltage: 3.6V
- Discharge End Voltage: 2.5V
- Protection Circuit (Against over charge, over discharge, over current and short-circuit.) Dimensions:
- (L) 38.1 mm x (D)18.6 mm Warnings:
- Do not overdischarge/overcharge
- Recharge drained batteries ASAP
- Do not short circuit
- Do not dispose of in fire
- Do not expose to extreme heat or water
- Please be familiar with handling lithium-ion batteries before purchase. Please note: Due to the nature of this consumable product, no returns are allowed unless the product is defective upon receipt. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/keeppower-18350-1200mah-protected-button-top-2-pack-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/keeppower-18350-1200mah-protected-button-top-2-pack-43.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-18350-body-package-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-18350-body-package-34.jpgcustom-itemoptacticalgear-page15offmodlite13518350BDY72Modlite 18350 BodyModlite111This light body is ONLY compatible with the Surefire® Scout Light M600DF KE2-DF head. It is approximately 1.25 inches shorter and about 1.5oz lighter than a M600DF body with battery. This allows for additional rail space especially on SBR and pistol builds. The Modlite 18350 light body is compatible with Surefire® z68, Modlite TCC tailcaps along with Surefire® UE and DS00 tail caps. It will also fit in any aftermarket Scout mount, as it retains the mounting holes and square lug interface on the underside of the light body. Modlite recommends Arisaka Defense mounts which can be found at OPT. CAUTION: This light body accepts 18350 cells only. Lithium CR123 cells are NOT supported and if used will cause the CR123 cells to heat up and possibly explode or catch fire. If you need a charger please take a look at our Li-Ion chargers sold separately. Run time is about 35 minutes with the KE2-DF head and a freshly charged battery. 18350 Body Only. 18350 Rechargeable Battery Sold Separately. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-18350-body-package-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-18350-body-package-44.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/keeppower-18650-3500mah-protected-cell-2-pack-41.jpgcustom-itemoptacticalgear-pagebach13518650PC2PK35Modlite 18650 3500mAh Protected Cell - 2 PackModlite111Specifications:
- Nominal Capacity: 3500 mAh
- Nominal Voltage: 3.6V
- Discharge End Voltage: 2.5V
- Max. Continuous Discharging Current: 10A Dimensions:
- 69.10 mm (L) x 18.60 mm (D) Protection Circuit (Over charge, over discharge, over current, and short-circuit) Warnings:
- Do not overdischarge/overcharge
- Recharge drained batteries ASAP
- Do not short circuit
- Do not dispose of in fire
- Do not expose to extreme heat or water
- Please be familiar with handling lithium-ion batteries before purchase. Please note: Due to the nature of this is a consumable product, no returns are allowed unless the product is defective upon receipt. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/keeppower-18650-3500mah-protected-cell-2-pack-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/keeppower-18650-3500mah-protected-cell-2-pack-48.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-18650-body-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-18650-body-42.jpgcustom-itemoptacticalgear-page15offmodlite13518350BODY74Modlite 18650 BodyModlite111Lithium CR123 cells are not supported with this product unless used with our OKW Dual Fuel Head. If CR123s are used with a standard Modlite head, it will cause the cells to heat up and possibly explode or catch fire. We recommend our Modlite Protected Cells.
Weight (W/O Battery): .9 oz
Width/Diameter: 1" (no head)
Length (no tailcap): 2 1/8 " (no head)
Length + Clicky Tailcap: 4 " 18650 Body Only. 18650 Rechargeable Battery Sold Separately. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-18650-body-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-18650-body-56.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-okw-18650-light-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-okw-18650-light-65.jpgcustom-itemoptacticalgear-page15offmodlite135HHOKW18650309Modlite Handheld OKW-18650 LightModlite111• Hand assembled in and tested in the USA
• Lifetime guarantee
• Approximately 680 out the front lumens and candela is approximately 69,000. It is an excellent overall light head good for indoor or outdoor use
• Drivers are fully potted and tested.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance
• Includes 1 x 3500mAh 18650 battery
• Includes XTAR MC2 charger Dimensions:
• Length: 5 3/8" / 136.5mm
• Body Diameter: .990" / 25.1mm
• Head Diameter: 1 3/16" / 30mm CAUTION: Lithium CR123 cells are NOT supported and if used will cause the cells to heat up and possibly explode or catch fire. We recommend the KeepPower 18650 high drain cells available from OPT. Run time is about 75 minutes with the supplied 18650 cells. Color: Black This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-okw-18650-light-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-okw-18650-light-79.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-plhv2-18650-light-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-plhv2-18650-light-60.jpgcustom-itemoptacticalgear-page15offmodlite135PLHv2-HANDHELD309Modlite Handheld PLHv2-18650 LightModlite111• Cool White 5700K emitter tint
• Made and assembled in the USA
• Drivers are fully potted and tested to withstand select fire SCAR 17 recoil.
• Lifetime guarantee
• Approximately 1350 out the front lumens and candela is approximately 54,000. It is an excellent overall light head good for indoor or outdoor use.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance.
• Includes a XTAR MC2 charger Dimensions:
• Length w/ Clicky tailcap: 5 1/2" / 140mm
• Head Diameter: 1 3/16" / 30.16mm Lithium CR123 cells are not supported and if used will cause the cells to heat up and possibly explode or catch fire. We recommend the KeepPower 18650 high drain cells which can be found here. Runtime is about 75 minutes with the supplied 18650 cells. Made in the USA. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-plhv2-18650-light-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-plhv2-18650-light-74.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/15-off-modlite-42.jpgcustom-itemoptacticalgear-pagelightslasersModlite Lights and Parts1modlitepl350rmopllipar1moplliparmopllihemooklipamomookliparmookwlihemomolisuplmomolilaplmomolidulemomoligumohapllimohaoklimo18bopamo18boonehucolionehucosh1https://s.turbifycdn.com/aah/optacticalgear/15-off-modlite-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/15-off-modlite-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-dual-lead-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-dual-lead-48.jpgcustom-itemoptacticalgear-page15offmodlite135MBL2149Modlite ModButton Lite - Dual LeadModlite111NO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. ModButton Lite is a smaller, lighter-weight cousin to the original ModButton. The switch features the same momentary only activation as the original ModButton. It also features the same high power cable and switch from ModButton but in a slightly smaller package without the integrated mount. The switch is made from injection-molded plastic and fully potted to provide an extra degree of protection in harsh environments and ensures a durable long-lasting switch. The Dual Lead variant is our same Modbutton Lite, but has both a Surefire®/Modlite and Crane Laser lead. This Modbutton Lite activates both leads simultaneously, allowing for an excellent vis override functionality of both white light and visible laser. There is no way to select a single lead for activation. For that, we recommend the Unity TAPS SNYC. Available here. ModButton Lite utilizes a patented Unity Tactical design which supports power delivery needed by the next generation of high output weapon lights like Modlite. A Unity-built Surefire® compatible cable lead allows ModButton Lite to be backwardly compatible with all Surefire®, Arisaka, and Modlite Scout bodies as well as Surefire UE and DS00 tail caps. If constant on is a requirement we recommend using a SF DS00 tail cap which can be found here. One problem that exists today is older legacy switches are not able to pass the current needed to run current and future generation lights. These older switch designs do not allow Modlite light heads to run at full power. Typically these switches reduce output by 15-20%. ModButton Lite utilizes an updated plug design as well as improved electronics that allow the ModButton Lite to output at full power so all the lumens and candela can be put to good use. The package includes the switch picatinny mounting rails and mounting hardware only, no tail cap is supplied. We recommend the Surefire UE or DS00 tailcap. Note on cable length options: For almost all use cases the 4.5in variant is what you want to buy. Unless you have a special setup the 4.5 in cable is going to be plenty even running a laser. Made in the USA Specs:
• Weight: 1.8oz
• Dimensions: 1.0 × 3.8 × 5.7 in
• Mounting Side: Left or Right
• Color: Black or Tan NO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-dual-lead-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-dual-lead-62.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-laser-plug-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-laser-plug-46.jpgcustom-itemoptacticalgear-page15offmodlite13585000896512878Modlite ModButton Lite - Laser PlugModlite111NO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. Note on cable length options: For almost all use cases the 4.5 inch variant is what you want to buy. Unless you have a special setup the 4.5 inch cable is going to be plenty even running a laser. ModButton Lite is a smaller lighter weight cousin to the original ModButton. The switch features the same momentary only activation as the original ModButton. It also features the same high power cable and switch from ModButton but in a slightly smaller package without the integrated mount. The switch is made from injection molded plastic and fully potted to provide extra degree of protection in harsh environments ensures a durable long lasting switch. The plug is compatible with PEQ15, DBAL, BE Meyers® MAWL™ and Wilcox® RAIDx™ lasers. The package includes the switch PIC mounting rail and mounting hardware only. Note on cable length options: For almost all use cases the 4.5 inch variant is what you want to buy. Unless you have a special setup the 4.5 inch cable is going to be plenty even running a laser. Specs:
• Weight: 1.8 oz
• Dimensions: 1.0 × 3.8 × 5.7 in
• Mounting Side: Left or Right Made in the USA. NO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-laser-plug-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-laser-plug-60.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-surefire-modlite-plug-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-surefire-modlite-plug-44.jpgcustom-itemoptacticalgear-page15offmodlite13585000896578Modlite ModButton Lite - Surefire/Modlite PlugModlite111litosuuetaNO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. Note on cable length options: For almost all use cases the 4.5 inch variant is what you want to buy. Unless you have a special setup the 4.5 inch cable is going to be plenty even running a laser. ModButton Lite is a smaller lighter weight cousin to the original ModButton. The switch features the same momentary only activation as the original ModButton. It also features the same high power cable and switch from ModButton but in a slightly smaller package without the integrated mount. The switch is made from injection molded plastic and fully potted to provide extra degree of protection in harsh environments and ensures a durable long lasting switch. ModButton Lite utilizes a patented Unity Tactical design which supports power delivery needed by the next generation of high output weapon lights like Modlite. A Unity built Surefire® compatible cable lead allows ModButton Lite to be backwardly compatible with all Surefire®, Arisaka and Modlite Scout bodies as well as Surefire UE and DS00 tail caps. One problem that exists today is older legacy switches are not able to pass the current needed to run current and future generation lights. These older switch designs do not allow Modlite light heads to run at full power. Typically these switches reduce output by 15-20%. ModButton Lite utilizes an updated plug design as well as improved electronics that allow the ModButton Lite to output at full power so all the lumens and candela can be put to good use. The package includes the switch PIC mounting rails and mounting hardware only, no tail cap is supplied. We recommend the Surefire UE or DS00 tailcap. Note on cable length options: For almost all use cases the 4.5 inch variant is what you want to buy. Unless you have a special setup the 4.5 inch cable is going to be plenty even running a laser. Specs:
• Weight: 1.8oz
• Dimensions: 1.0 × 3.8 × 5.7 in
• Mounting Side: Left or Right Made in the USA. NO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-surefire-modlite-plug-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-surefire-modlite-plug-58.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-guards-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-guards-46.jpgcustom-itemoptacticalgear-page15offmodlite135MBLGRD1815Modlite Modbutton Lite GuardsModlite111Lite Guard ONLY. ModButton Lite Pressure Pad Sold Separately. This product is a direct replacement for the included picatinny rail clamps of the Modbutton Lite. The guards have raised sides and reduce the flat surface area of the button to ensure activation of the switch only occurs when absolutely intended. For those taking advantage of the ability to stack two Modbutton Lites together for white light and laser use, this is a great way to increase tactile feedback and to prevent white light activation when not intended. The package contains both sides of the guard set. Installation utilizes the screws and nuts that come with Modbutton Lite. Made in the USA Lite Guard ONLY. ModButton Lite Pressure Pad Sold Separately. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-guards-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-guards-60.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-light-head-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-light-head-58.jpgcustom-itemoptacticalgear-page15offmodlite135OKWLH209Modlite OKW Light Head - Dual FuelModlite111Features:
- Hand assembled in and tested in the USA.
- Lifetime guarantee
- Approximately 680 out the front lumens and candela is approximately 69,000. This light is an excellent choice for anyone needing maximum throw.
- 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
- Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dual Fuel Marked Heads: Can be powered by a 18350, 18650 or x2 CR123. Using a single CR123 Battery may cause the cells to heat up and possibly explode or catch fire. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-okw-light-head-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-light-head-68.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-modlite-okw-18350-light-package-r-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modlite-okw-18350-light-package-r-55.jpgcustom-itemoptacticalgear-page15offmodlite135OKW-18350289Modlite OKW-18350 Light PackageModlite111Compatible with Surefire Scout Mounts.
• Lifetime guarantee
• Approximately 680 out the front lumens and candela is approximately 69,000. It is an excellent overall light head good for indoor or outdoor use
• Drivers are fully potted and tested to withstand select fire SCAR 17 recoil
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance
• Includes 1 x KeepPower 1200mAh 18350 battery
• Includes XTAR MC2 charger Dimensions:
• Length w/ Clicky tailcap: 4.25" / 108mm
• Head Diameter: 1 3/16" / 30.16mm Made in the USA. CAUTION: Lithium CR123 cells are NOT supported and if used will cause the cells to heat up and possibly explode or catch fire. We recommend the KeepPower 18350 high drain cells available from OPT. Run time is about 35 minutes with the supplied 13650 cells. Types:
Complete Light: includes Light with Clicky Tailcap (momentary and constant on), Recharger, 1 x 18350 KeepPower Rechargeable Battery
Light with No Tailcap: includes Light without Tailcap ready for use with with Tape Switches and Caps, Recharger, 1 x KeepPower 18350 Rechargeable Battery Made in the USA. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-modlite-okw-18350-light-package-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modlite-okw-18350-light-package-r-65.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-okw-18650-light-package-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-18650-light-package-57.jpgcustom-itemoptacticalgear-page15offmodlite135OKW18650289Modlite OKW-18650 Light Package - Dual FuelModlite111Compatible with Surefire Scout Mounts.
• Lifetime guarantee
• Approximately 680 out the front lumens and candela is approximately 69,000. It is an excellent overall light head good for indoor or outdoor use.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dual Fuel Marked Heads: Dual Fuel 18350/18650 or x2 CR123 (18650 body only). Using a single CR123 Battery may cause the cells to heat up and possibly explode or catch fire. Types:
• Complete Light: includes: Light with Clicky Tailcap (momentary and constant on), Recharger, 1 x 18650 KeepPower Rechargeable Battery
• Light with No Tailcap: includes: Light without Tailcap ready for use with with Tape Switches and Caps, Recharger, 1 x KeepPower 18650 Rechargeable Battery Made in the USA. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-okw-18650-light-package-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-18650-light-package-67.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-pl350-r-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-pl350-r-50.jpgcustom-itemoptacticalgear-page15offmodlite135PL350319Modlite PL350 - All ModelsModlite111litoqustandhThe switch bar is now a solid injection-molded piece updated from the previous two- piece design. This one-piece design offers a significant upgrade to the durability of your light switch. Other internal changes to the switch components make for an improved tactile feel. Features:
• Modular design is compatible with all slim Modlite heads, which lets the end user customize the light output to their specific needs.
• The PL350 is designed to be compatible with current and future Modlite heads, ensuring long life and future upgrade paths.
• At launch the PL350 is well supported in the holster industry as well. Will fit Safariland 6000 series Duty Holsters designed to fit the X300 Ultra Weapon Light. See link below for more info different holsters compatibility.
Lithium CR123 cells are not supported and if used will cause the cells to heat up and possibly explode or catch fire. We recommend our Modlite Protected Cells. Available Models: With or Without XTAR Charger Included PLHv2:
• 5700 Kelvin color temperature
• 1350 Lumens
• 54,000 Candela
• This model is the best all around, with both spill and long throw. If you are unsure which model to buy, we recommend this version. OKW:
• 5800 Kelvin color temperature
• 680 Lumens
• 69,000 Candela
• This model is designed for rural and outdoor use, where maximum throw is required. This head can still be used in close quarters but will have a brighter hot spot. Made in the USA. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-pl350-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-pl350-r-60.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-light-head-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-light-head-46.jpgcustom-itemoptacticalgear-page15offmodlite135PLHV2-HEAD209Modlite PLHv2 Light Head - Dual FuelModlite111• Cool White 5700K emitter tint
• Made and assembled in the USA
• Drivers are fully potted and tested to withstand select fire SCAR 17 recoil.
• Lifetime guarantee
• Approximately 1350 out the front lumens and candela is approximately 54,000. It is an excellent overall light head good for indoor or outdoor use.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dimensions:
• Length w/ Clicky tailcap: 5 1/2" / 140mm
• Head Diameter: 1 3/16" / 30.16mm
• Weight: 2.26oz Made in the USA. Dual Fuel Marked Heads: Can be powered by a 18350, 18650 or x2 CR123. Using a single CR123 Battery may cause the cells to heat up and possibly explode or catch fire. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-light-head-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-light-head-56.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18350-light-package-r-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18350-light-package-r-55.jpgcustom-itemoptacticalgear-page15offmodlite135PLH-18350v2289Modlite PLHv2-18350 Light PackageModlite111• Cool White 5700K emitter tint
Compatible with Surefire Scout Mounts.
• Drivers are fully potted and tested to withstand select fire SCAR 17 recoil.
• Lifetime guarantee
• Approximately 1350 out the front lumens and candela is approximately 54,000. It is an excellent overall light head good for indoor or outdoor use.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dimensions:
• Length w/ Clicky tailcap: 5 1/2" / 140mm
• Head Diameter: 1 3/16" / 30.16mm Lithium CR123 cells are not supported and if used will cause the cells to heat up and possibly explode or catch fire. We recommend the KeepPower 18350 high drain cells which can be found here. Runtime is about 35 minutes with the supplied 18350 cells. Made in the USA. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18350-light-package-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18350-light-package-r-65.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18650-light-package-r-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18650-light-package-r-52.jpgcustom-itemoptacticalgear-page15offmodlite135PLHv2-18650289Modlite PLHv2-18650 Light Package - Dual FuelModlite111• Cool White 5700K emitter tint
Compatible with Surefire Scout Mounts.
• Drivers are fully potted and tested to withstand select fire SCAR 17 recoil.
• Lifetime guarantee
• Approximately 1350 out the front lumens and candela is approximately 54,000. It is an excellent overall light head good for indoor or outdoor use.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dimensions:
• Length w/ Clicky tailcap: 5 1/2" / 140mm
• Head Diameter: 1 3/16" / 30.16mm Dual Fuel Marked Heads: Dual Fuel 18350/18650 or x2 CR123 (18650 body only). Using a single CR123 Battery may cause the cells to heat up and possibly explode or catch fire. Made in the USA. Types:
• Complete Light: includes: Light with Clicky Tailcap (momentary and constant on), Recharger, 1 x 18650 KeepPower Rechargeable Battery
• Light with No Tailcap: includes: Light without Tailcap ready for use with with Tape Switches and Caps, Recharger, 1 x KeepPower 18650 Rechargeable Battery This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18650-light-package-r-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18650-light-package-r-62.jpgModlite
https://s.turbifycdn.com/aah/optacticalgear/modtac-suppressor-shield-with-universal-rail-attach-coupler-u-rac-r-26.jpghttps://s.turbifycdn.com/aah/optacticalgear/modtac-suppressor-shield-with-universal-rail-attach-coupler-u-rac-r-24.jpgcustom-itemoptacticalgear-pagenewitemsXX-18B-004339Modtac Suppressor Shield with Universal Rail Attach Coupler (U-RAC) (R)Modtac111- The Suppressor Shield with Universal Rail Attached Coupler, was designed to be compatible with all AR-style platforms that have a top Picatinny rail on the end of the free floating handguard. The Heights over bore that Modtac uses, are industry standards, to ensure proper fitment:
- AR-15: 1.215”
- AR-10: 1.345”
- HK-416: 1.460”
- SIG MCX/MPX: 2.037 The Pic-Rail Grabber is machined to be compatible with as many commercial and military rails as possible. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/modtac-suppressor-shield-with-universal-rail-attach-coupler-u-rac-r-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/modtac-suppressor-shield-with-universal-rail-attach-coupler-u-rac-r-37.jpgModtac
https://s.turbifycdn.com/aah/optacticalgear/molle-pals-webbing-belts-76.jpgitem.optacticalgear-pagebeltsMOLLE/PALS Webbing Belts / Unity Clutch Belt1fecobibeblfogechbegbgrasbesyv3raodmkiiibeeainopgunbeweainbeforopgblintrbemovehsmigrbepacrprmoribe20vesyoputbeohslaslpabeslhssupabehsslpabeatsmopawarbeatswarbeinbetwnebeskuntaclbeuntaclinkit1https://s.turbifycdn.com/aah/optacticalgear/molle-pals-webbing-belts-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/molle-pals-webbing-belts-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stroganoff-pro-pak-new-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stroganoff-pro-pak-new-57.jpgcustom-itemoptacticalgear-pagemohomemohobestprne10.99Mountain House Beef Stroganoff Pro-Pak NewMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Tender pieces of beef, tasty onions and mushrooms blended in a savory cream sauce over a bed of egg noodles. Packed with 27g of protein. With a dish this satisfying, you'll never guess that it's freeze-dried. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stroganoff-pro-pak-new-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stroganoff-pro-pak-new-72.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-biscuits-and-gravy-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-biscuits-and-gravy-43.jpgcustom-itemoptacticalgear-pagemohome12500554537.99Mountain House Biscuits and GravyMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House Biscuits and Gravy are a filling and delicious breakfast that you can enjoy anywhere, any time. Simply add hot water and you'll be ready to dig into a taste of home even if you're thousands of miles away. Made with real buttermilk biscuits, sausage patties and gravy, Mountain House Biscuits and Gravy are guaranteed to give you the fuel you need to tackle the day ahead. You won't even have to worry about packing a bowl or a plate - just add water to the Pouch and you're good to go. Homecooked, comforting flavor, wherever you are — that's what you can expect with Mountain House Biscuits and Gravy. Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-biscuits-and-gravy-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-biscuits-and-gravy-58.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-buffalo-style-mac-and-cheese-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-buffalo-style-mac-and-cheese-43.jpgcustom-itemoptacticalgear-pagemohome125005510110.49Mountain House Buffalo Style Mac and CheeseMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Here's comfort food to the next level. This meal combines Mountain House's signature creamy Mac & Cheese with chicken and a spicy buffalo sauce and it doesn't hold back. Enjoy while camping, tailgating, or at home. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-buffalo-style-mac-and-cheese-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-buffalo-style-mac-and-cheese-58.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-rice-pro-pak-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-rice-pro-pak-34.jpgcustom-itemoptacticalgear-pagemohome125005011510.99Mountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Gluten Free No matter the adventure, you need carbs and protein to keep you energized - and that's exactly what you'll get with Mountain House Chicken & Rice. Made with tender cooked chicken, zesty pimientos, hearty rice, packed with 43g of protein, this best-selling favorite has fueled explorers through power outages, snow storms, and backpacking excursions. Just add hot water and you'll be ready to enjoy a delicious, satisfying meal in minutes. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-rice-pro-pak-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-rice-pro-pak-46.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-and-dumplings-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-and-dumplings-43.jpgcustom-itemoptacticalgear-pagemohome12500551658.49Mountain House Chicken and DumplingsMountain House111Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-and-dumplings-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-and-dumplings-56.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-fajita-bowl-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-fajita-bowl-43.jpgcustom-itemoptacticalgear-pagemohome12500551759.99Mountain House Chicken Fajita BowlMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Gluten Free Ready in 9 Minutes If you want to enjoy a delightful Mexican dish while on a wilderness trek or otherwise away from home, we have the solution. Tickle your fancy and your taste buds with our chicken fajita bowl. We have combined chicken, rice, peppers, corn, onions and black beans to recreate this Mexican favorite in a compact, easy to carry form. Our freeze drying process keeps all the flavors sharp and delicious upon re-hydration. Enjoy this fun spin on a Mexican classic straight out of the pouch when needed, but you can also indulge further by spooning it into your favorite fajita shells. Just add water directly to the pouch and enjoy a tasty dish in the backcountry in less than 10 minutes. Eat straight from the bowl-like pouch. No extra cleanup! Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-fajita-bowl-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-fajita-bowl-58.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chili-mac-with-beef-pro-pak-new-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chili-mac-with-beef-pro-pak-new-57.jpgcustom-itemoptacticalgear-pagemohomemohochmacwib110.99Mountain House Chili Mac with Beef Pro-Pak NewMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Whether you're trekking the Sierra Nevado or completing a success mission, our Mountain House Chili Mac is an insanely delicious meal that's guaranteed to fill you right up at the end of a long day. Made with pillowy macaroni noodles, savory precooked beef and yummy kidney beans in a tasty chili sauce, and packed with 30g of protein. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-chili-mac-with-beef-pro-pak-new-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chili-mac-with-beef-pro-pak-new-72.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-classic-spaghetti-with-meat-sauce-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-classic-spaghetti-with-meat-sauce-17.jpgcustom-itemoptacticalgear-pagemohomemohoclspwime110.99Mountain House Classic Spaghetti with Meat SauceMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Ready in 9 Minutes There is something attractive about a classic. It is true of paintings, literature, and definitely food. When you want a meal you can rely on, a classic is definitely where it's at. When it comes to classic foods, especially those you enjoyed as a kid, spaghetti is about as classic as it gets. That is why we have created our own classic spaghetti with meat sauce recipe. As you savor every bite of the enriched spaghetti and beefy sauce, you can reminisce about your youth. But this classic is no kid's meal. Each freeze dried serving is designed for the fast preparation only adulthood can make you fully appreciate. There is also easy serving and cleanup because you can prepare, heat and eat it all in one package. Just add water directly to the pouch and enjoy a tasty dish in the backcountry in less than 10 minutes. Eat straight from the bowl-like pouch. No extra cleanup!]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-classic-spaghetti-with-meat-sauce-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-classic-spaghetti-with-meat-sauce-32.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-fettuccine-alfredo-with-chicken-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-fettuccine-alfredo-with-chicken-43.jpgcustom-itemoptacticalgear-pagemohome1250051789.99Mountain House Fettuccine Alfredo with ChickenMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Ready in 9 Minutes Looking for a home-cooked meal without the long prep or cleanup? Look no further than our Fettuccine Alfredo with Chicken. Our convenient just-add-water prep in the pouch means that you have more time to do what you love, without the hassles of cooking and cleanup. The pouch is durable and lightweight making it easy to pack and carry. Enjoy tender pasta in a delicious butter and parmesan sauce with hearty chunks of chicken any time, anywhere. Perfect for camping trips, backpacking, or just any time you want a tasty quick meal. Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-fettuccine-alfredo-with-chicken-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-fettuccine-alfredo-with-chicken-58.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-30.jpgcustom-itemoptacticalgear-pagemohome12500554505.99Mountain House Granola with Milk and BlueberriesMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain Gouse freeze-dried granola makes the perfect breakfast, snack or even dessert when you're craving something slightly sweet. Made with real blueberries, crunchy oats and powdered milk, Mountain House's Blueberry Granola has fueled everyone from United States Special Forces to explorers on Antarctic expeditions and everywhere in between. Simply add hot or cold water to eat as a cereal, or skip the prep altogether and enjoy it by itself. Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-40.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-military-meal-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-military-meal-43.jpgcustom-itemoptacticalgear-pagemohomemohogrwimian3.49Mountain House Granola with Milk and Blueberries - Military MealMountain House1111https://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-military-meal-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-military-meal-56.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-homestyle-chicken-noodle-casserole-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-homestyle-chicken-noodle-casserole-45.jpgcustom-itemoptacticalgear-pagemohome125005016111.99Mountain House Homestyle Chicken Noodle Casserole - Pro-PakMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Savory chicken, mushrooms, celery, and green peppers - this meal hits the mark (and taste) when it comes to providing the fuel you need to get things done in the backcountry. Packed with 42g of protein and 640 calories, no better time than now to set a new PR. Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-homestyle-chicken-noodle-casserole-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-homestyle-chicken-noodle-casserole-57.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-meals-68.jpgcustom-itemoptacticalgear-pagehysyMountain House Meals1mohochriprmohobestprnemohochmacwib1mohoscegwiba2mohomestadrimohohochnocamoholrpmemohogrwimianmohobiandgrmohogrwimian1mohovaicecrs1mohobustmacamohochanddumohochfabomohofealwichmohoclspwime11https://s.turbifycdn.com/aah/optacticalgear/mountain-house-meals-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-meals-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-mexican-style-adobo-rice-and-chicken-35.jpgcustom-itemoptacticalgear-pagemohome125005017111.99Mountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Rice, chicken, pinto beans, and veggies simmered in a delicious adobo sauce with a hint of lime to bring it to the next level. Packed with 33g of protein and 580 calories, roam the backcountry and reward yourself with south-of-the-border flavor. Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-mexican-style-adobo-rice-and-chicken-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-mexican-style-adobo-rice-and-chicken-43.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-scrambled-eggs-with-bacon-pro-pak-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-scrambled-eggs-with-bacon-pro-pak-55.jpgcustom-itemoptacticalgear-pagemohome125005045710.99Mountain House Scrambled Eggs with Bacon Pro-Pak NewMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Gluten Free Take all the prep work out of breakfast with our freeze-dried scrambled eggs and bacon. Just add hot water and you'll be ready to dig in to this classic hot breakfast anywhere under any circumstances. Loaded with 27g of protein to fuel your day. Expiration on this item is 5 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-scrambled-eggs-with-bacon-pro-pak-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-scrambled-eggs-with-bacon-pro-pak-67.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/moutain-house-lrp-meal-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/moutain-house-lrp-meal-49.jpgcustom-itemoptacticalgear-pagemohome1250067150913Mountain House Special Forces LRP MealsMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. We put a bug in Mountain House's ear about this a while back, and apparently the tribe has spoken loud enough... These meals are much like MH Pro-Paks, with higher protein content and are easier to pack in a food bag or ruck for your mission, hike, adventure etc... These are actual LRP Entrees Mountain House makes for the United States Special Forces and Military Cold Weather Meals. Perfect for outdoor adventures or as food for your bug-out-bag. Expiration on this item is 3 years from date of manufacture guaranteed. According to Mountain House, actual shelf life is up to 30 years if stored properly. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/moutain-house-lrp-meal-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/moutain-house-lrp-meal-61.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-vanilla-ice-cream-sandwich-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-vanilla-ice-cream-sandwich-62.jpgcustom-itemoptacticalgear-pagemohome125535243.99Mountain House Vanilla Ice Cream SandwichMountain House111Freeze Dried Ice Cream Sandwiches - For Adventurers and Space! Great for Camping and Hiking Mountain House's Freeze-Dried Ice Cream Sandwich allows you to enjoy real ice cream without needing a freezer. Sound too good to be true? We can assure you it's no joke - our ice cream sandwich features delicious, creamy freeze-dried vanilla ice cream sandwiched between two chocolate cookes for a delicious treat that can be enjoyed anywhere. And best of all? It's ready to eat straight from the pouch - no water or waiting required! Is This a Real Space Ice Cream Sandwich? Yes, this is the same famous ice cream you've heard about! But did you know that this space ice cream never actually went to outer space? It's sad but true. The likely story is that while space freeze-dried ice cream was really made and tested for space, it was ultimately deemed too crumbly to eat in the spaceship. Whether you're traveling to outer space or taking the kids on their very first camping trip, the legendary Mountain House Freeze-Dried Ice Cream Sandwich will satisfy your sweet tooth. Treat yourself to a sweet morsel on your next adventure on this planet or on another - we promise you won't be disappointed! Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-vanilla-ice-cream-sandwich-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-vanilla-ice-cream-sandwich-75.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mrds-mini-red-dot-sights-and-mounts-45.jpgcustom-itemoptacticalgear-pageopticsMRDS Mini Red Dot Sights, and Mounts1aiacp1raiglmosacmoptrrmrhdresirtrrmr3moaadrho50reddotmoledeproholosunhs507creoefmireddotardeofopmobaardeofopbapl1https://s.turbifycdn.com/aah/optacticalgear/mrds-mini-red-dot-sights-and-mounts-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/mrds-mini-red-dot-sights-and-mounts-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-cheese-spread-30.jpgcustom-itemoptacticalgear-pagehysyMRECHS1.891.75MRE Cheese SpreadOPT111120 calories
12gr Fat (7gr saturated fat)
30mg Cholesterol
430mg Sodium (Bacon, Jalapeño)
390mg Sodium (Cheddar)
0gr Carbohydrates
4gr Protein This is MRE cheese, it is no way health food, it's not gluten free, vegan, Halal, or Kosher. NO RETURNS ON FOOD ITEMS]]>
1https://s.turbifycdn.com/aah/optacticalgear/mre-cheese-spread-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-cheese-spread-40.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/mre-peanut-butter-30.jpgcustom-itemoptacticalgear-pagehysyMREPB1.891.75MRE Peanut ButterOPT1111 Serving per packet
150 Calories
12gr Fat (3gr saturated fat)
0mg Cholesterol
105mg Sodium
9gr Carbohydrates
2gr Dietary Fiber
5gr Protein PEANUT BUTTER:
1 Serving per packet
160 Calories
13gr Fat (2.5gr saturated fat)
0mg Cholesterol
135mg Sodium
6gr Carbohydrates
2gr Dietary Fiber
7gr Protein CHUNKY PEANUT BUTTER:
1 Serving per packet
160 Calories
13gr Fat (2.5gr saturated fat)
0mg Cholesterol
135mg Sodium
8gr Carbohydrates
2gr Dietary Fiber
7gr Protein This is MRE Peanut Butter, it is no way health food, it's not gluten free, vegan, Halal, or Kosher. Contains PEANUTS, Milk, Soy NO RETURNS ON FOOD ITEMS]]>
1https://s.turbifycdn.com/aah/optacticalgear/mre-peanut-butter-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-peanut-butter-40.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/msm-bottle-corset-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-bottle-corset-60.jpgcustom-itemoptacticalgear-pagewabopo54POUCH0001035MSM Bottle CorsetMil-Spec Monkey111Since we sell different bottle types we thought a versatile pouch would be appropriate. The MSM Bottle Corset design concept is to be a bottle holder that is very size flexible and built military tough. It can hold 32oz bottles such as the Nalgene while being adjustable down to small 12oz bottles. Being highly customizable, how the cords are routed allows the user to suit ease vs security needs; the bottom flap even allows for additional height adjustment. When not in use, the pouch can be stored flat and alternatively can hold other gear such as rifle magazines. The default cord routing has less power near the bottom to assist in one hand operation, but the user is encouraged to experiment adjusting both the cord routes and jump strap. Made by Tactical Tailor, Malice clips are included!1https://s.turbifycdn.com/aah/optacticalgear/msm-bottle-corset-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-bottle-corset-73.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-dlux-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-dlux-53.jpgitem.optacticalgear-pagebaseballhats54228MSM CG-Hat DLUXMil-Spec Monkey111Multicam color is made from softshell material and is highly water repellant]]>1https://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-dlux-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-dlux-67.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-raw-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-raw-66.jpgitem.optacticalgear-pagebaseballhats54124MSM CG-Hat RAWMil-Spec Monkey111 Due to a good response from MSM's DLUX hat, we now offer the RAW variant which is the same great quality, just without the integrated ear-pro. -FlexFit hat -top rivet removed -front panel is approx 4" x 3" -rear is 3" x 3" with a 5.5" x 1" strip at the bottom for name tapes -2" x 2" diamond up top for IR patches -edges sewn down for super smooth no snag functionality -bottom back has a lanyard attach point 2 Sizes: S/M 6 3/4” - 7 1/4” L/XL 7 1/8” - 7 5/8”1https://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-raw-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-raw-79.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-shear-pouch-plus-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-shear-pouch-plus-50.jpgcustom-itemoptacticalgear-pageinmedpoipo54pouch0001314MSM Shear Pouch Plus LaminateMil-Spec Monkey111A Malice clip is included for mounting, however NO shears, tourniquets, or other gear are included. Approx 2" x 6.5" (including strap) Made by Tactical Tailor. NO shears or tourniquets are included. Made in the USA by Tactical Tailor.]]>1https://s.turbifycdn.com/aah/optacticalgear/msm-shear-pouch-plus-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-shear-pouch-plus-60.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-small-patch-panel-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-small-patch-panel-66.jpgitem.optacticalgear-pageadminpouches54SPP24MSM Small Patch Panel Laminate - MOLLE FrontMil-Spec Monkey111(Patches and other gear however are not included)]]>1https://s.turbifycdn.com/aah/optacticalgear/msm-small-patch-panel-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-small-patch-panel-76.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-tac-organizer-pouch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-tac-organizer-pouch-64.jpgcustom-itemoptacticalgear-pageadminpouches54pouch-000120-XX35MSM Tac-Organizer PouchMil-Spec Monkey111 Based on the Stealth Admin pouch, we wanted to go with a slightly slimmed down and simplified version. The zippers go down further for wider access to the main compartment, yet stop soon enough so goods do not spill out. Interior has 3 billowed pockets on the frontal side and 2 billowed pockets on top of a sleeve pocket on the back interior side. The 3 pocket side fits multitool sized items great while the 2 pocket size can hold larger items like bandages and tourniquets. Instead of another compartment, the exterior has a sleeve stash pocket with security strap for shears or holding in papers. Security strap can be tucked into pocket when not needed or just cut off if never desired. To make up for the missing webbing on the sides, elastic pen holders have been added. 2 Color matched long Malice Clips included. Made by Tactical Tailor. Approximate Dimensions: 7" x 6.5" x 2+" (filled)1https://s.turbifycdn.com/aah/optacticalgear/msm-tac-organizer-pouch-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-tac-organizer-pouch-77.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-holster-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-holster-57.jpgcustom-itemoptacticalgear-pagecocavebaho54POUCH0001514MSM Wrap HolsterMil-Spec Monkey111WARNING:
Due to the highly customizable nature of this design care must be given to the setup when using with a pistol to make sure no extra overlaping material will get in the way of the trigger during draw or reholstering. USE AT YOUR OWN RISK! Like many holsters, long term use may scuff items inserted into this pouch.]]>
1https://s.turbifycdn.com/aah/optacticalgear/msm-wrap-holster-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-holster-70.jpgMil-Spec Monkey
https://s.turbifycdn.com/aah/optacticalgear/msm-wrap-multi-pouch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-multi-pouch-64.jpgcustom-itemoptacticalgear-pagecocavebaho5400014-black-4in11MSM Wrap Multi PouchMil-Spec Monkey111One pouch per item.]]>1https://s.turbifycdn.com/aah/optacticalgear/msm-wrap-multi-pouch-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-multi-pouch-77.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-claymore-bag-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-claymore-bag-36.jpgcustom-itemoptacticalgear-pagecobamanpumeb113MSWCLAY52.548.3MSW Claymore BagTactical Tailor111• Woodland BDU Camo: M81 Pattern
• Ranger Green
• Multicam]]>
1https://s.turbifycdn.com/aah/optacticalgear/milsim-west-claymore-bag-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-claymore-bag-46.jpgTactical Tailor
https://s.turbifycdn.com/aah/optacticalgear/milsim-west-baofeng-radio-pouch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-baofeng-radio-pouch-48.jpgcustom-itemoptacticalgear-pageradiopouches113MSW0151.9547.79MSW Enhanced Baofeng Radio PouchTactical Tailor111The Need: The Baofeng UV5R is an extremely ubiquitous radio used around the world, both for hobby and professional usage. They are inexpensive, easy to program, but due to their compact size they don't fit well in standard radio pouches. Until now there has not been a commercially available radio pouch specifically sized and purpose built for Baofeng style radios. The Solution: Sized for Baofeng UV5R series radios with the extended battery pack, the MilSim West Radio Pouch is specifically designed for the needs of users from all ends of the spectrum, whether it be a warfighter, a downhill skier, or a mil-sim enthusiast. The MSW Enhanced Baofeng Pouch's fold down design, with vinyl window facilitates viewing the radio's face and channel selector. Improvements
-Elastic Webbing on the Flap for Chemlights
-Velcro on the Inside of the Pouch to prevent “side to side” wobble caused by heavier antennas.
-Opening on the side to accommodate accessory connectors without removing the radio from the pouch.
-Still fits the Baofeng UV5R radio WITH extended battery. Features
-500D Cordura
-3 inch Jacquard Webbing
-Attaches to standard MOLLE / PALS webbing
-Lightweight Large MALICE clips (x2)
-Manufactured by Tactical Tailor
-Uses 2 channels of PALS webbing on wearer's equipment Colors: Multicam, Ranger Green, Coyote Brown Pouch fits all UV-5R and UV-5RV2+ series radios.]]>
1https://s.turbifycdn.com/aah/optacticalgear/milsim-west-baofeng-radio-pouch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-baofeng-radio-pouch-58.jpgTactical Tailor
https://s.turbifycdn.com/aah/optacticalgear/milsim-west-gopro-battery-pouch-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-gopro-battery-pouch-43.jpgcustom-itemoptacticalgear-pageheacandwe113MSW0020.518.99MSW GoPro Battery PouchTactical Tailor111Features:
-Velcro backed for easily attaching to helmets and other surfaces
-Velcro on the inside allows for the secure carrying of multiple sizes of battery packs as well as additional items such as batteries or weights. An included 1 inch velcro tie wraps around the battery pack and secures it to the inside.
-2x pieces of 1 inch elastic on each side of the pouch keeps the pouch nice and compact as well as allows for easy routing of cables.
-550 chord tie down points on the rear of the pouch to allow it to be securely attached to different points on the helmet or other surface.
-Velcro on the flap allows for attachment of IFF and morale pouches. As always, it is made in the USA by Tactical Tailor from USA made materials. No accessories included.]]>
1https://s.turbifycdn.com/aah/optacticalgear/milsim-west-gopro-battery-pouch-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-gopro-battery-pouch-53.jpgTactical Tailor
https://s.turbifycdn.com/aah/optacticalgear/msw-lightweight-baofeng-radio-pouch-24.jpghttps://s.turbifycdn.com/aah/optacticalgear/msw-lightwieght-baofeng-radio-pouch-29.jpgcustom-itemoptacticalgear-pageradiopouches113MSW0622.7520.99MSW Lightweight Baofeng Radio Pouch Mil-Spec Monkey111The Need: The Baofeng UV5R is an extremely ubiquitous radio used around the world, both for hobby and professional usage. They are inexpensive, easy to program, but due to their compact size they don't fit well in standard radio pouches. Until now there has not been a commercially available radio pouch specifically sized and purpose built for Baofeng style radios. The Solution: Sized for Baofeng UV5R series radios with the extended battery pack, the MilSim West Radio Pouch is specifically designed for the needs of users from all ends of the spectrum, whether it be a warfighter, a downhill skier, or a mil-sim enthusiast. The MSW Enhanced Baofeng Pouch's fold down design, with vinyl window facilitates viewing the radio's face and channel selector. Improvements
-Single channel design takes up less space, creates capability to attach to single channel areas (shoulder straps)
-Hypalon Webbing on the Flap for attaching PALS compatible accessories
-Opening on the side to accommodate accessory connectors without removing the radio from the pouch.
-Still fits the Baofeng UV5R radio WITH extended battery. Features
-500D Cordura
-Hypalon
-Attaches to standard MOLLE / PALS webbing
-Lightweight Large MALICE clip (x1)
-Manufactured by Tactical Tailor
-Uses 1 channel of PALS webbing on wearer's equipment Colors: Multicam, Ranger Green, Coyote Brown Pouch fits all UV-5R and UV-5RV2+ series radios.]]>
1https://s.turbifycdn.com/aah/optacticalgear/msw-lightwieght-baofeng-radio-pouch-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/msw-lightwieght-baofeng-radio-pouch-36.jpgMil-Spec Monkey
https://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-2-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-2-44.jpgcustom-itemoptacticalgear-pagebrtoki148-9993119.9517.95Multitasker NANO 2Multitasker Tools111DIMS: 1.2” x 0.5”
WEIGHT: Less than 1 oz
FEATURES:
• T10 Torx for Aimpoint ACRO P1/P2
• Light duty SLIM slotted screwdriver for Eotech EFLX, all Holosun, Leupold DeltaPoint Pro, Sig Romeo Pro1/Pro2, Steiner MPS, Trijicon RMR
• Also compatible with Aimpoint DUTY RDS and L3 HARRIS NGAL
• Lanyard hole accepts 550 paracord
• 420 stainless with Melonite® finish ]]>
1https://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-2-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-2-58.jpgMultitasker Tools
https://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-tool-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-tool-42.jpgcustom-itemoptacticalgear-pagebrtoki1489991118.9514.49Multitasker NANO Tool Multitasker Tools111• Size: 1.2 x 0.5 inches
• Weight: Less than 1 ounce
• Carry Options: Built-in lanyard hole and compatible with the integrated SpaceFrame locking storage slot on the front of the upcoming Gen3 MagPod®
• Material: 420 stainless with Melonite® finish ]]>
1https://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-tool-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-tool-56.jpgMultitasker Tools
https://s.turbifycdn.com/aah/optacticalgear/multitasker-series-3x-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/noname1-29.jpgcustom-itemoptacticalgear-pagesukiandto14888611179.99149.99Multitasker Series 3X ToolMultitasker Tools111• CNC machined pliers (D2 tool steel) - Not investment cast
• Non-slip G10 scales (Black or Tan)
• 3/8" hex for LaRue mounts
• 1/2" hex for scope rings
• Dual lug M4 castle nut spanner wrench + screwdriver
• 3/32" pin punch with 8-32 male thread for OTIS cleaning kit compatibility
• Radiused tip carbon scraper
• 3" D2 tool steel knife blade - Plain edge or partially serrated
• Pocket clip (removable)
• 1/4" magnetic bit driver with M16A2 FSP adjuster
• Includes these commonly used hex bits and a convenient bit carrier: No.1 Phillips, 3/32 Slotted, 3/16 Hex, 9/64 Hex, 1/8 Hex, 7/64 Hex, T10 Torx, T15 Torx]]>
1https://s.turbifycdn.com/aah/optacticalgear/noname1-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/noname1-36.jpgMultitasker Tools
https://s.turbifycdn.com/aah/optacticalgear/multitasker-twist-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-twist-46.jpgcustom-itemoptacticalgear-pagesukiandto1488872164.9559.95Multitasker Twist ToolMultitasker Tools111• Aimpoint turret adjuster on rear cap
• Pocket clip is a light-duty slotted screwdriver
• Heavy-duty dental pick with brass shank
• 3/32 pin punch
• Radial carbon scraper
• M16A2 style FSP adjustment tool on a magnetic 1/4" hex bit holder
• 10 1/4" hex bits and carrier strip ]]>
1https://s.turbifycdn.com/aah/optacticalgear/multitasker-twist-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-twist-56.jpgMultitasker Tools
https://s.turbifycdn.com/aah/optacticalgear/ordnance-pouches-51.jpgitem.optacticalgear-pageammopouchesMunitions / Ordnance Pouches1fecobapo1inmtrgravsoblfogehewhfrspsylidyflbablfohewhsmgratssmflpoeoglowprdepohast405bahat340ba1https://s.turbifycdn.com/aah/optacticalgear/ordnance-pouches-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/ordnance-pouches-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-narrow-mouth-32-oz-grey-bottle-w-black-lid-40.jpgitem.optacticalgear-pagenalgene2634200012.9910.99Nalgene Sustain Narrow Mouth 32 oz. Grey Bottle w/ Black LidNalgene111This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-narrow-mouth-32-oz-grey-bottle-w-black-lid-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-narrow-mouth-32-oz-grey-bottle-w-black-lid-47.jpgNalgenehttps://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-wide-mouth-32-oz-grey-w-black-lid-47.jpgitem.optacticalgear-pagenalgene2634183315.9912.49Nalgene Sustain Wide Mouth 32 oz. Grey w/ Black LidNalgene111This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-wide-mouth-32-oz-grey-w-black-lid-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-wide-mouth-32-oz-grey-w-black-lid-54.jpgNalgenehttps://s.turbifycdn.com/aah/optacticalgear/nar-ars-for-needle-decompression-14-gauge-x-3-25-in-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/ifak-ars-for-needle-decompression-14-gauge-x-3-25-in-24.jpgcustom-itemoptacticalgear-pagebandages114ZZ005610.99NAR ARS for Needle Decompression (14 gauge x 3.25 in.)North American Rescue111Specifications
SEL#: 09MS-02-THOR
Strong, reliable needle/catheter: 14 gauge x 3.25 in.
Rugged needle/catheter protective tube
Easy ID textured twist top with handy clip
Easy-open container for quick access
Capless flash chamber for immediate confirmation of needle placement
Convenient, compact size
U.S. Patents D595,847 and 001002372-0001, Patent(s) Pending Dimensions:
Packaged: L 5.7 in. x W 0.7 in. x 0.8 in.
Needle Size: 14 gauge x 3.25 in.
Weight: 0.6 oz THIS ITEM REQUIRES TRAINING PRIOR TO REAL WORLD USE. SEEK TRAINING FROM ACCREDITED SOURCES WITH REAL WORLD EXPERIENCE. O P Tactical Inc. will not be held responsible for misuse of this item. There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/ifak-ars-for-needle-decompression-14-gauge-x-3-25-in-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/ifak-ars-for-needle-decompression-14-gauge-x-3-25-in-31.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/nar-bear-claw-glove-glove-kit-pack-of-25-pairs-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-bear-claw-glove-glove-kit-pack-of-25-pairs-46.jpgcustom-itemoptacticalgear-pagebandages114ZZ-024X26.69NAR Bear Claw Glove Glove Kit - Pack of 25 PairsNorth American Rescue111Designed for single-use only. Features:
• 100% nitrile gloves
• Textured for improved wet and dry gripping
• Longer and thicker than standard nitrile gloves
• Form fitting
• Extended, beaded cuff for quick and easy donning
• Sand color
• Non-sterile NATO NSN: 6515-01-600-6059 Made in the USA. There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/nar-bear-claw-glove-glove-kit-pack-of-25-pairs-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-bear-claw-glove-glove-kit-pack-of-25-pairs-60.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/nar-black-talon-glove-kit-pack-of-25-pairs-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-black-talon-glove-kit-pack-of-25-pairs-46.jpgcustom-itemoptacticalgear-pagebandages114ZZ-021X26.69NAR Black Talon Glove Kit - Pack of 25 PairsNorth American Rescue111Designed for single-use only. Features:
• 100% nitrile gloves
• Textured for improved wet and dry gripping
• Longer and thicker than standard nitrile gloves
• Form fitting
• Extended, beaded cuff for quick and easy donning
• Black color
• Non-sterile Made in the USA. There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/nar-black-talon-glove-kit-pack-of-25-pairs-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-black-talon-glove-kit-pack-of-25-pairs-60.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/nar-c-a-t-tourniquet-holder-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-c-a-t-tourniquet-holder-57.jpgcustom-itemoptacticalgear-pagetourniquets11430005X23.99NAR C-A-T Tourniquet HolderNorth American Rescue111• PALS/MOLLE-style connectors for versatile attachment to an armor vest, gear or belt (mounted horizontally or vertically) for rapid & easy access
• 1000D IR Signature Reduced Nylon
• Easy-open pull elastic tab with tourniquet ID patch – “TQ” Accommodates both Gen 6 and Gen 7 C-A-T Tourniquets (not included). Made in the USA. Note: Inset picture shows OD Green on the left and Ranger Green (darker color) on the right.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nar-c-a-t-tourniquet-holder-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-c-a-t-tourniquet-holder-70.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/nar-compressed-gauze-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-compressed-gauze-53.jpgcustom-itemoptacticalgear-pagebandages11430-00524.09NAR Compressed GauzeNorth American Rescue111Features -4.5 in. x 4.1 yd Sterile, 6-ply 100% cotton gauze -The compressed, rolled gauze is ideal for wound bandaging and wrapping of injuries -Unique crinkle weave ensures excellent fluid absorption -Ultra-compact size that expands to cover larger wound areas -Used as backing gauze for hemostatic agents, in conjunction with a compression bandage to control hemorrhage Dimensions: -Packaged: L 3 in. x W 2 in. x D 1 in. -Weight: 1.2 oz There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-compressed-gauze-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-compressed-gauze-67.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-cummerbund-tourniquet-holder-elastic-26.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-cummerbund-c-a-t-holder-elastic-22.jpgcustom-itemoptacticalgear-pageinmedpoipo1130021X15.99NAR Cummerbund Tourniquet Holder - ElasticNorth American Rescue111• Tailored to allow attachment to a variety of armor carriers from law enforcement style over and concealable carriers to more tactical armor like assault and plate carriers
Accommodates Gen 6 and Gen 7 C-A-T Tourniquets and some other brand tourniquets like the SOFT-T Wide
• Utilizes 4 in. elastic coupled with hook and loop attachment to external cummerbund flap
• Rapid and Easy access with ambidextrous one handed TQ removal
• 4 in. Elastic Retention Band for Combat Application Tourniquet
• Hook and Loop attachment Specs:
• L 5 in. x W 4 in. x D 0.25 in.
• Weight: 0.6 oz Tourniquets sold separately. Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nar-cummerbund-c-a-t-holder-elastic-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-cummerbund-c-a-t-holder-elastic-29.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/nar-flat-emergency-trauma-dressing-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-flat-emergency-trauma-dressing-45.jpgcustom-itemoptacticalgear-pagebandages1143000937.99NAR Emergency Trauma DressingNorth American Rescue111Special Features:
-Sterile bandage with up to 5 year expiry
-Suitable for applying immediate direct pressure
-Flat folded, vacuum configuration reduces cube space and footprint in your kit
-Multi-functional, all-in-one design
-Simple application that is easy to remember under combat/survival stress
-Omission of pressure bars and hooks to moderate the use of fine motor skills
-Durable securing device
-Quick-Grip™ Roll Control tabs to prevent the bandage from unrolling during application
-Vacuum-sealed, flat low-cube packaging with NAR's signature Red-Tip Technology® red tear notches
-Cost effective Weight:
• 4-Inch: 2.6 oz
• 6-Inch: 4 oz There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/nar-flat-emergency-trauma-dressing-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-flat-emergency-trauma-dressing-55.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/nar-gen-7-combat-application-tourniquet-c-a-t-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-gen-7-combat-application-tourniquet-c-a-t-46.jpgcustom-itemoptacticalgear-pagetourniquets11430000131.59NAR Gen 7 Combat Application Tourniquet (C-A-T)North American Rescue111Description Noted as the best prehospital tourniquet in the February 2008 supplement of The Journal of Trauma The patented North American Rescue C-A-T® is a true one-handed tourniquet proven to be 100% effective by the U.S. Army’s Institute of Surgical Research. Tests proved that the C-A-T® completely occluded blood flow of an extremity in the event of a traumatic wound with significant hemorrhage. Features -Official Tourniquet of the U.S. Army -The CAT-T is proven to be 100% effective in occluding blood flow in both upper & lower extremities by the U.S. Army’s Institute of Surgical Research -NEW Single Routing Buckle for faster application, decreased blood loss, effective slack removal, fewer windlass turns, and simplified training with single protocol application standards -Includes reinforced windlass, stabilization plate, windlass clip and writeable windlass security strap -Featuring NAR's signature Red Tip Technology® elliptical tab providing added visual clues during application Dimensions: -Packaged: L 6.5 in. x W 2.4 in. x D 1.5 in. -Open Length: 37.5 in. -Weight: 2.7 oz There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-gen-7-combat-application-tourniquet-c-a-t-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-gen-7-combat-application-tourniquet-c-a-t-60.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-compact-chest-seal-twin-pack-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-compact-chest-seal-twin-pack-36.jpgcustom-itemoptacticalgear-pagebandages11410-004213.29NAR Hyfin Vent Chest Seal - Compact Model - Twin PackNorth American Rescue111Compact size fits in most IFAK/Medical Pouches better than the Full size model. Designed with 3-vented channels that allow air to escape the chest cavity during exhalation but prevents airflow from entering through the injury site during inhalation. Each HyFin Vent Compact Chest Seal is 4.75 in. x 4.75 in. and made with advanced adhesive to provide a superior adhesion in the most adverse conditions, including sweaty or hairy casualties. Packaged in a rugged, easy-to-open foil pouch, the perforated packaging allows users to open only one dressing at a time as needed. It’s small packaging is ideal for low profile kits as you do not have to fold it to get it to fit in your kit, go-bag, cargo pocket or body armor. Features:
• 3-channel pressure relief vents
• Two Chest Seals for the treatment of entry/exit or multiple penetrating wounds
• Advanced adhesive gel for superior adhesion, even to sweaty or hairy chests
• Large red tab for single step, peel and apply application that also allows for burping the wound if necessary Dimensions:
• Device: 4.75 in. x 4.75 in. (excluding tab)
• Packaged: H 3.875 in. x W 6.6 in. x D 0.13 in.
• Weight: 1.55 oz
• U.S. Patents: 7,504,549 & Patent(s) Pending There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-compact-chest-seal-twin-pack-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-compact-chest-seal-twin-pack-46.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-chest-seal-twin-pack-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-chest-seal-twin-pack-36.jpgcustom-itemoptacticalgear-pagebandages11410003716.39NAR Hyfin Vent Chest Seal - Full Size Model - Twin PackNorth American Rescue111Features:
-Patented, new design with 3-channel pressure relief vents
-Two Chest Seals for the treatment of both entry/exit or multiple penetrating injuries
-Advanced adhesive technology for a superior seal in the most adverse conditions, including sweaty or hairy casualties
-Easy-to-grip, large red tab for single step, peel-and-apply application that allows for the burping of the wound if necessary Specifications:
-Patented, new design with 3-channel pressure relief vents
-Two Chest Seals for the treatment of both entry/exit or multiple penetrating injuries
-Advanced adhesive technology for a superior seal in the most adverse conditions, including sweaty or hairy casualties
-3-vent channels that prevent airflow into the chest cavity during inspiration while allowing air to escape through the vent channels during exhalation
-Vent channels allow blood to escape and provides a backup fail-safe system as even if two of the three channels become obstructed, the vent will remain fully operational
-Easy-to-grip, large red tab for single step, peel-and-apply application that allows for the burping of the wound if necessary
-Rugged, easy-to-open foil package featuring signature Red-Tip Technology® tear notches with perforated packaging allowing rescuers to open only one dressing at a time as needed Dimensions:
-Device: H 6 in. x W 6 in.
-Packaged Folded: H 7.5 in. x W 4.5 in. x D 0.25 in.
-Packaged Unfolded: L 7.5 in. x W 9 in. x D 0.13 in.
-Weight: 2.5 oz.
-US Patents: 7,504,549 & Patent(s) Pending There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-chest-seal-twin-pack-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-chest-seal-twin-pack-46.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/nar-mini-responder-4-inch-dressing-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-mini-responder-4-inch-dressing-43.jpgcustom-itemoptacticalgear-pagebandages11430-01796.19NAR Mini Responder 4-Inch DressingNorth American Rescue111• Small, compact packaging
• Flat folded
• Both hook and loop as well as C-Clip securing device
• 4 x 6 inch non-adherent sterile pad
• 42 inch elastic bandage (unstretched)
• Sterile unless package is opened or damaged There are no returns or exchanges on medical items.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nar-mini-responder-4-inch-dressing-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-mini-responder-4-inch-dressing-57.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/ifak-nasopharyngeal-airway-28f-with-lubricant-23.jpgcustom-itemoptacticalgear-pagebandages114ZZ00345.99NAR Nasopharyngeal Airway 28F with LubricantNorth American Rescue111Specifications Not easily dislodged during transport
Better tolerated than an oropharyngeal airway by semi-conscious or unconscious patients with an intact gag reflex
Packaged with surgical lubricant attached Dimensions:
Packaged: L 6 in. x W 1.6 in. x D 0.5 in.
Device Size: 28 French
Weight: 0.5 oz THIS ITEM REQUIRES TRAINING PRIOR TO REAL WORLD USE. SEEK TRAINING FROM ACCREDITED SOURCES WITH REAL WORLD EXPERIENCE. O P Tactical Inc. will not be held responsible for misuse of this item. There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/ifak-nasopharyngeal-airway-28f-with-lubricant-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/ifak-nasopharyngeal-airway-28f-with-lubricant-30.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/nar-polycarbonate-eye-shield-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-polycarbonate-eye-shield-44.jpgcustom-itemoptacticalgear-pagebandages11430-01423.3NAR Polycarbonate Eye ShieldNorth American Rescue111• Made of rigid, shatterproof polycarbonate
• Meets CoTCCC treatment protocols for penetrating eye trauma
• Holes allow air circulation
• Accommodates either eye
• Translucent orange color
• Engraved “Tape over eye this side out. Nothing under shield” Specs:
• Each: 3 in. x 2.375 in.
• Weight: 0.2 oz There are no returns or exchanges on medical items.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nar-polycarbonate-eye-shield-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-polycarbonate-eye-shield-58.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/nar-quiklitter-lite-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-quiklitter-lite-42.jpgcustom-itemoptacticalgear-pagemesuhy11460007131.99NAR QuikLitter LiteNorth American Rescue111Features: • Perfect balance of size, weight, cost, and capability • Features ten large carry handles with a load capacity tested to 750 lb • Made of lightweight, heavy-duty nylon • Vacuum-packed to conserve space and fit in a cargo pocket ]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-quiklitter-lite-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-quiklitter-lite-56.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-roo-m-fak-kit-advanced-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-roo-m-fak-kit-advanced-38.jpgcustom-itemoptacticalgear-pageinmedpoipo11480106089.19NAR Roo M-FAK KitNorth American Rescue111Pouch Features:
Super compact
500 Denier nylon
Unique front tourniquet pouch, pull tab opening for one handed access
Multiple elastic loops on the interior
MOLLE style attachment
Mounts in vertical position, MOLLE
Mounts in horizontal position 3 in. internal sleeve for belt
Includes a 1 in. PVC Med Cross Patch Basic Kit Contents:
1 x C-A-T® (Combat Application Tourniquet®) Black
1 x 4 in. Flat ETD™
1 x S-rolled Gauze (4.5 in. x 4.1 yd)
1 x HyFin® Vent Compact Chest Seal, Twin Pack
1 x pair Bear Claw® Nitrile Trauma Gloves, large Advanced Kit Contents:
1 x C-A-T® (Combat Application Tourniquet®) Black
1 x 4 in. Flat ETD™
1 x Combat Gauze® LE Hemostatic Bandage
1 x Nasopharyngeal Airway 28F with Lubricant
1 x HyFin® Vent Compact Chest Seal, Twin Pack
1 x ARS® Needle Decompression Kit (10 G x 3.25 in.)
1 x pair Bear Claw® Nitrile Trauma Gloves, large Dimensions:
L 7 in. x W 3.75 in. x D 4 in.
Weight: 13 oz ]]>
1https://s.turbifycdn.com/aah/optacticalgear/nar-roo-m-fak-kit-advanced-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-roo-m-fak-kit-advanced-48.jpgNorth American Rescue
https://s.turbifycdn.com/aah/optacticalgear/navigation-and-watches-73.jpgitem.optacticalgear-pagefigemiNavigation, Watches, Radios1gafo901baedgafo701baedgafo801lugafogpsmodiupttrediumoapxm11diuke2pindiapxrecadivemoansybndivemoansytnbaofengbff8hpssprnafleogga30wrst215geopgpsposucoallblmisum9wrcowistsucllbnhcocatrwrcocauslecotrrangerbeadswmapcaThe USPS will not insure watches shipped through the postal system, choose postal delivery at your own risk, this does include international and APO/FPO customers]]>1https://s.turbifycdn.com/aah/optacticalgear/navigation-and-watches-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/navigation-and-watches-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-commando-wire-saw-39.jpgitem.optacticalgear-pagesukiandto647101012NDuR Commando Wire sawNDuR111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The strongest (over 100 lbs. breaking strain) and most effective wire saw available. Cuts through wood, plastic, bone and even soft metals. Constructed using 8 strands of interwoven stainless steel wire, will easily reach inaccessible places. Attach rope ring on each end to cut higher branches. 24" saw edge. Many uses for the outdoors and home.]]>1https://s.turbifycdn.com/aah/optacticalgear/proforce-commando-wire-saw-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-commando-wire-saw-46.jpgNDuRhttps://s.turbifycdn.com/aah/optacticalgear/proforce-emergency-signalling-mirror-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-emergency-signalling-mirror-51.jpgitem.optacticalgear-pagesukiandto645122012NDur Emergency Signalling MirrorNDur111Robust high impact plastic. Easy to use with one hand. Suns reflection can be seen for many miles. Floats if accidentally dropped in water. Measures 3" x 2". 1https://s.turbifycdn.com/aah/optacticalgear/proforce-emergency-signalling-mirror-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-emergency-signalling-mirror-61.jpgNDurhttps://s.turbifycdn.com/aah/optacticalgear/night-vision-and-accessories-45.jpgcustom-itemoptacticalgear-pageheacNight Vision and Accessories1l3habinividel3hapvbinivil3hanivideannvgmosoweaponlaserswelilaswheliandacheacandwenonvgwrchemlights1https://s.turbifycdn.com/aah/optacticalgear/night-vision-and-accessories-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/night-vision-and-accessories-44.jpgitem.ysw-templates-to-change111https://s.turbifycdn.com/aah/optacticalgear/nocorium-bnvd1531-wrap-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-bnvd1531-wrap-49.jpgcustom-itemoptacticalgear-pagenonvgwrXXNOC-153129.99Nocorium BNVD1531 WrapNocorium111litoinvi1Battery Pack Wraps are sold separately. If this is your first time applying these NVG Wraps, or if you need a refresher on how to apply them / reminder of where the pieces go, make sure you watch our how to video (see link below). SPECS:
• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nocorium-bnvd1531-wrap-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-bnvd1531-wrap-62.jpgNocorium
https://s.turbifycdn.com/aah/optacticalgear/nocorium-eotech-binonv-c-nvg-wrap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-eotech-binonv-c-nvg-wrap-45.jpgcustom-itemoptacticalgear-pagenonvgwrXXNOC-NV-BNVD32Nocorium EOTech BinoNV-C NVG WrapNocorium111litoinvi2• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nocorium-eotech-binonv-c-nvg-wrap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-eotech-binonv-c-nvg-wrap-58.jpgNocorium
https://s.turbifycdn.com/aah/optacticalgear/nocorium-nvg-wraps-33.jpgcustom-itemoptacticalgear-pageniviandacNocorium NVG and Headset Wraps1nopvwrnobnwrnoeobinvgwrnopvbapawrnoopampearprnopvwr11https://s.turbifycdn.com/aah/optacticalgear/nocorium-nvg-wraps-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-nvg-wraps-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-opscore-amp-ear-protection-wrap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-opscore-amp-ear-protection-wrap-45.jpgcustom-itemoptacticalgear-pageheprXXNOC-OpsCore-AMP19.95Nocorium OpsCore AMP Ear Protection WrapNocorium111• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nocorium-opscore-amp-ear-protection-wrap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-opscore-amp-ear-protection-wrap-58.jpgNocorium
https://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-14-wrap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-14-wrap-45.jpgcustom-itemoptacticalgear-pagenonvgwrXXNOC-PVS1422.99Nocorium PVS-14 WrapNocorium111litoinvi3PRODUCT NOTE: while most PVS14 Monocular devices are very similar, there are a few different battery housings available on the market. The wrap you see here, is designed specifically for the more common non-scooped battery housing, also often referred to as the Carson battery housing. The Nocorium PVS-14 Wrap™ is a non-permanent, adhesive-backed vinyl wrap carefully designed and precision cut to customize the appearance of your PVS-14 Night Vision Device This is for the more common single AA housing variant. Please double check to make sure you have the same style of housing. If this is your first time applying these NVG Wraps, or if you need a refresher on how to apply them / reminder of where the pieces go, make sure you watch our how to video (see link below). SPECS:
• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-14-wrap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-14-wrap-58.jpgNocorium
https://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-battery-pack-wrap-31.jpgcustom-itemoptacticalgear-pagenonvgwrXXNOC-PVS31A-BATPACK23.99Nocorium PVS-31A Battery Pack WrapNocorium111liinvi• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-battery-pack-wrap-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-battery-pack-wrap-40.jpgNocorium
https://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-wrap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-wrap-45.jpgcustom-itemoptacticalgear-pagenonvgwrXXNOC-PVS31A29.99Nocorium PVS-31A WrapNocorium111litoinviPVS-31A Battery Pack Wraps are sold separately. If this is your first time applying these NVG Wraps, or if you need a refresher on how to apply them / reminder of where the pieces go, make sure you watch our how to video (see link below). SPECS:
• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-wrap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-wrap-58.jpgNocorium
https://s.turbifycdn.com/aah/optacticalgear/non-reg-norse-face-sticker-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-norse-face-sticker-79.jpgcustom-itemoptacticalgear-pagestickers131NORSESTICKER3Non-Reg Norse Face Sticker Non-Reg111-Long-lasting printed vinyl sticker
-Size: 4 x 2.2 inches]]>
1https://s.turbifycdn.com/aah/optacticalgear/non-reg-norse-face-sticker-91.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-norse-face-sticker-92.jpgNon-Reg
https://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-parody-patch-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-parody-patch-70.jpgcustom-itemoptacticalgear-pagegrpa131NORSE6Non-Reg The Norse Face Parody PatchNon-Reg111-Velcro Hook backing, embroidered
-Includes Non-Reg vinyl sticker and artist info card More Info:
-Intended to help bring out the Norse warrior in all of us. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-parody-patch-82.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-parody-patch-83.jpgNon-Reg
https://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-t-shirt-100.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-t-shirt-98.jpgcustom-itemoptacticalgear-pagetshirts131NORSETEE25Non-Reg The Norse Face T-ShirtNon-Reg111 Intended to help bring out the Norse warrior in all of us. Printed on a comfortable Gildan Softstyle 100% Cotton T-Shirt. Regular Fit. T-Shirt only, gear not included.1https://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-t-shirt-111.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-t-shirt-112.jpgNon-Reghttps://s.turbifycdn.com/aah/optacticalgear/nuun-active-hydration-tube-of-12-46.jpgitem.optacticalgear-pagehysy264435__7.496.99Nuun Active HydrationNuun Hydration111NUUN Hydration Tablets A tasty & hydrating blend of electrolytes, minerals and caffeine provides complete hydration with an extra boost*. 10 tablets per tube. Dissolve in 16oz. of water. Features/Benefits:
Optimal electrolyte levels and salt balance; no carbs/sugars Tabs dissolve in the time it takes to tie your laces Tough, water-resistant tube is more convenient than bags of powder Nuun is triathlon tested to prevent cramping and maximize hydration Refreshing, light flavor designed for the active palate; not overwhelming; a bit tart and just right Nuun is not fizzy, not messy, not hard to dose like powder Great for long runs, rides, working out in the gym, anywhere. Active Ingredients:
Sodium (carbonates) 300 mg
Potassium (bicarbonate) 150 mg
Calcium (carbonate) 13 mg
Magnesium (sulfate) 25 mg
Sugar 1g Other Ingredients: Citric Acid, Dextrose, Sodium Carbonate, Potassium Bicarbonate, Sodium Bicarbonate, Natural Flavors, Potassium Chloride, Rice Extract Blend, Magnesium Oxide, Calcium Carbonate, Stevia Leaf Extract, Avocado Oil, Riboflavin (for color). This item cannot be returned unless in brand new, unused, unopened condition.]]>
1https://s.turbifycdn.com/aah/optacticalgear/nuun-active-hydration-tube-of-12-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/nuun-active-hydration-tube-of-12-53.jpgNuun Hydration
https://s.turbifycdn.com/aah/optacticalgear/nvg-mounting-solutions-79.jpgcustom-itemoptacticalgear-pageniviandacNVG Mounting Solutions1wiinl4g24lowwig69nvgmosywiinl4g70nvguntasushwiinl4sehy3hwiinl4sethhoopmobushopskshtnnvgpopaexwiinanarmmowrataseskcrgecrprnicrprnibapofecopvbaresyagbrtaheacplwiinamficoasopbuforarcraspsylidsnv21https://s.turbifycdn.com/aah/optacticalgear/nvg-mounting-solutions-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/nvg-mounting-solutions-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/oakley-si-double-edge-thin-blue-line-prizm-grey-lens-41.jpgcustom-itemoptacticalgear-page124938018Oakley SI Double Edge Thin Blue Line - Prizm Grey Lens11Features
- High wrap rectangular lens shape with optimized peripheral vision and side protection suitable for medium to large faces
- Unobtainium® nosepads increase grip with perspiration for a no slip grip
- Three-Point Fit holds lenses in precise optical alignment while eliminating pressure points
- Plutonite® Lenses offer top UV Protection filtering 100% of all UVA, UVB, UVC and harmful blue light up to 400nm
- O Matter™ stress-resistant frame material is both lightweight and durable for all-day comfort and protection WARNING: Eyewear products contain chemicals known to the State of California to cause cancer and birth defects or other reproductive harm.]]>
1https://s.turbifycdn.com/aah/optacticalgear/oakley-si-double-edge-thin-blue-line-prizm-grey-lens-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/oakley-si-double-edge-thin-blue-line-prizm-grey-lens-40.jpg
https://s.turbifycdn.com/aah/optacticalgear/oc-tactical-cat-trap-tourniquet-holder-available-soon-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/oc-tactical-cat-trap-tourniquet-holder-available-soon-34.jpgcustom-itemoptacticalgear-pagetourniquets1128.57.5OC Tactical CAT Trap Tourniquet HolderOC Tactical111-Lightweight
-Adjustable tension
-Secures easily to PALS Webbing
-Shock cord adjusted tension weaves through PALS Webbing
-Shock cord and ITW cord lock easily replaced in the field
-Lined with a non-slip material, providing friction to hold tourniquet Available in Multicam, Coyote 498, Ranger Green, and Black Made in the USA, 100% Berry Compliant]]>
1https://s.turbifycdn.com/aah/optacticalgear/oc-tactical-cat-trap-tourniquet-holder-available-soon-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/oc-tactical-cat-trap-tourniquet-holder-available-soon-44.jpgOC Tactical
https://s.turbifycdn.com/aah/optacticalgear/oc-tactical-hearing-protection-cover-34.jpgcustom-itemoptacticalgear-pagehepr116HP222.519.5OC Tactical HP2 Hearing Protection CoverOC Tactical111Peltor: Approximately 9.25" x 2" when folded. (Fits earpro with 2" wide bands: Comtac, 6S, TacticalPro, Tactical Sport, and Sordin Supreme Pro with leather headband.) Sordin Pro x: Approximately 9.5" x 1.5" when folded (Designed for Sordin Pro X with 1.5" plastic headband) Howard Leight: Approximately 10.5" x 2" when folded (Designed specifically for the Howard Leight Impact Sport. Will also fit Sordin Supreme Pro with leather headband) Like the original, this version is made using cordura fabric instead of clothing weight material for better wear resistance and uses foam backed Dri-Lex on the underside. The reason for the new version? It's faster and easier to make, which equals being able to keep up with demand and best off all, lower prices. Although the price is lower I didn't compromise in the details. Like the original I opted to continuing using Dri-Lex. Why Dri-Lex instead of standard spacer mesh? Because it not only increases airflow, but also wicks moisture away from the surface. I'm also able to custom order it with a layer of foam laminated to the back for extra cushion. It's more expensive, but worth it as far as I'm concerned. The original was the first in the industry to offer loop on top for a name tape. The name tape loop is still standard, but can also be ordered without for a lower price if you don't need it. When possible I always use matching camouflage loop. Why? Because I don't mind spending a few extra pennies and that's the way you would do it if you were making it for yourself. Also like the original I opted to not go with a one size fits all approach. Is it easier and cheaper from a manufacturing stand point to go with one size? Sure, but if you were making it yourself you would make it to fit correctly, not just good enough. So I settled on the 3 most popular sizes. Lastly, one of the most popular custom features from the original was a small loop centered in the back allowing you to hang your hearing protection using a carabineer, grimloc, or similar item. This feature is now standard. This makes storing you hearing protection at home, in the vehicle or aircraft, or on you gear a lot easier. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/oc-tactical-hearing-protection-cover-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/oc-tactical-hearing-protection-cover-41.jpgOC Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/olicamp-space-saver-mug-hard-anodized-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/olicamp-space-saver-mug-hard-anodized-53.jpgcustom-itemoptacticalgear-pagenalgene2633044818.9917.49Olicamp Space Saver Mug - Hard AnodizedOlicamp111This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/olicamp-space-saver-mug-hard-anodized-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/olicamp-space-saver-mug-hard-anodized-66.jpgOlicamphttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-helmetscrim-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-helmetscrim-18.jpgcustom-itemoptacticalgear-pageshvescbaXXOHC-HC30One Hundred Concepts HelmetScrimOne Hundred Concepts111We have stocked the Coyote color for those who wish to paint their gear all together - rifle, scrim, and anything else - to get a consistent pattern, as well as those who may not be able to get Multicam HelmetScrim due to unit SOPs, and those who simply would like the base color.
The HelmetScrim does not come with a Helmet Cover]]>
1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-helmetscrim-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-helmetscrim-32.jpgOne Hundred Concepts
https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-hexcap-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-hexcap-16.jpgcustom-itemoptacticalgear-pagerdsreddotsiaXXOHC-HC35One Hundred Concepts HexCapOne Hundred Concepts111• Minimizes downrange reflection.
• Snaps securely in place. The HexCap is a ruggedly simple, snap-fit Anti-Reflection Device (ARD) that installs securely in seconds to your red dot sight with no additional hardware. The HexCap was designed to be as low profile as possible while maintaining durability for use in the field. Its hexagonal lattice allows you to see through the optic with minimal obstruction while eliminating downrange reflections. Anti-Reflection Devices are nothing new, but there simply aren't good options for many of the red dots on the market today – especially with the rise in popularity of top-mounted and offset red dot sights. The goal of the HexCap is to solve that problem. Compatible with Aimpoint Micro:
• Aimpoint T1, T2, H1, H2, CompM5, Duty RDS
• Holosun 403C
• Vortex Crossfire RDS ]]>
1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-hexcap-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-hexcap-30.jpgOne Hundred Concepts
https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-lightcap-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-lightcap-17.jpgcustom-itemoptacticalgear-pageweaponlights1XXOHC-LC20One Hundred Concepts LightCapOne Hundred Concepts111litoliandscsSizing: See link below for additional size chart based on model
• Small: 1.125"
• Medium: 1.25"
• Large: 1.45" Common Light Compatibility
• Small: non-turbo Surefire Scout
• Medium: REIN 2.0, Modlite
• Large: Rein 3.0, Surefire Turbo]]>
1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-lightcap-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-lightcap-30.jpgOne Hundred Concepts
https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-packscrim-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-packscrim-16.jpgcustom-itemoptacticalgear-pagebaXXOHC-PS85One Hundred Concepts PackScrimOne Hundred Concepts1111https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-packscrim-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-packscrim-30.jpgOne Hundred Conceptshttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-ruggedized-lightcap-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-ruggedized-lightcap-17.jpgcustom-itemoptacticalgear-pagenewitemsXXOHC-LCR45One Hundred Concepts Ruggedized LightCap - ShockCollar IncludedOne Hundred Concepts111Small: Surefire 300/600/Vampire Series, Malkoff E1HT/E2HT
Medium: Modlite OKW/PLH-V2, Cloud Defensive Rein 2.0, Malkoff E2XT, Streamlight ProTac Rail Mount 1/2
Large: Cloud Defensive Rein 1.0, Streamlight ProTac 2.0 Rail Mount ]]>
1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-ruggedized-lightcap-25.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-ruggedized-lightcap-26.jpgOne Hundred Concepts
https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-19.jpgcustom-itemoptacticalgear-pagelplowpovaopaXXOHC-SC20One Hundred Concepts ScopeCapOne Hundred Concepts111liandscsich• Protects your lens
• Low profile when off of the lens - when using scope
• Field repairable Sizing: See link below for additional size chart based on scope model
• Small: 1.125" / 28.58mm
• Medium: 1.25" / 31.75mm
• Large: 1.40" / 35.56mm
• Size 1: 1.58" / 40.2mm
• Size 2: 1.73" / 44mm
• Size 3: 1.83" / 46.5mm ]]>
1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-33.jpgOne Hundred Concepts
https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-pro-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-pro-16.jpgcustom-itemoptacticalgear-pagelplowpovaopaXX-OHC-SCP65One Hundred Concepts ScopeCap ProOne Hundred Concepts111• Protect your lens and minimize downrange reflection
• Low profile in off position
• Field repairable Combining the technology of our ScopeCaps and HexCaps, the ScopeCap Pro features hexagonal lattice on the front lens when the cover is flipped up, which allows you to see through the optic with minimal obstruction while eliminating downrange reflections. The Cap itself is a simple, rugged, and low-profile solution to protect your scope's lenses and eliminate any reflections from them when not in use. Our signature flipper tab is integral to the ScopeCap and allows for fast and easy removal from your scope's bezel. When doffed, they have a lower profile than traditional flip style scope caps. Whether flipped up to take a shot or flipped down for ultimate signature reduction, the ScopeCap Pro combines all the features of products you've come to know and love from One Hundred Concepts. AVAILABLE SIZES:
• 30mm (30mm LPVOs)
• 33mm (Vortex Razor HD/Viper 1-6x24)
• 34mm (34mm LPVOs) ]]>
1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-pro-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-pro-30.jpgOne Hundred Concepts
https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-shockcollar-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-shockcollar-17.jpgcustom-itemoptacticalgear-pageweaponlights1XXOHC-CLR15One Hundred Concepts ShockCollarOne Hundred Concepts111• Eliminate excess shock cord and use of ranger bands
• Simplifies LightCap™ and ScopeCap™ installation
• Ease of manipulating light heads for battery changes and Vampire modes
• Better suited for scopes with rotating Oculars (EOTECH Vudu and NightForce Scopes) Size Corresponds to LightCap or ScopeCap Size
Common Light Compatibility
• Small: non-turbo Surefire Scout, S&S M-Ax Mount + Surefire IR Scout Light Head
• Medium: REIN 2.0, Modlite
• Large: Rein 3.0, Surefire Turbo]]>
1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-shockcollar-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-shockcollar-30.jpgOne Hundred Concepts
https://s.turbifycdn.com/aah/optacticalgear/ops-core-ach-arc-kit-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-ach-arc-kit-68.jpgitem.optacticalgear-pageachmiheandac562599203137.95124Ops-Core ACH Skeleton ARC Kit - Bungees IncludedOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Transform ACH style helmets into a streamlined platform capable of integrating mission enhancing components and accessories such as visors, mandibles, lights and cameras. Features:
• One size fits all. (Fits the bolt pattern of Gentex ACH style helmets, sizes small to extra-large.)
• Based on FAST ARC Rails.
• Quickly mounts to the sides of the helmet.
• Mounts using existing chinstrap holes in the helmet.
• Multiple non-snag attachment points provide quick, easy and secure donning and doffing of accessories, and clean routing of external wires and cables in a streamlined configuration to minimize user distraction.
• Compatible with ballistic visors and mandibles to offer several options for fully integrated face protection.
• Visor mounts directly; mandible through a point molded into the rail.
• May be integrated with liners and retention systems.
• Corners of the rail designed for compatibility with Ops-Core O2 Mask Straps making the helmet suitable for HALO/HAHO operations.
• Designed to emergency release accessories at 8ft-lbs (11 Newton meters) of torque to prevent neck injuries in the event of snagging.
• Durable, lightweight construction.
• Kit includes: (2) Skeleton ARCs, (2) Picatinny Adapters, (2) Wing- Loc Adapters, ballistic mounting hardware, and (10) cable ties, (2) hook bungees and (2) hook & carabiner bungees to assist with stabilization of night vision devices and mounting brackets. Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-ach-arc-kit-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-ach-arc-kit-78.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-communication-headset-connectorized-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-communication-headset-connectorized-51.jpgcustom-itemoptacticalgear-pagehepr56N101153-011549.951509.95Ops-Core AMP Communication Headset - ConnectorizedOps-Core111litoampheramThis item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Near Field Magnetic Induction (NFMI) Earplugs Sold Separately for NFMI Enabled AMP Headset Models. For leading-edge tactical ear protection and unprecedented audio quality, choose the Ops-Core AMP® Communication Headset. This advanced tactical communications headset integrates seamlessly with Ops-Core helmets and accessories to create a lightweight protective headborne system for any mission and environment. AMP's unique 3D Hear-Through Technology and optional NFMI earplugs provide double hearing protection that restores and enhances natural hearing and sound localization while maintaining clear communication for enhanced situational awareness. With a noise-cancelling microphone that mitigates all background noise, AMP is the ideal communications headset to wear in any unpredictable combat environment. This ergonomically designed headset can be configured to meet a wide range of tactical communications needs and delivers ear protection while providing optimal comfort and a streamlined profile. This noise-cancelling headset has a user-based design and can be easily adapted to either headband or helmet configurations, and the optional Rail Mount Kit increases helmet stabilization. AMP features an integrated fixed downlead connection point and quick release downlead connection. The AMP Communication Headset is CE approved EN 352 and available in Berry Amendment compliant configurations. Features:
• World Class Audio Quality and Tactical Ear Protection
• CE approved EN 352
• Berry Amendment compliant configurations available
• 3D Hear-Through Technology
• Double Hearing Protection with optional Ops-Core Near Field Magnetic Induction (NFMI) Earplugs (sold separately for use with NFMI enabled headsets specifically)
• Mission Configurable Capability
• Ergonomic Headband for low profile hearing protection
• Quick Change Rail Mount Kit (sold separately)
• Quick Release Downlead Connections
• Noise-cancelling Headset/Microphone
• Integrated Microphone Mounting and Connection Point
• Ergonomic Earseals
• Auto Shutdown
• Fail-Safe Communications Noise Protection Ratings/Specs/Weight:
See small inset picture above. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-communication-headset-connectorized-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-communication-headset-connectorized-63.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-helmet-rail-mount-kit-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-helmet-rail-mount-kit-48.jpgcustom-itemoptacticalgear-pagehepr561000440159.95Ops-Core AMP Helmet Rail Mount KitOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Features:
• Allows for mounting to the rear of Ops-Core ARC Rails, leaving the top portion of the rails free for mounting accessories, such as lights, cameras, etc. This also creates better helmet stabilization and a counterbalancing effect of forward shroud mounted devices, such as night vision devices.
• A single point gimbal attachment to the ear cups allow for 360 degree adjustment, which not only allows for better fitment and seal to the user’s unique ear / head shape, but maintains that seal and moves more naturally with their head movement.
• Earcups rotate to the side or rear of helmet when not in use, streamlining stowage to create a very low profile. AMP Rail Mount Kit Only. AMP Headset sold separately. Designed to work only with the Ops-Core AMP Headset and ARC Rails. Adapters sold separately from other manufacturers are required for different headsets or rail system. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-helmet-rail-mount-kit-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-helmet-rail-mount-kit-60.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-u174-downlead-cable-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-u174-downlead-cable-53.jpgcustom-itemoptacticalgear-pagehepr56N254584199.95Ops-Core AMP U174 Downlead CableOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The Adaptive Mission Platform (AMP) Headset allows for multiple downlead cable options. These downlead cables gives operators the ability to tailor comms to their mission needs and preferences. Downlead cables allow operators to choose the side of the headset they are physically connected to - offering left, right, and dual downlead capabilities. Features:
• Connects AMP Communication Headsets to various push-to-talk, intercom, and radio options.
• Provides high quality, environmentally sealed connection points.
• Immersion: IPX7
• Multiple cable options are available for the AMP Communication Headset. See small inset photo above for Downlead type info. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-u174-downlead-cable-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-u174-downlead-cable-65.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-ballistic-mounting-hardware-4-pcs-49.jpgitem.optacticalgear-pageopheandac56 039920322.9521Ops-Core Ballistic Mounting Hardware (4 pcs)Ops-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The ballistic mounting hardware set includes (4) custom ballistic screws and (4) T-nuts. It fits all Head-Loc™ Retention Systems. Available in black. Screws are 22mm length for use with Ops-Core ARC Rails and Chin Straps. This IS NOT a replacement for standard MICH or ACH hardware, it is intended to replace hardware used with Ops-Core chinstraps.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-ballistic-mounting-hardware-4-pcs-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-ballistic-mounting-hardware-4-pcs-58.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-bungees-for-arc-rails-48.jpgitem.optacticalgear-pagenvgmoso562599203-Bungee29.95Ops-Core Bungees For ARC Rails - ACHOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Bungee set for use with the Ops-Core ACH ARC Rails 2 Bungees per set. Length per bungee: approximately 4 inches tip-to-tip.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-bungees-for-arc-rails-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-bungees-for-arc-rails-55.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-cbrn-mask-extender-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-cbrn-mask-extender-56.jpgitem.optacticalgear-pagecbrngasmasks5619991015.9514Ops-Core CBRN Mask ExtenderOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. CBRN Mask Extender can be used with all current model Ops-Core Head-Loc™ Retention Systems. It adds 3.5” to the chinstrap, allowing it to fasten over the CBRN mask. The extender is simply attached and removed with one click of the buckle.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-cbrn-mask-extender-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-cbrn-mask-extender-69.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-bump-super-high-cut-helmet-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-bump-super-high-cut-helmet-18.jpgcustom-itemoptacticalgear-pageopheandac56A15057549.95495Ops-Core FAST Bump Super High Cut Helmet Ops-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. (Formerly the Base Jump Helmet) The FAST Bump High-Cut Helmet is the same design as the Ballistic and Carbon FAST helmets but with a polycarbonate shell. This helmet is NOT ballistic rated. The Ops-Core FAST® Bump high-cut shell is designed for less extreme environments where ballistic threats are not a priority, and the focus is on protection from blunt trauma forces, or where the primary need is for integration of mission-configured components. Features & Specifications
• Rigid polymer high-cut shell with eight vent holes to provide increased airflow and reduce heat stress
• Vented Lux Liner with Low Profile Occ-Dial and Head-Loc Retention System offering enhanced impact protection and unmatched stability and comfort
• Modular Bungee Shroud (MBS) for compatibility with most NVG mounts and integrated NVG retention
• Features PowerPath ARC rails with improved cable management and accessory integration Set up for Right-Eye Dominant Shooters. Please contact us if you need a Left-Eye Dominant chinstrap buckle. There are no returns or exchanges on helmets. Please be sure of your size before ordering. This Item is Excluded from ALL Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-bump-super-high-cut-helmet-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-bump-super-high-cut-helmet-30.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-mesh-helmet-cover-for-fast-helmets-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-mesh-helmet-cover-for-fast-helmets-66.jpgcustom-itemoptacticalgear-pageopheandac5641-98-259151.95137Ops-Core FAST Helmet CoverOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Latest Gen version of the Ops-Core Helmet Cover for FAST High-Cut and Super High-Cut Helmets. Design is slightly different on the front portion of each model type to accommodate different retention bungee positions. See pictures for reference. Functionally, they are the same. Features:
• Lightweight and easy to don and doff, providing the ultimate in signature management convenience.
• Lightweight mesh and tweave construction.
• Mesh overlaps vent holes on most FAST Non-Ballistic helmets to provide maximum air flow.
• Para-cord attachment points for natural foliage, camouflage material or cable management.
• Protects the shell while still providing all of the FAST helmet platform functionality.
• Attaches with integrated VELCRO brand tabs. Types:
• FAST Super High-Cut: Compatible with Ops-Core FAST SF Ballistic, FAST MT Ballistic, Current-Gen FAST XP, and FAST SF Carbon Helmets
• FAST High-Cut: Compatible with Previous-Gen Ops-Core FAST XP and other FAST High-Cut Ballistic and Non-Ballistic Helmets Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-mesh-helmet-cover-for-fast-helmets-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-mesh-helmet-cover-for-fast-helmets-76.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sf-super-high-cut-ballistic-helmet-r-96.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sf-super-high-cut-ballistic-helmet-r-94.jpgcustom-itemoptacticalgear-pageopheandac56A145702080.951873Ops-Core FAST SF Super High Cut Ballistic Helmet (R)Ops-Core111litodashUPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. The current issued helmet for USSOCOM, the FAST SF is one of the lightest and most advanced ballistic helmets ever designed. See small picture for Size Chart. Features:
• Super high cut, ballistic shell made of a hybrid composite of the most advanced Carbon, Unidirectional Polyethylene and woven Aramid.
• High performance evolution of the Ops-Core FAST MT Super High Cut Helmet, with an 8% weight reduction, while maintaining compatibility with FAST head borne accessories.
• Super high cut shell geometry extends critical coverage over the rear occipital bone without load carrier interference, and optimizes weight distribution for increased stability, integration, balance, and improved comfort.
• Ear cut geometry is 16 mm higher than the FAST XP High Cut shell shape, allowing for clearance of larger communication headsets.
• Super High Cut Skeleton Rails offer lower profile with a 30% weight reduction from FAST MT Super High Cut Rails.
• Features a lightweight Modular Bungee Shroud (MBS) which reduces snag hazards and interference. Carabiner clips improve NVG retention and stability.
• Molded liner features proprietary recessed groove, accommodating over-the-head communications headsets with no interference or user discomfort, and ability to doff and don helmet without removing the headset.
• Vented Lux Liner features expanded polypropylene liner, offering enhanced impact protection, and molded-in vent holes are integrated with the shell to provide increased airflow and reduce heat stress.
• Helmets come standard with right eye dominant retention (buckle on left) Liner: Vented Lux Liner - Occ-Dial Kit
• Suspension system combining a one-piece full coverage impact layer with modular breathable comfort pads which can be customized and/or repositioned for comfort without affecting impact performance
• Includes vents and a more streamlined geometry to enhance air flow, comfort, and fit
• Low Profile OCC-Dial provide easy adjustments to ensure NVG stability
• Designed for comfort during extended use
• Comfort Pads are durable, breathable, low absorbency, removable and washable
• Seamlessly integrates with all Ops-Core FAST Ballistic, and Non-Ballistic Helmets.
• Installs using VELCRO® brand fasteners
• Comes in corresponding helmet sizes (M, L, XL, XXL)
• 1/4", 1/2", and 3/4" Comfort pads are included for easy, customizable fit Testing/Rating Protocols: See Link Below for Data Sheet
• Modified and Abbreviated Family of Tactical Headborne Systems, dated June 30th 2017 Ops-Core Performance Specification FAST SF PS-1228 Specs:
• Large Shell Weight: 1.47 lbs
• XLarge Shell Weight: 1.59 lbs
• 2XL Shell Weight: 1.65 lbs Made in the USA, Berry Compliant. O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. There are no returns or exchanges on body armor items. Please be sure of your size before ordering. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sf-super-high-cut-ballistic-helmet-r-105.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sf-super-high-cut-ballistic-helmet-r-106.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-xp-super-high-cut-helmet-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-xp-super-high-cut-helmet-r-18.jpgcustom-itemoptacticalgear-pageopheandac56A151571820.951638Ops-Core FAST XP Super High Cut Helmet (R)Ops-Core111litodash1UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. See small picture for Size Chart. The Ops-Core® FAST XP helmet is part of the FAST ballistic protection helmet family. Its innovative, lightweight design resists penetration from 9mm and frag threats at a weight of 2.81lbs (Large). The FAST XP integrates into Ops-Core’s total headborne system solutions, which include situational awareness, optics, and respiratory protection.
• Lightweight design capable of resisting 9mm and frag threats
• High cut, ballistic shell made of a hybrid composite of the most advanced carbon, unidirectional polyethylene, and woven aramid
• High cut shell geometry extends critical coverage over the rear occipital lobe without load carrier interference and optimizes weight distribution for increased stability, integration, balance, and improved comfort
• Low Profile Skeleton Rail system offers a lightweight mounting system for the headborne eco-system
• Molded liner features proprietary recessed channel, accommodating over-the-head communications headsets with no interference or user discomfort, and ability to doff and don helmet without removing the headset Liner: Vented Lux Liner - Low Profile Occ-Dial Kit options
• Suspension system combining a one-piece full coverage impact layer with modular breathable comfort pads which can be customized and/or repositioned for comfort without affecting impact performance
• Includes vents and a more streamlined geometry to enhance air flow, comfort, and fit
• Low Profile OCC-Dial adjustment provides easy adjustments to ensure NVG stability
• Designed for comfort during extended use
• Comfort Pads are durable, breathable, low absorbency, removable and washable
• Seamlessly integrates with all Ops-Core FAST Ballistic, and Non-Ballistic Helmets.
• Installs using VELCRO® brand fasteners
• Comes in corresponding helmet sizes (M, L, XL, XXL)
• 1/4", 1/2", and 3/4" Comfort pads are included for easy, customizable fit Testing/Rating Protocols: See Link Below for Data Sheet
• Performance Specification: In accordance with Gentex PS-1063 Specification, Modified and Abbreviated US Army ACH Helmet CO/PD 05-04:2007
• Specification NIJ Standards: NIJ 0106.01 with NIJ 0108.01 Level IIIA (9mm FMJ @ 1,400 ft/s)
• Threat Fragmentation Protection: In accordance with PS-1063 and MIL-STD-662F Specs:
• Large Shell Weight: 1.72 lbs
• XLarge Shell Weight: 1.89 lbs
• 2XL Shell Weight: 1.97 lbs Specs:
• Large System Weight: 2.81 lbs
• XLarge System Weight: 3.02 lbs
• 2XL System Weight: 3.11 lbs Made in the USA, Berry Compliant. O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. There are no returns or exchanges on body armor items. Please be sure of your size before ordering. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order.]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-xp-super-high-cut-helmet-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-xp-super-high-cut-helmet-r-30.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sentry-helmet-counterweight-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sentry-helmet-counterweight-38.jpgcustom-itemoptacticalgear-pageopheandac5639-99-XX90.9582Ops-Core Helmet CounterweightOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Compatible with Sentry, FAST, and TBH IIIA helmets. Possibly compatible with other helmets using ARC Rails (not guaranteed). This customizable weight management system is designed to enhance comfort and reduce neck strain particularly when wearing NVGs. The five removable weights are housed in elastic pockets that can stretch to fit two weights or one weight and one battery. The Ops-Core Counterweight easily mounts to the rear of the helmet with custom anchors using the existing helmet holes with provided longer ballistic screws, and the VELCRO® brand fastener attachment ensures motion free and secure positioning. Compatible with Ops-Core FAST, Sentry and TBH IIIA Helmets. Possibly compatible with other Helmets using ARC Rails. this durable system also includes a Chemlight window and Velcro patch for Glint tape for use with low light IFF Features:
• Customizable weight management system designed to enhance comfort and reduce neck strain.
• (5) 70g removable weights and (5) elastic pockets.
• Total weight system is 0.85lbs (385g).
• Elastic pockets can stretch to fit (2) weights or (1) weight and (1) battery (AA, AAA or 123).
• Mounts to the rear of the helmet with custom anchors using the existing helmet holes with longer ballistic screws (provided).
• Rear VELCRO® brand fastener attachment ensures motion free and secure positioning.
• Chemlight window and the patch with VELCRO® brand fasteners for Glint tape for use with low light IFF.
• Durable construction.
• Includes 24mm Helmet Screws
Compatible with Sentry, FAST, and TBH IIIA helmets. Possibly compatible with other helmets using ARC Rails (not guaranteed). Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sentry-helmet-counterweight-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sentry-helmet-counterweight-48.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-helmets-and-accessories-74.jpgcustom-itemoptacticalgear-pageheacOps-Core Helmets and Accessories1opfasfsuhicuopfaxpsuhicuopfabusuhicuuntama20ampuntamakit3mpearcadleauntasasoaduntareforpeagopmasfhecoagunrepoforhopmehecoforfagbrtaheacplopfahecofispophecohyfispopfabaheuntacoweliopmobushoppiadopluxliveockopbuforarcraopcbmaex20veopbamoha4pcratahecahi1https://s.turbifycdn.com/aah/optacticalgear/ops-core-helmets-and-accessories-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-helmets-and-accessories-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-modular-bungee-shroud-25.jpgcustom-itemoptacticalgear-pagenvgmoso56H10672202.95183Ops-Core Modular Bungee Shroud (MBS)Ops-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The new Ops-Core Modular Bungee Shroud is standard equipment on the next-generation Ops-Core FAST SF and USSOCOM Special Operations Forces Personal Equipment Advanced Requirements Family of Tactical Headborne Systems (SPEAR FTHS), and can be attached to any 3-Hole WARCOM pattern helmet. Made of a hybrid lightweight polymer frame and removable/replaceable machined aluminum mounting insert and featuring an integral bungee retention system with carabiner-style bungee attachments, the MBS is one of the most advanced and most secure NVG retention systems currently on the market.
Features:
• Lightest night vision shroud available.
•Comprised of a molded outer housing and a machined removable insert, designed to be changed out without removing the shroud from the helmet, to provide multiple mounting solutions within the same shroud platform. (Alternate shroud solutions often require the shroud to be removed from the helmet to change out the insert).
•Integrated NVG bungee eliminates interference with accessories.
•The low-profile bungee helps prevent snag hazards while stabilizing NVGs. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-modular-bungee-shroud-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-modular-bungee-shroud-32.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-nfmi-earplugs-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-nfmi-earplugs-41.jpgcustom-itemoptacticalgear-pagehepr56N100880234.95Ops-Core NFMI EarplugsOps-Core111litoopampheThis item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Designed for use with the Ops-Core AMP Communications Headset only (sold separately). The Ops-Core® Near Field Magnetic Induction (NFMI) Earplugs provide increased noise reduction, while maintaining clear communications and 3D Hear-Through, when used with NFMI enabled Ops-Core headsets. Do not need batteries, recharging, or any wired connection. When engaged, the NFMI earplug will seamlessly integrate for clear communication. The kit ships with standard, slim, and large Comply foam tips, to accommodate a wide variety of users. See inset picture for Noise Protection Ratings. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-nfmi-earplugs-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-nfmi-earplugs-52.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-picatinny-adapter-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-picatinny-adapter-54.jpgitem.optacticalgear-pageopheandac5620-99-10322.9521Ops-Core Picatinny AdapterOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Works with the ACH-ARC Kit and the FAST Helmet rails Use it to mount a variety of headborne accessories to the helmet Quickly attaches or releases from the rail system]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-picatinny-adapter-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-picatinny-adapter-67.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-skeleton-shroud-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-skeleton-shroud-64.jpgcustom-itemoptacticalgear-pagenvgmoso5634-99-XXX137123Ops-Core Skeleton ShroudOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Features:
• Forged aluminum construction for greater strength and lower weight than the VAS shroud
• High tolerance CNC machined mount arm interface for perfect fit without rattle
• Multiple bungee and lanyard mounting points for compatibility with visors
• Fits all ACH, MICH, PASGT, and LWH helmets with the MARSOC / WARCOM 3-hole pattern, including Crye Airframe and Ops-Core FAST Helmets The Skeleton Shroud’s sleek design will not snag on risers during airborne operations and is HALO, HAHO, and Static Line rated. Mounting hardware included. Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-skeleton-shroud-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-skeleton-shroud-78.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/ops-core-lux-liner-vented-occ-dial-kit-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-lux-liner-vented-occ-dial-kit-16.jpgcustom-itemoptacticalgear-pageopheandac56H10758382.95345Ops-Core Vented Lux Liner - Low Profile OCC-Dial KitOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Choose the option based on your dominant eye. "Right Eye Dominant" has the buckle on the left side of the chin strap to accommodate for the buttstock. "Left Eye Dominant" has the buckle on the right side of the chin strap for the same reason. Features:
• Suspension system combining a one-piece full coverage impact layer with modular breathable comfort pads which can be customized and/or repositioned for comfort without affecting impact performance
• Includes vents and a more streamlined geometry to enhance air flow, comfort, and fit
• Low Profile OCC-Dial provides easy adjustments to ensure NVG stability
• Designed for comfort during extended use
• Comfort Pads are durable, breathable, low absorbency, removable and washable
• Seamlessly integrates with all Ops-Core FAST Ballistic, and Non-Ballistic Helmets
• Installs using VELCRO® brand fasteners
• 1/4", 1/2", and 3/4" Comfort pads are included for easy, customizable fit Note: Screws NOT included. You use the ones that came with your FAST Helmet. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/ops-core-lux-liner-vented-occ-dial-kit-25.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-lux-liner-vented-occ-dial-kit-26.jpgOps-Core
https://s.turbifycdn.com/aah/optacticalgear/opt-3-inch-dot-target-30.jpgcustom-itemoptacticalgear-pagetargetsOPT3IDTGT1.25 10 10 25 21.25 50 37.5 100 50OPT 3 inch Dot TargetOPT11110 Target: $1.00/piece
25 Targets: $0.85/piece
50 Targets: $0.75/piece
100 Targets: $0.50/piece UPS OR INTERNATIONAL SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. CONTACT US FOR SHIPPING COST IF ORDERING MORE THAN 100 TARGETS.]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-3-inch-dot-target-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-3-inch-dot-target-40.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-large-33.jpgcustom-itemoptacticalgear-pagestickersOPTACESTLG3OPT Ace Tomato Co Sticker - LargeOPT111One of the greatest covers for action in the history of espionage. Adhesive backed. 3" x 2.25". Matte finish.1https://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-large-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-large-43.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-small-31.jpgcustom-itemoptacticalgear-pagestickersOPTACESTSM2OPT Ace Tomato Co Sticker - SmallOPT111One of the greatest covers for action in the history of espionage. Adhesive backed. 2" x 1.5". Matte finish.1https://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-small-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-small-40.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-tee-31.jpgcustom-itemoptacticalgear-pagetshirtsOPTACETEE2520OPT Ace Tomato TeeOPT111Shirt Details: •The preferred T-Shirt of the military in tropical environments. •Tan/OCP goes with New Scorpion Pattern ACUs •Adult size •50% Cotton, 50% Polyester jersey •Lightweight 4 ounce fabric •Crewneck Made and printed in the USA]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-tee-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-tee-40.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-be-a-man-vinyl-sticker-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-be-a-man-vinyl-sticker-59.jpgcustom-itemoptacticalgear-pagestickersOPBAMAMS3OPT Be A Man Vinyl StickerOPT111A tribute to one of the most successful COIN units in the history of modern warfare, The Rhodesian Light Infantry. Vinyl sticker 3 x 4.5 inches1https://s.turbifycdn.com/aah/optacticalgear/opt-be-a-man-vinyl-sticker-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-be-a-man-vinyl-sticker-72.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-best-in-life-t-shirt-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-best-in-life-t-shirt-60.jpgcustom-itemoptacticalgear-pageoptapparelOPTBILT3025OPT Best In Life T-ShirtOPT111Back of shirt features the graphic and saying. Next Level Brand T-shirt: Athletic Fit, 60% Cotton 40% Poly Blend, Lightweight Material. For a loose fit, order one size larger than normal. Black shirt, tan print, short sleeve.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-best-in-life-t-shirt-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-best-in-life-t-shirt-73.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-blood-type-tape-patch-40.jpgitem.optacticalgear-pagegrpa12CP506502OPT Blood Type Tape PatchOPT1111" x 2" For quick and easy identification in an emergency situation these patches have the blood type stated in bold capital letters. VELCRO Brand fastener backed with the "hook" portion, ready to be placed on any available surface with pile tape on it.1https://s.turbifycdn.com/aah/optacticalgear/opt-blood-type-tape-patch-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-blood-type-tape-patch-49.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-burn-down-commies-sticker-13.jpgcustom-itemoptacticalgear-pagestickersOPTBDCDST3OPT Burn Down Commies StickerOPT111In 1967, Polish mercenary Rafal Ganowicz was asked what it felt like to take human life... "I wouldn't know, I've only ever killed Communists." Adhesive backed 3" x 5" Matte finish1https://s.turbifycdn.com/aah/optacticalgear/opt-burn-down-commies-sticker-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-burn-down-commies-sticker-21.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTBUSH3OPT Bush Wars Logo StickerOPT111Features:
-Long-lasting printed vinyl sticker
-Size: 3.63 x 4 inches]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-sticker-39.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-t-shirt-light-weight-loose-fit-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-t-shirt-light-weight-loose-fit-45.jpgcustom-itemoptacticalgear-pageoptapparelOPTBUSHTEETB25OPT Bush Wars Logo T-Shirt - Light Weight Loose FitOPT111TRI-BLEND Specs
50/37/13 Polyester/Cotton/Rayon Pre-shrunk Jersey
Weight approx. 4.5 oz / 153 g
Soft, lightweight jersey with moisture wicking
Seamless 1x1 rib collar with two-needle coverstitching on front neck
Tear away label
Shoulder-to-shoulder taping
Two-needle hemmed sleeves and bottom
Quarter-turned to eliminate center crease Imported, printed in USA]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-t-shirt-light-weight-loose-fit-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-t-shirt-light-weight-loose-fit-58.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-morale-patch-30.jpgcustom-itemoptacticalgear-pagegrpaOPTBWMP4OPT111As a tribute to all who follow the exploits of the RLI, RAR, Selous Scouts, RSAS, 32BN, SADF, etc. OPT presents the Bush Wars Logo, a tribute to both the Bushwood Country Club, and the incredible stories of African counter-insurgency against the Soviet backed revolutions of the 60s-80s. Sewn embroidery patch. Velcro Hook backing. 4 inch x 4 inch1https://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-morale-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-morale-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-calico-jack-patch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-calico-jack-patch-54.jpgitem.optacticalgear-pageflagpatches12CP5065034OPT Calico Jack PatchJack]]>111VELCRO Brand fastener backed, approximately 2.25" by 3.5" patch. Inset picture is taken on USGI ACUs. Colors: Black, Olive, Sand, Gray1https://s.turbifycdn.com/aah/optacticalgear/opt-calico-jack-patch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-calico-jack-patch-67.jpgJack]]>https://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-bumper-sticker-40.jpgcustom-itemoptacticalgear-pagestickersOPDBBS3.5OPT Douchebag Bumper StickerOPT111Revered and praised by Communists for his mediocre book about Guerrilla Warfare and his failures at actually leading anything; we bring you... The ultimate Douchebag Communist, celebrated through capitalism! "Che was like the little engine that couldn't, he just sucked" -Fidel Castro "I love celebrating communist revolutionaries by wearing shirts with their icons on them made in third world slave labor factories, it's how they would have wanted it!" -American Hipster, Dew Schnozzle "Che was pretty awesome... what did he do? I don't have any idea, all my buddies say he was awesome, why would I even research something like that?" -Ben Atool, Minimum Wage Rights Activist "I love the sticker, but I'm kind of scared someone who was alive back then will see his face and try to rear end me." -Javier Alejandro, Paraguay 3.5" x 11"1https://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-bumper-sticker-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-bumper-sticker-49.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-t-shirt-athletic-fit-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-t-shirt-athletic-fit-45.jpgcustom-itemoptacticalgear-pagetshirtsOPTATFTCHET3025OPT DouCheBag T-Shirt Athletic FitOPT111Dedicated to the ultimate communist douchebag. Wanna piss off liberals, commies, socialists, and clueless douchebags who have no idea who Che was or what he stood for? Athletic fit Next Level SHORT SLEEVE Tee, poly-cotton blend, order one size larger for loose fit Set-in rib collar with shoulder-to-shoulder taping Double-needle sleeve and bottom hems Color: Heather Gray Sizes: Small - 3XLarge1https://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-t-shirt-athletic-fit-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-t-shirt-athletic-fit-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-emanuel-wyne-pirate-flag-patch-32.jpgitem.optacticalgear-pageflagpatches12CP5070884OPT Emanuel Wynn Pirate Flag PatchOPT111Approximately 3 inches by 2 inches, backed with hook side VELCRO Brand fastener.1https://s.turbifycdn.com/aah/optacticalgear/opt-emanuel-wyne-pirate-flag-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-emanuel-wyne-pirate-flag-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-enhanced-watch-cap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-enhanced-watch-cap-45.jpgcustom-itemoptacticalgear-pageopthatsOPTWATCAP19.9914.39OPT Enhanced Watch CapOPT111THE NEED:
Upgrade the Army issue cold weather / watch cap and modify it to be a solid patch platform for duty patches, or morale items. THE SOLUTION:
OPT's owner approached Milspec Monkey about modifying an existing design he sells by adding a rear patch panel to hold the US Army Nametape. THE OUTCOME: A quality, comfortable, and warm watch cap which accommodates duty patches or morale items. TECH SPECS:
- 100% synthetic, microfleece, no-pill POLARTEC 100
- Front Pile Tape is 3.75" x 2.5" with tapered corners
- Rear Pile Tape is 1.5" x 4.75"
- Edges sewn with a lock stitch to prevent snags when brushing by the loop area
- One Size Design
- Made in U.S.A.
- Berry Amendment Compliant All materials and workmanship are 100% made in the USA Patches not included.]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-enhanced-watch-cap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-enhanced-watch-cap-58.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-exclusives-62.jpgcustom-itemoptacticalgear-pageindex-OPT Exclusives1optmasofpadejowabllahooptappareloptshortsopthatsopttagemedicalpatchesgrpaflagpatchespvcpatchesstickershodepaandstlacutpaOur proprietary designs and collaborations.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-exclusives-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-exclusives-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-fun-meter-patch-40.jpgitem.optacticalgear-pagegrpa12CP5064992OPT Fun Meter PatchOPT111Is your fun-meter pegged? These items measure one inch by two inches, and come with a "hook" VELCRO Brand fastener back. Available in full color, blue with white trim, or in tactical colors subdued for green or desert type operations.1https://s.turbifycdn.com/aah/optacticalgear/opt-fun-meter-patch-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-fun-meter-patch-49.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-chest-patch-3-inch-x-5-inch-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-chest-patch-3-inch-x-5-inch-59.jpgcustom-itemoptacticalgear-pageflagpatchesOPTGFCP6OPT Gadsden Flag Large Patch 3 x 5 inchOPT111The Gadsden flag is a historical American flag with a yellow field depicting a rattlesnake coiled and ready to strike. Positioned below the rattlesnake are the words "Don't tread on me." The flag is named after American general and statesman Christopher Gadsden (1724–1805), who designed it in 1775 during the American Revolution. It was also used by the Continental Marines as an early motto flag, along with the Moultrie Flag. Hook Tape Backing. Designed to be worn on the chest of Body Armor. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-chest-patch-3-inch-x-5-inch-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-chest-patch-3-inch-x-5-inch-69.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-small-patch-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-small-patch-58.jpgcustom-itemoptacticalgear-pageflagpatchesOPTGADSM4OPT Gadsden Flag Small PatchOPT111 The Gadsden flag is a historical American flag with a yellow field depicting a rattlesnake coiled and ready to strike. Positioned below the rattlesnake are the words "Don't tread on me." The flag is named after American general and statesman Christopher Gadsden (1724–1805), who designed it in 1775 during the American Revolution. It was also used by the Continental Marines as an early motto flag, along with the Moultrie Flag. Velcro Hook Tape Backing. Size approximately 2 x 3 inches. 1https://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-small-patch-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-small-patch-71.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-sticker-29.jpgcustom-itemoptacticalgear-pagestickersOPTGADSSTICKER3OPT Gadsden Flag StickerOPT111Long-lasting printed vinyl sticker featuring the Gadsden Flag. The Gadsden flag is a historical American flag with a yellow field depicting a rattlesnake coiled and ready to strike. Positioned below the rattlesnake are the words "Don't tread on me." The flag is named after American general and statesman Christopher Gadsden (1724–1805), who designed it in 1775 during the American Revolution. It was also used by the Continental Marines as an early motto flag, along with the Moultrie Flag. Size approximately 2.63 x 4 inches. Long-lasting printed vinyl sticker.1https://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-pvc-patch-46.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTGRENPVC7OPT Gren-Ade Logo PVC PatchOPT111Features:
-PVC Material.
-Velcro Hook backing
-Size: 3.5 inch diameter]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-pvc-patch-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-pvc-patch-55.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTGREN3OPT Gren-Ade Logo StickerOPT111Features:
-Long-lasting printed vinyl sticker
-Size: 4 inch diameter]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-sticker-39.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-t-shirt-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-t-shirt-17.jpgcustom-itemoptacticalgear-pageoptapparelOPTGRENTEENEW25OPT Gren-Ade Logo T-ShirtOPT111T-Shirt tribute to the finest of tossable munitions, this shirt is built to the quality, and specs that OPT demands of its products. This is a light weight, athletic fit, durable, moisture wicking shirt. Built for those times when a clingy fabric is least desirable, whether in the gym, at the range, on the trail, lounging and chill on the couch, or spending time with friends and family. OPT Gren-Ade Logo on front, small sign logo on upper back. Next Level Brand T-shirt: Athletic Fit, 60% Cotton 40% Poly Blend, Lightweight Material. For a loose fit, order one size larger than normal. Charcoal-Heather shirt, short sleeve.1https://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-t-shirt-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-t-shirt-30.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-patch-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-patch-45.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTJOEP5OPT Gustav Joe Logo PatchOPT111-High quality PVC material
-Velcro Hook backing
-Size: 1.5 x 1.25 inches Types:
-Standard Full Color
-Glow in the Dark Full Color (looks the same as Standard version)]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-patch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-patch-58.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTJOE3OPT Gustav Joe Logo StickerOPT111Features:
-Long-lasting printed vinyl sticker
-Size: 5 x 4 inches]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-39.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-mini-30.jpgcustom-itemoptacticalgear-pagestickersOPTJOEM1.5OPT Gustav Joe Logo Sticker - MiniOPT111-Long-lasting printed vinyl sticker
-Size: 2 x 1.5 inches]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-mini-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-mini-39.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-hats-38.jpgcustom-itemoptacticalgear-pageoptexclusivesOPT Hats1hodefrskpahahodedetistpahodekhpahathoderagrpahaoptrahatsocooptrangehatoptmutrflhatoptenwacapoptsignlogohathodeataupahahodemupahathodemublpahahodemutrpahahodewatrclhahodemublcltrhodewatrpahahodewocapahahodeorclorha1https://s.turbifycdn.com/aah/optacticalgear/opt-hats-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hats-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/special-forces-maritime-operations-oda-team-patch-production-over-run-45.jpgcustom-itemoptacticalgear-pagegrpaG003OPT Hellfish PatchOPT111-Left-Facing: Hellfish facing to left of patch.
-Right-Facing: Hellfish facing to right of patch. Sold individually.]]>
1https://s.turbifycdn.com/aah/optacticalgear/special-forces-maritime-operations-oda-team-patch-production-over-run-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/special-forces-maritime-operations-oda-team-patch-production-over-run-52.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-henry-every-pirate-flag-patch-39.jpgitem.optacticalgear-pageflagpatches12CP5070894OPT Henry Every Pirate Flag PatchOPT111Approximately 3 inches by 2 inches, backed with hook side VELCRO Brand fastener.1https://s.turbifycdn.com/aah/optacticalgear/opt-henry-every-pirate-flag-patch-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-henry-every-pirate-flag-patch-48.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/clearance-opt-i-fight-for-bush-patch-48.jpgitem.optacticalgear-pagegrpa21IFB43.5OPT I Fight For Bush PatchOPT1111https://s.turbifycdn.com/aah/optacticalgear/clearance-opt-i-fight-for-bush-patch-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-opt-i-fight-for-bush-patch-55.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/johnnie-warpath-black-label-hoodie-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/johnnie-warpath-black-label-hoodie-43.jpgcustom-itemoptacticalgear-pageoptexclusivesOPT-JWH44.95OPT Johnnie Warpath HoodieOPT111Sizing: standard Hoodie fit, go with your normal size.]]>1https://s.turbifycdn.com/aah/optacticalgear/johnnie-warpath-black-label-hoodie-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/johnnie-warpath-black-label-hoodie-53.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-johnnie-warpath-sticker-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-johnnie-warpath-sticker-45.jpgcustom-itemoptacticalgear-pagestickersXXJW43OPT Johnnie Warpath StickerOPT111Top shelf stickers for those on the Warpath. Keep Warring. Size: 4 x 3.71 inches1https://s.turbifycdn.com/aah/optacticalgear/opt-johnnie-warpath-sticker-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-johnnie-warpath-sticker-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-large-blackbeard-pirate-patch-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-large-blackbeard-pirate-patch-48.jpgcustom-itemoptacticalgear-pageflagpatchesOPTBBPPL6OPT Large Blackbeard Pirate PatchOPT111 Ask and ye shall receive... driven by customer requests, OPT brings you our exclusive Large Blackbeard Pirate Flag Patch. Approximately 3 inches by 4.25 inches, hook VELCRO Brand fastener backed.1https://s.turbifycdn.com/aah/optacticalgear/opt-large-blackbeard-pirate-patch-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-large-blackbeard-pirate-patch-61.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-large-pvc-flag-patch-3-x-5-inch-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-large-pvc-flag-patch-3-x-5-inch-44.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTPVCFLAG7OPT Large PVC US Flag Patch 3 x 5 inchOPT111 Rubberized/PVC material with Hook tape backing. Easier to clean off than embroidered version when dirty. Designed to be worn on the chest of an armor carrier. 1https://s.turbifycdn.com/aah/optacticalgear/opt-large-pvc-flag-patch-3-x-5-inch-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-large-pvc-flag-patch-3-x-5-inch-54.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-major-league-wolverine-patch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-major-league-wolverine-patch-54.jpgitem.optacticalgear-pagegrpa12CP5179754OPT Major League Wolverine PatchOPT111WOLVERINES!!! What more needs to be said? OPT exclusive, made in collaboration with Mil-Spec Monkey. Measures 3" x 2.2" Picture taken on a Crye Combat Shirt and a PCU soft shell. VELCRO Brand fastener backed1https://s.turbifycdn.com/aah/optacticalgear/opt-major-league-wolverine-patch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-major-league-wolverine-patch-67.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-embroidery-patch-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-embroidery-patch-48.jpgcustom-itemoptacticalgear-pagegrpaOPTMANDINFPTCH43OPT Mandalorian Infantry Embroidered PatchOPT111 Modeled after the Mandalorian symbol found on Boba Fett's armor, this patch features added Infantry crossed Rifles in the background. Sewn embroidery patch. Velcro Hook backing. 2.5 inch x 3.5 inch1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-embroidery-patch-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-embroidery-patch-61.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-ranger-panties-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-ranger-panties-45.jpgcustom-itemoptacticalgear-pageoptshortsOPTMANDINRP20OPT Mandalorian Infantry Ranger PantiesOPT111 Our exclusive Mandalorian Infantry Ranger Panties feature the Mandalorian symbol found on Boba Fett's armor with added Infantry crossed Rifles in the background. These Silkies are just what a grunt needs when you're knee deep in the Sarlacc Suck.1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-ranger-panties-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-ranger-panties-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTMANDIN3OPT Mandalorian Infantry StickerOPT111A tribute to all things Mandalorian and Grunt (yes, we were Infantry, give me a buffer, simple green, and I'll prove it while making mom jokes, and bitching about the shammers in 2nd platoon). Modeled after the Mandalorian symbol found on Boba Fett's armor, this sticker features added Infantry crossed rifles in the background. Adhesive backed. 3-inch by 5-inch oval1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-t-shirt-36.jpgcustom-itemoptacticalgear-pageoptapparelOPTMANDINTEE25OPT Mandalorian Infantry T-ShirtOPT111Modeled after the Mandalorian symbol found on Boba Fett's armor, this T-Shirt features Infantry crossed Rifles in the background. This is just what a grunt needs when you're knee deep in the Sarlacc Suck. Next Level Brand T-shirt: 60% Cotton 40% Poly Blend, lightweight material. Color: Black with off-white logo. T-Shirt only. Helmet not included.1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-t-shirt-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-t-shirt-45.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-patch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-patch-48.jpgcustom-itemoptacticalgear-pagegrpaOPTMANDPATCH3OPT Mandalorian SOF Embroidered PatchOPT111 Modeled after the Mandalorian symbol found on Boba Fett's armor, this patch features added Special Forces crossed arrows and Dagger in the background. Sewn embroidery patch. Velcro Hook backing. 3-inch diameter. 1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-patch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-patch-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-package-deal-39.jpgcustom-itemoptacticalgear-pageoptexclusivesOPTMANDSOFD44.7927.99OPT Mandalorian SOF Package Deal!OPT111IT'S BACK! For the price of 1 Mandalorian SOF T-Shirt and 1 Mandalorian SOF PVC Patch you get an additional Embroidered Patch and 2 Stickers. That's 38% off the regular price and you're covered for whatever the galaxy throws at you! Deal Includes:
1 x Mandalorian SOF T-Shirt
1 x Mandalorian SOF PVC Patch
1 x Mandalorian SOF Embroidered Patch
2 x Mandalorian SOF Stickers This deal available for a limited time, get some and may the force be with you... This item is excluded from the OPT Exclusive Swag Sale.]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-package-deal-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-package-deal-49.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-pvc-patch-45.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTMANDPVC6OPT Mandalorian SOF PVC PatchOPT111Modeled after the Mandalorian symbol found on Boba Fett's armor, this PVC vinyl patch features added Special Forces crossed arrows and Dagger in the background. PVC Material. Velcro Hook backing. 3-inch diameter. 1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-pvc-patch-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-pvc-patch-54.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-ranger-panties-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-ranger-panties-49.jpgcustom-itemoptacticalgear-pageoptshortsOPTMANDRP20OPT Mandalorian SOF Ranger PantiesOPT111 Exclusively through O P Tactical! These are custom printed SOFFE Tricot Running Shorts (AKA Ranger Panties) with our Mandalorian SOF Logo on the left side. Modeled after the Mandalorian symbol found on Boba Fett's armor, this logo features added Special Forces crossed arrows and Dagger in the background. Color: Black1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-ranger-panties-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-ranger-panties-62.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-sticker-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-sticker-61.jpgcustom-itemoptacticalgear-pagestickersOPTMAND3OPT Mandalorian SOF StickerOPT111 Modeled after the Mandalorian symbol found on Boba Fett's armor, this sticker features added Special Forces crossed arrows and Dagger in the background. Adhesive backed. 3-inch diameter.1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-sticker-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-sticker-74.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-t-shirt-42.jpgcustom-itemoptacticalgear-pageoptapparelOPTMANDT621025OPT Mandalorian SOF T-ShirtOPT111Modeled after the Mandalorian symbol found on Boba Fett's armor, this T-shirt features added Special Forces crossed arrows and Dagger in the background. Next Level Brand T-shirt: 60% Cotton 40% Poly Blend, lightweight material. Color: Black with off-white logo.1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-t-shirt-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-t-shirt-51.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mega-force-shoulder-insignia-pvc-30.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTMFSIP7OPT Mega Force Shoulder Insignia PVCOPT111Mega Force, Shoulder Unit Insignia PVC Patch. In honor of the finest SOF Light Infantry unit ever assembled. Size: 4" Tall x 2.25" Wide PVC material Velcro hook backing1https://s.turbifycdn.com/aah/optacticalgear/opt-mega-force-shoulder-insignia-pvc-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mega-force-shoulder-insignia-pvc-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-minor-league-shooters-pvc-patch-38.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTMLSPVC7OPT Minor League Shooters PVC PatchOPT111We can't all be first round picks, but we can still answer the call Size: 2" x 3" PVC material Glows in the dark Velcro hook backing.1https://s.turbifycdn.com/aah/optacticalgear/opt-minor-league-shooters-pvc-patch-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-minor-league-shooters-pvc-patch-47.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mobile-infantry-pvc-patch-30.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTMOBINFPVC7OPT Mobile Infantry PVC PatchOPT111Service guarantees citizenship! Everybody fights, no one quits. If you don't do your job, I'll kill you myself! Size: 3" PVC material Velcro hook backing. 1https://s.turbifycdn.com/aah/optacticalgear/opt-mobile-infantry-pvc-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mobile-infantry-pvc-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-multicam-tropic-flag-hat-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-multicam-tropic-flag-hat-45.jpgcustom-itemoptacticalgear-pageopthatsOPTFLAGHAT20OPT Multicam Tropic Flag HatOPT111THE NEED:
A simple range hat with embroidered US Flag and no top button for use with electronic hearing protection. THE SOLUTION:
OPT's owner approached a hat manufacturer that does Berry Compliant hats for a simple solution to a simple need. THE OUTCOME:
A quality, comfortable range hat with embroidered US Flag in matching colors that meets the needs of both professional and civilian shooters. OPT website located on the back for others to know where to go for quality kit. TECH SPECS:
- Genuine Crye Precision 50/50 Ripstop Fabric
- Flag is 3" x 2"
- One Size Design
- Bungee retention on the back is internally adjustable and provides added comfort.
- Made in U.S.A.
- Berry Amendment Compliant Life time warranty.]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-multicam-tropic-flag-hat-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-multicam-tropic-flag-hat-58.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-north-carolina-large-state-flag-patch-31.jpgcustom-itemoptacticalgear-pageflagpatchesOPTNCFLAG6OPT North Carolina Large State Flag PatchOPT111North Carolina State Flag, 3 x 5 inch size, velcro hook backing. The perfect size to fit on the front panel of most armor carriers. Note - dimensions on the flag were scaled to best fit the 3 x 5 inch size common to most armor carriers and vests.1https://s.turbifycdn.com/aah/optacticalgear/opt-north-carolina-large-state-flag-patch-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-north-carolina-large-state-flag-patch-40.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-patch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-patch-54.jpgcustom-itemoptacticalgear-pagegrpa12ND6OPT Nous Defions Patch - LargeOPT111OPT's custom Nous Defions Patch, 3.5 x 3.5 inch size with velcro hook backing for attaching to combat shirts, vests, and packs. US Army Special Forces Direct Action (DA) CQB Skull, Dagger and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is the symbol that represents DA units and schools, its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the skull represents the same thing any skull represents, death. "Nous Defions" is French for "we defy" representing the unit's audacity.1https://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-patch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-patch-67.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-pvc-patch-30.jpgcustom-itemoptacticalgear-pagepvcpatches12NDPVC6OPT Nous Defions PVC PatchOPT111OPT's custom Nous Defions PVC Patch, 3 x 3 inch size with velcro hook backing for attaching to combat shirts, vests, and packs. US Army Special Forces Direct Action (DA) CQB Skull, Dagger and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is the symbol that represents DA units and schools, its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the skull represents the same thing any skull represents, death. "Nous Defions" is French for "we defy" representing the unit's audacity.1https://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-pvc-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-pvc-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-omega-sector-patch-30.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTOMSECTPVC7OPT Omega Sector PatchOPT111Omega Sector, the true silent professionals Size: 3.5" PVC material Velcro hook backing.1https://s.turbifycdn.com/aah/optacticalgear/opt-omega-sector-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-omega-sector-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-original-t-shirt-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-original-t-shirt-59.jpgcustom-itemoptacticalgear-pageoptapparelOPTLOGOT3025OPT Original T-Shirt OPT111 The original OPT Logo. Athletic fit Next Level Tee, poly-cotton blend, order one size larger for loose fit. Set-in rib collar with shoulder-to-shoulder taping Double-needle sleeve and bottom hems Color: Black Sizes: Small - 3XLarge1https://s.turbifycdn.com/aah/optacticalgear/opt-original-t-shirt-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-original-t-shirt-72.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-pvc-us-flag-patch-standard-size-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-pvc-us-flag-patch-standard-size-45.jpgcustom-itemoptacticalgear-pageflagpatchesOPTPVCUSSTD7OPT PVC US Flag Patch - Standard SizeOPT111Velcro backed US Flag patch made from heavy duty PVC for to withstand all environments. •Hook Tape backing •3.25" x 2" •Heavy duty washable PVC1https://s.turbifycdn.com/aah/optacticalgear/opt-pvc-us-flag-patch-standard-size-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-pvc-us-flag-patch-standard-size-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-52.jpgcustom-itemoptacticalgear-pageopthatsOPTRANHAT24.9920OPT Range HatOPT111THE NEED:
A simple range hat with no top button for use with hearing protection, and available Pile Tape panels for morale or IFF items. THE SOLUTION:
OPT's owner approached a hat manufacturer that does Berry Compliant hats for a simple solution to a simple need. THE OUTCOME:
A quality, comfortable range hat that meets the needs of both professional and civilian shooters. TECH SPECS:
- Genuine Crye Precision 50/50 Ripstop Fabric
- Front Pile Tape is 3" x 2"
- Rear Pile Tape is 3" x 2"
- Top Pile Tape is 1" x 1"
- One Size Design
- Bungee retention on the back is internally adjustable and provides added comfort.
- Made in U.S.A.
- Berry Amendment Compliant OPTIONS:
Multicam, Multicam Black, Multicam Arid, Multicam Tropic Life time warranty.]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-65.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-solid-color-all-cotton-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-solid-color-all-cotton-47.jpgcustom-itemoptacticalgear-pageopthatsOPTRANHATSC2520OPT Range Hat Solid Color - All CottonOPT111THE NEED:
A simple range hat with no top button for use with hearing protection, and available Pile Tape panels for morale or IFF items. THE SOLUTION:
OPT's owner approached a hat manufacturer that does Berry Compliant hats for a simple solution to a simple need. THE OUTCOME:
A quality, comfortable range hat that meets the needs of both professional and civilian shooters. TECH SPECS:
- 100% Cotton
- Front Pile Tape is 3" x 2"
- Rear Pile Tape is 3" x 2"
- Top Pile Tape is 1.5" x 1.5"
- One Size Design
- Bungee retention on the back is internally adjustable and provides added comfort.
- Made in U.S.A.
- Berry Amendment Compliant OPTIONS:
Jalepeno (close match to Ranger Green), Khaki Life time warranty.]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-solid-color-all-cotton-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-solid-color-all-cotton-60.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-red-crescent-red-diamond-patch-40.jpgitem.optacticalgear-pagegrpa12CP5070914OPT Red Cross - Red Crescent - Red Diamond PatchOPT111Approximately 2 inches by 3 inches, hook VELCRO Brand fastener backed.1https://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-red-crescent-red-diamond-patch-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-red-crescent-red-diamond-patch-49.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-patch-49.jpgitem.optacticalgear-pagegrpa12CP5070933OPT Red Cross PatchOPT1111.75 inches by 1.75 inches, backed with hook side VELCRO Brand fastener.1https://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-patch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-patch-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-logo-sticker-68.jpgcustom-itemoptacticalgear-pagestickersOPTSFALS3OPT SF Assaulter Logo StickerOPT111OPTactical Historical SOF Unit Tribute Series: US Army Special Forces Direct Action (DA) CQB Skull, Dagger and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is the symbol that represents DA units and schools, its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the skull represents the same thing any skull represents, death. "Nous Defions" is French for "we defy" representing the unit's audacity. Diameter: 4 inches Adhesive backed sticker.1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-logo-sticker-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-logo-sticker-77.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-us-flag-patch-3-x-5-inch-30.jpgcustom-itemoptacticalgear-pageflagpatchesOPTSFAUS6OPT SF Assaulter US Flag Patch 3 x 5 InchOPT111Hook Tape Backing, 3 x 5 inches. US Army Special Forces Direct Action (DA) CQB Skull, Dagger and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is a US flag inlaid with the symbol for DA units and schools, its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the skull represents the same thing any skull represents, death. "Nous Defions" is French for "we defy" representing the unit's audacity. Designed to be worn on the chest of Body Armor.1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-us-flag-patch-3-x-5-inch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-us-flag-patch-3-x-5-inch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-34.jpgcustom-itemoptacticalgear-pageoptshortsOPTSFRP20OPT SF Ranger Panties - Assaulter LogoOPT111Exclusively through O P Tactical! These are custom printed SOFFE Tricot Running Shorts (AKA Ranger Panties) with Special Forces "Nous Defions" Assaulter Logo on the left side. Color: Black1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-41.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-sniper-logo-33.jpgcustom-itemoptacticalgear-pageoptshortsOPTSFRPSNIPER20OPT SF Ranger Panties - Sniper LogoOPT111Exclusively through O P Tactical! These are custom printed SOFFE Tricot Running Shorts (AKA Ranger Panties) with Special Forces Sniper Logo on the left side. Color: Black1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-sniper-logo-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-sniper-logo-42.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-patch-56.jpgcustom-itemoptacticalgear-pagegrpaOPTSFSLP5OPT SF Sniper Logo PatchOPT111OPTactical Historical SOF Unit Tribute Series: US Army Special Forces Snipers Skull, Dagger, Crosshairs, and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is the symbol that represents a particular group of SFODAs in a direct action unit. Its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg, and this symbol was developed by an SFODA that has its roots in the units that came out of that project. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the crosshairs represent the long range interdiction capability, the skull represents the same thing any skull represents, death. The original version of this is still in use by certain units, this is modified and is not a direct copy. Hook Tape backing, 3.5 inch diameter.1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-patch-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-patch-65.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-sticker-66.jpgcustom-itemoptacticalgear-pagestickersOPTSFSLS3OPT SF Sniper Logo StickerOPT111OPTactical Historical SOF Unit Tribute Series: US Army Special Forces Snipers Skull, Dagger, Crosshairs, and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is the symbol that represents a particular group of SFODAs in a direct action unit. Its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg, and this symbol was developed by an SFODA that has its roots in the units that came out of that project. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the crosshairs represent the long range interdiction capability, the skull represents the same thing any skull represents, death. The original version of this is still in use by certain units, this is modified and is not a direct copy. Diameter: 4 inches Adhesive backed sticker.1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-sticker-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-sticker-75.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-apparel-65.jpgcustom-itemoptacticalgear-pageoptexclusivesOPT Shirts1optgrlothodetophattehoderesiloteoptbeinlitoptdotatfitoptoriginalteeoptacetoteerosqtwifitoptmaintoptmasoftoptbuwalotlioptsilotliwe1https://s.turbifycdn.com/aah/optacticalgear/opt-apparel-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-apparel-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-shorts-35.jpgcustom-itemoptacticalgear-pageoptexclusivesOPT Shorts1optmasofrapaoptmainrapaoptsfrapaoptsfrapasnl1https://s.turbifycdn.com/aah/optacticalgear/opt-shorts-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-shorts-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-hat-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-hat-49.jpgcustom-itemoptacticalgear-pageopthatsOPTLHAT3025OPT Sign Logo HatOPT111 Our store sign logo. Adjustable strap back closure, ripstop material hat, with OPT logo embroidered on the front, and our URL embroidered on the rear. No button on top for comfort when using over the head ear protection. Light Olive Green in color ripstop material. Logo is Grey-Green with Tan Lettering.1https://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-hat-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-hat-62.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-patch-30.jpgcustom-itemoptacticalgear-pagegrpaOPTSIGNEMB43OPT Sign Logo PatchOPT111An embroidery tribute to the newest chapter in the OPT Legacy, this patch is built to the quality and specs that people have come to expect from OPT. 3.75 x 2.30 inches, Velcro Backed.1https://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-sticker-21.jpgcustom-itemoptacticalgear-pagestickersOPTSIGNSTK32OPT Sign Logo StickerOPT111A sticker tribute to the newest chapter in the OPT Legacy. 4 x 2.85 inches1https://s.turbifycdn.com/aah/optacticalgear/opt-sign-sticker-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-sticker-28.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-t-shirt-light-weight-loose-fit-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-t-shirt-light-weight-loose-fit-53.jpgcustom-itemoptacticalgear-pagetshirtsOPTSIGNTEETB25OPT Sign Logo T-Shirt - Light Weight Loose FitOPT111TRI-BLEND Specs
50/37/13 Polyester/Cotton/Rayon Pre-shrunk Jersey
Weight approx. 4.5 oz / 153 g
Soft, lightweight jersey with moisture wicking
Seamless 1x1 rib collar with two-needle coverstitching on front neck
Tear away label
Shoulder-to-shoulder taping
Two-needle hemmed sleeves and bottom
Quarter-turned to eliminate center crease Imported, printed in USA]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-t-shirt-light-weight-loose-fit-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-t-shirt-light-weight-loose-fit-66.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-blackbeard-pirate-flag-patch-32.jpgitem.optacticalgear-pageflagpatches12CP5070874OPT Small Blackbeard Pirate Flag PatchOPT111Approximately 2 inches by 3 inches, hook VELCRO Brand fastener backed.1https://s.turbifycdn.com/aah/optacticalgear/opt-blackbeard-pirate-flag-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-blackbeard-pirate-flag-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-tactical-gear-43.jpgcustom-itemoptacticalgear-pageoptexclusivesOPT Tactical Gear and Exclusive Offers1vesyliweplcaopmbasplca1https://s.turbifycdn.com/aah/optacticalgear/opt-tactical-gear-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-tactical-gear-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-texas-flag-large-patch-3-x-4-5-inch-32.jpgcustom-itemoptacticalgear-pageflagpatchesOPTTFPL6OPT Texas Flag Large Patch 3 x 4.5 InchOPT111Hook Tape Backing, 3 x 4.5 inches. Designed to be worn on the chest of Body Armor. 1https://s.turbifycdn.com/aah/optacticalgear/opt-texas-flag-large-patch-3-x-4-5-inch-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-texas-flag-large-patch-3-x-4-5-inch-41.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-large-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-large-55.jpgitem.optacticalgear-pagegrpaOPTGCLG5OPT The Original Guns and Coffee Patch - LargeOPT111Both colors are 3.5 inches in diameter.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-large-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-large-68.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-small-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-small-54.jpgitem.optacticalgear-pagegrpaOPTGCSMALL3OPT The Original Guns and Coffee Patch - SmallOPT111NOTE: the Green&White patch is 2.75 inches in diameter, and the Green&Tan is 3 inches in diameter.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-small-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-small-67.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-sticker-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-sticker-61.jpgcustom-itemoptacticalgear-pagestickersGACS3OPT The Original Guns and Coffee 4 inch StickerOPT111This is the original, and still the best, dating back to spring 2010, an idea born from a thread on Lightfighter forum and that has come to be the cornerstone of a very common icon within the industry. The emblems on the side of the patch are E-Type Silhouettes used as rifle targets in the military. Sticker comes in 4 inch and 6 inch diameter. Full color or subdued color options.1https://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-sticker-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-sticker-74.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-total-war-bumper-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTTOTWARBS4OPT Total War Bumper StickerOPT111A design that speaks for itself... Working with a renowned artist in the gear industry, OPT teamed up with Righteous Duke to bring you a tribute to the perfect form of coexistence, Total WAR. 3" x 10"1https://s.turbifycdn.com/aah/optacticalgear/opt-total-war-bumper-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-total-war-bumper-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-us-flag-large-patch-3-x-5-inch-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-us-flag-large-patch-3-x-5-inch-53.jpgcustom-itemoptacticalgear-pageflagpatchesOPTUSFCP6OPT US Flag Large Patch 3 x 5 inchOPT111 Hook Tape Backing, 3 x 5 inches. Designed to be worn on the chest of Body Armor. 1https://s.turbifycdn.com/aah/optacticalgear/opt-us-flag-large-patch-3-x-5-inch-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-us-flag-large-patch-3-x-5-inch-66.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/us-flag-patch-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/us-flag-patch-54.jpgitem.optacticalgear-pageflagpatches34734_4OPT US Flag PatchPatch]]>111Note: Due to how small this item is, the Multicam version has very little of the pattern shown on it.]]>1https://s.turbifycdn.com/aah/optacticalgear/us-flag-patch-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/us-flag-patch-64.jpgPatch]]>https://s.turbifycdn.com/aah/optacticalgear/opt-war-drug-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTDRU3OPT War Drug StickerOPT111Features:
-Long-lasting printed vinyl sticker
-Size: 5 x 3 inches]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-war-drug-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-war-drug-sticker-39.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-yeet-sticker-30.jpgcustom-itemoptacticalgear-pagestickersoptyeetsticker43OPT YEET! StickerOPT111Features:
- Long-lasting printed vinyl sticker
- Size 2" x 4.75"]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-yeet-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-yeet-sticker-39.jpgOPT
https://s.turbifycdn.com/aah/optacticalgear/opt-altama-exclusive-maritime-assault-land-warfare-mod-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-altama-exclusive-maritime-assault-land-warfare-mod-21.jpgcustom-itemoptacticalgear-pageovbeofo138330002112.49104.99OPT-Altama Exclusive Maritime Assault - Land Warfare ModAltama Boots111Features
• Mid cut design for better ankle support while being low enough for easy range of motion
• High abrasion quick drying 1000D Cordura quarter panels
• Air mesh linings help wick away sweat and other moisture quickly from your feet
• Non-shine rust-proof lace hardware will not break on the battle field
• Low profile laces
• Full length one piece ABS shank provides stability and support when climbing a caving ladder
Anti-microbial foam insole with fabric top cover for ease of use with socks
• High abrasion rubber sticky outsole originally developed for rock climbing shoes, meets ASTM F2913-17 test for slip resistance
• Zero Drop outsole provides full contact with the floor for increased stability
• Heel counter is Back Part Molded to produce a customized curve that cups the foot, eliminated all "break-in" discomfort. Designed for Specials Ops. Worn by the Elite. These shoes are no longer fin-friendly; they do not feature drain holes, nor do they have the SEAL Rubber sticky outsoles. Sizing: Available in Regular and Wide sizes. Similar sizing to Converse Chuck Taylors. True to size for most people. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-altama-exclusive-maritime-assault-land-warfare-mod-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-altama-exclusive-maritime-assault-land-warfare-mod-35.jpgAltama Boots
https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-belt-pack-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-belt-pack-34.jpgcustom-itemoptacticalgear-pagehipegekitba117BLPM81137OPT-Hill People Gear M81 Woodland Belt Pack - SnubbyHill People Gear111Custom M81 Woodland Belt Pack available at O P Tactical! Sometimes attire and situations don't lend to on-body pistol carry very well and HPG's chest mounted kit bags might be out of place in those circumstances. HPG took their Snubby Kit Bag Original Pattern and replaced the mesh harness with a 1.5" webbing belt that can be worn around the waist or cross-body. This is a great solution to keep all your EDC items organized when you go to the gym, travel to a new city, or on a front country hike. This bag can carry up to a stock Glock 19 size firearm, but really shines with sub-compact pistols. Features:
- 500d construction
- Quick access concealed pistol compartment.
- 1.5" webbing belt with ITW Nexus buckle
- Elastic keepers for the webbing strap
- Velcro loop and dummy cord loop in pistol compartment allow for various retention options
- Tabs on the bottom to hang items.
- Front zippered access flat pocket with two interior slot pockets with dummy cord loops above them
- Large 1" deep main compartment with dual interior slot pockets with dummy cord loops above them.
- Main Compartment lined with 6/12 velcro loop that is laser cut to accept PALS style pouches. Specifications:
- Weight: 0.88 lb
- Length: 2.00 in
- Width: 8.50 in
- Height: 6.00 in Made in the USA. This Item is Excluded from ALL Coupon Codes.]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-belt-pack-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-belt-pack-44.jpgHill People Gear
https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-original-kit-bag-full-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-original-kit-bag-full-56.jpgcustom-itemoptacticalgear-pagehipegekitba117M81OKBF148OPT-Hill People Gear M81 Woodland Original Kit Bag - FullHill People Gear111Custom M81 Woodland Kit Bags available at O P Tactical! Kit Bags were born out of the desire to discreetly carry a pistol in a way that doesn't interfere with a full size backpack. Kit Bags are so handy for keeping small items close at hand on the trail (or in the ATV, or in the canoe, or on the stand, etc.) that many folks choose to use them even without a pistol. The original Kit Bag has been around long enough now that we've added a few updates to the original design for V2:
• #10 zipper on the main cargo compartment instead of #8
• rear of the main cargo compartment is lined with PALS cut velcro faced fabric (First Spear 6/12) which allows for the mounting of PALS or velcro backed pouches inside the main compartmnet
• single row of PALS on the underside allows for mounting small items such as a knife The original Kit Bag V2 also includes the following features:
• 500d construction
• Quick access concealed pistol compartment
• Comfortable mesh backed H-harness allows you to wear the Kit Bag by itself or underneath of a pack
• Elastic keepers for the H-harness straps
• Velcro loop and dummy cord loop in pistol compartment allow for various retention options
• tabs with grimlocs at the top for hanging on another pack, or for use with Lifter Straps (included) for docking to a host pack
• Tabs on the bottom for attaching to another pack, or for use with the Stabilizer Kit (optional) for running with
• Front zippered access flat pocket with two interior slot pockets with dummy cord loops above them
• Large 1" deep main compartment with dual interior slot pockets with dummy cord loops above them Specifications:
• Weight: 1.00 lb
• Length: 2.50 in
• Width: 11.50 in
• Height: 7.50 in Made in the USA. This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-original-kit-bag-full-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-original-kit-bag-full-70.jpgHill People Gear
https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-recon-kit-bag-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-recon-kit-bag-36.jpgcustom-itemoptacticalgear-pagehipegekitba117REKBM81120OPT-Hill People Gear M81 Woodland Recon Kit Bag - FullHill People Gear111Custom M81 Woodland Kit Bags available at O P Tactical! Some folks really like to have their own organizational layout and HPG gets that. The Recon Kit Bag takes the thin Runner's profile and adds a PALS grid on the front. This gives you the option of running low profile (size wise if not social wise) or adding your own PALS compatible pouches on the front. It is really nice with a Blue Force Gear triple 5.56 ten speed pouch on the front. It makes for a good weapon support platform for training classes (mags on front, BUG in the pistol compartment) or a mini-chest rig over a slick plate carrier for patrol. Features:
-500d construction
-8 channel / 3 row PALS grid
-Quick access concealed pistol compartment
-Comfortable mesh backed H-harness allows you to wear the Kit Bag by itself or underneath of a pack
-Elastic keepers for the H-harness straps
-Velcro loop and dummy cord loop in pistol compartment allow for various retention options
-Tabs with grimlocs at the top for hanging on another pack, or for use with Lifter Straps (optional) for docking to a host pack
-For use with the Stabilizer Kit (optional) for running with
-Front zippered access flat pocket with two interior slot pockets with dummy cord loops above them
-Pro-tip: one of our GI 1qt bottle holsters mounted on the front of a Recon makes a dandy quick access binocular carrier.

-Weight: 0.81 lb
-Length: 1.00 in
-Width: 11.50 in
-Height: 7.50 in Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-recon-kit-bag-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-recon-kit-bag-46.jpgHill People Gearhttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-runners-kit-bag-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-runners-kit-bag-34.jpgcustom-itemoptacticalgear-pagehipegekitba117RUKBM81106OPT-Hill People Gear M81 Woodland Runners Kit Bag - FullHill People Gear111Custom M81 Woodland Kit Bags available at O P Tactical! The Runner's Kit Bag was designed specifically for carrying a pistol while running in urban environments. It also works well in higher activity situations (running, mountain biking, rock climbing) where you would like to discreetly carry a pistol and very little else. Features:
-500d construction
-Quick access concealed pistol compartment
-Comfortable mesh backed H-harness allows you to wear the Kit Bag by itself or underneath of a pack
-Tabs on the bottom for attaching to another pack, or to use with the Stabilizer Kit (included) for less movement when running
-Velcro loop and dummy cord loop in pistol compartment allow for various retention options
-Tabs with grimlocs at the top for hanging on another pack, or for use with Lifter Straps (optional) for docking to a host pack
-Front zippered access flat pocket with two interior slot pockets with dummy cord loops above them
-Pro - tip: replace the color matched parachute cord zipper pulls with flamboyant contrasting colors of your choosing for an even lower social profile.
-This is not a good choice if you want to carry a 6 shot bigger bore revolver (S&W N-frame and similar). The lack of a middle pocket for the cylinder to intrude into tends to jam the cylinder into your chest. Go with the original Kit Bag instead.

-Weight: 0.81 lb
-Length: 1.00 in
-Width: 11.50 in
-Height: 7.50 in Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-runners-kit-bag-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-runners-kit-bag-44.jpgHill People Gearhttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-reagan-patch-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-reagan-patch-43.jpgcustom-itemoptacticalgear-pagehodepaandstOPTREAGAN6.5OPT-Hodge Defense Reagan PatchHodge Defense111 Fight the next Evil Empire with this high quality screen printed patch featuring our 40th President, Hodge Defense, and O P Tactical. Size: 4 x 3 inches Velcro hook backing.1https://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-reagan-patch-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-reagan-patch-56.jpgHodge Defensehttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-space-gun-patch-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-space-gun-patch-43.jpgcustom-itemoptacticalgear-pagehodepaandstOPTSG6.5OPT-Hodge Defense Space Gun PatchHodge Defense111 Hodge Defense, OPT War Department, Space Gun - a superior combination in design and excellence. If you get it, you get it. Size: 4 x 2.5 inches Velcro hook backing.1https://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-space-gun-patch-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-space-gun-patch-56.jpgHodge Defensehttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-apc-shoulder-pads-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-apc-shoulder-pads-47.jpgcustom-itemoptacticalgear-pagecaac150VS-CPAD235OPT-Mayflower MBAV APC Shoulder PadsMayflower111• Stretchable Tweave material allows for slings and communications wiring to fit through the pad easily.
• Slim design for greater range of motion and less chafing along neck line.
• Thin foam padding for comfort on the underside of pad.
• Designed for 2-inch wide shoulder straps and will fit most carriers including vests from Mayflower, Velocity Systems, Crye Precision and Blue Force Gear.
• Similar design to shoulder pads found on the Velocity Systems Scarab LT. Sold as a set of 2 shoulder pads. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-apc-shoulder-pads-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-apc-shoulder-pads-63.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-assault-plate-carrier-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-assault-plate-carrier-45.jpgcustom-itemoptacticalgear-pagemaveclqaco50OPTMBAV276235OPT-Mayflower MBAV APC with Mesh PaddingMayflower111Our exclusive MBAV APC now includes 3D spacer mesh padding along the inner face of the front and back panels for comfort and ventilation! THE NEED:
A plate carrier that accommodates USSOCOM issued MBAV (Modular Body Armor Vest) soft armor and SAPI plates. Must feature high degree of scalability, modularity, PALS webbing, QASM compatibility, while maintaining the fundamentals of simplicity in wear and maintenance. THE SOLUTION: OPT's owner approached Mayflower about making simple modifications to the time proven, simple design of the Assault Plate Carrier. This is an APC sized to hold MBAV soft armor and SAPI plates, with added features of a removable front flap that exposes a pile tape belly area that easily accommodates any QASM compatible placard or chest rig, and updated slim shoulder pads with padding and stretchable tweave covering. THE OUTCOME: An affordable, highly modular, armor carrier, that provides any USSOCOM Operator with a high degree of load flexibility, and mobility; whether in training, or on the battlefield. FEATURES:
• Updated slim Shoulder Pads with thin padding for comfort and tweave stretch covering for running comms wiring and hydration tubing through. These are very similar to shoulder pads found on the Scarab LT Plate Carrier. Note: shoulder pads on the Multicam Tropic model are Ranger Green color since Tropic pattern is not yet available in tweave material. • The MBAV-APC comes with a removable front flap for optimized use with a SwiftClip Chest Rig or Placard. Front of the flap also features MOLLE/PALS webbing for pouch attachment and 3 rows of velcro loop for use with placards and chest rigs. • The upper front of the MBAV-APC contains an integral admin pouch with internal elastic loops to retain pens, pencils, chemlites or similar items. This pouch has a wider opening than the standard APC and can fit larger documents easier. • There is an additional pocket in front of the admin pouch to hold quick access documents like maps/index cards. • The front lower half of the APC has a velcro kangaroo pocket sized to hold up to three M4 sized magazines. A triple M4 pouch insert is available separately to fit this pocket. When using a triple mag insert, only hard plates that are less than 0.75 inches thick will fit properly. Plates that are 0.75 inches or thicker may have issues fitting into plate pocket when triple shingle is used and all 3 mags are in the shingle insert. • Cummerbund is made to Soft armor inserts, and can also fit thin 6x6 inch side plates in a separate pocket (may require an additional retainer strap to secure the top of a hard plate). Use same size Velocity Systems soft armor cummerbund insert as the size of the cummerbund. • The MBAV-APC features removable SwiftClip® Buckles on the front of the carrier to allow the individual to mount various chest rigs and placards directly to the carrier. This configuration allows the individual to use the same loadout with or without armor or have multiple rigs configured for different mission requirements. • Front/Back panels feature an internal plate strap to secure Hard plates and soft armor in place and adjust ride height in the pocket. Front/Back Panels available in two sizes; Small/Medium and Large/XLarge. Cummerbund available in 4 sizes. The plate pockets are sized to accommodate stand alone or in-conjunction with SAPI/ESAPI or Swimmer cut plates. Sized to fit MBAV soft armor or regular SAPI plate backer soft armor.Extensive testing has proven plate shifting is not an issue. The S/M APC will fit small, medium and 10”x12” sized plates. The L/XL APC will fit large and extra-large plates. Sizing:
S/M1 - Small/Medium Front and Back Panel, Small Cummerbund: 5 Columns of MOLLE per side
S/M2 - Small/Medium Front and Back Panel, Medium Cummerbund: 6 Columns of MOLLE per side
L/XL3 - Large/XLarge Front and Back Panel, Medium Cummerbund: 6 Columns of MOLLE per side
L/XL4 - Large/XLarge Front and Back Panel, Large Cummerbund: 8 Columns of MOLLE per side Cummerbund has a wide range of adjustment, when in doubt go with the larger Cummerbund size, as your armor will increase the diameter once in the carrier. S/M1 is best suited for users who wear Small or Medium SAPI Plates and have a thin waist (32 inch or less). Most users who wear Medium SAPI plates will need the S/M2 size. Most users who wear Large SAPI Plates will need L/XL3. L/XL4 will accommodate users who have a wider waist line and use Large or XL SAPI Plates. Weight: Approximately 2 lbs (S/M2 size) Material: 500D Cordura, Tweave Shoulder Pads All materials and workmanship are 100% made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-assault-plate-carrier-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-assault-plate-carrier-55.jpgMayflower
https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-47.jpgcustom-itemoptacticalgear-pageflagpatches82BLKBRD19.9917.99OPT-Spartan Village Blackbeard Pirate Patch - Large SizeSpartan Village111IR REFLECTIVE MODEL CANNOT SHIP INTERNATIONAL. USA Addresses only for this version. Made by Spartan Village at O P Tactical's request, these Blackbeard Pirate Flag Patches are laser-cut from Cordura nylon and feature Velcro Hook backing. They are the perfect size to fit on the front of a vest or carrier. Camouflage pattern colors are exact matching. Specs:
• 3 x 5 inch size
• Cordura material with matte vinyl background
• Velcro Hook backing Types:
• Black Vinyl background: visible spectrum only
• Black IR background: Infrared reflective Made in the USA. IR REFLECTIVE MODEL CANNOT SHIP INTERNATIONAL. USA Addresses only for this version. This Item is Excluded from the Limited Sale Coupon Codes.]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-60.jpgSpartan Village
https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-laser-cut-us-flag-patch-large-ir-r-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-laser-cut-us-flag-patch-large-ir-r-53.jpgcustom-itemoptacticalgear-pagelacutpa82SVFLAGIRLG27.9924.99OPT-Spartan Village Laser-Cut US Flag Patch - Large IR Version (R)Spartan Village111-3 x 5 inch size
-Cordura material with matte vinyl IR background
-Velcro Hook backing Made in the USA. Per ITAR regulations, IR flags are NOT AVAILABLE FOR EXPORT. USA Addresses Only. This Item is Excluded from the Limited Sale Coupon Codes.]]>
1https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-laser-cut-us-flag-patch-large-ir-r-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-laser-cut-us-flag-patch-large-ir-r-63.jpgSpartan Village
https://s.turbifycdn.com/aah/optacticalgear/spartan-village-large-us-flag-patch-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-large-us-flag-patch-35.jpgcustom-itemoptacticalgear-pagelacutpa82SVFLAG21.9919.99OPT-Spartan Village Laser-Cut US Flag Patch - Large SizeSpartan Village111These patches are NOT IR reflective, which means no ITAR restrictions and makes them significantly less expensive. They are also non-reflective for visible light spectrum. Specs:
-3 x 5 inch size
-Cordura material with matte vinyl background
-Velcro Hook backing Made in the USA. This item is allowed to ship to international for our foreign customers! This Item is Excluded from the Limited Sale Coupon Codes.]]>
1https://s.turbifycdn.com/aah/optacticalgear/spartan-village-large-us-flag-patch-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-large-us-flag-patch-45.jpgSpartan Village
https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-44.jpgcustom-itemoptacticalgear-pagelacutpa82OPTMANDO18.9916.99OPT-Spartan Village Mandalorian SOF PatchSpartan Village111These patches are NOT IR reflective, which means no ITAR restrictions and makes them significantly less expensive. They are also non-reflective for visible light spectrum. 3.5 x 3.5 inches. Velcro Hook backing. Made in the USA. This Item is Excluded from the Limited Sale Coupon Codes.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-57.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-ir-r-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-ir-r-36.jpgcustom-itemoptacticalgear-pagelacutpa82MANDAIR27.9925.99OPT-Spartan Village Mandalorian SOF Patch - IR Version (R)Spartan Village111Per ITAR regulations, IR flags are NOT AVAILABLE FOR EXPORT. USA Addresses Only. This Item is Excluded from the Limited Sale Coupon Codes.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-ir-r-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-ir-r-46.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/opt-velocity-systems-assault-zip-on-panel-type-1-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-velocity-systems-assault-zip-on-panel-type-1-36.jpgcustom-itemoptacticalgear-pagevesyscplcaan98ZOMF-BP189.99OPT-Velocity Systems Scarab Assault Zip-On Panel Type 1Velocity Systems111Designed specifically to zip onto the Scarab LT Plate Carrier only. Not MOLLE compatible. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-velocity-systems-assault-zip-on-panel-type-1-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-velocity-systems-assault-zip-on-panel-type-1-46.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/optic-mounting-tools-35.jpgcustom-itemoptacticalgear-pageopticsOptic Mounting Tools1ardeoplecofixitstscjafixitstaltod1https://s.turbifycdn.com/aah/optacticalgear/optic-mounting-tools-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/optic-mounting-tools-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/optics-60.jpgcustom-itemoptacticalgear-pageweac-Optics / Mounts1lplowpovaopardsreddotsiamrmireddotsiopmotospscmobi1https://s.turbifycdn.com/aah/optacticalgear/optics-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/optics-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/ors-oral-rehydration-salts-37.jpgcustom-itemoptacticalgear-pagehysyorsorresa1.5 25 30ORS Oral Rehydration Salts PacketORS111Description: NSN# 6505-01-197-8809 Required treatment for severe diarrhea, or other illnesses where dehydration is a problem. These rehydration salts, made from the standard World Health Organization formula, should be a part of every travel kit, particularly for those traveling with children or in Third World countries. The combination of salt (as Sodium Chloride, 3.5 g. and Trisodium Citrate, Dihydrate, 2.9 g.), potassium (as Potassium Chloride, 1.5 g.) and glucose (Anhydrous, 20 g.) enhances the ability of the large intestine to absorb fluids. Includes instructions Weight: 1.1oz Manufactured in Kansas City, MO, USA Dissolve in 1 liter of drinking water. 1 Packet = $1.50 25 Packets = $30]]>1https://s.turbifycdn.com/aah/optacticalgear/ors-oral-rehydration-salts-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/ors-oral-rehydration-salts-44.jpgORShttps://s.turbifycdn.com/aah/optacticalgear/oss-agent-yugoslavia-ww2-49.jpgcustom-itemoptacticalgear-pagegearloadoutsOSS, WWII, Yugoslavia1Weapon
Ammo
Sensitive items
Map
Flashlight
Raincoat
Sleeping Bag
Extra socks 1 pair
First aid kit, eventually aspirin and iodine
Toothbrush
Soap
Razor
Emergency rations Reference: Beacons in the Night, Franklin Lindsay, 1993 Stanford University Press, Stanford, CA]]>
1https://s.turbifycdn.com/aah/optacticalgear/oss-agent-yugoslavia-ww2-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/oss-agent-yugoslavia-ww2-48.jpg
https://s.turbifycdn.com/aah/optacticalgear/ot-defense-als-nub-mod-for-safariland-als-holsters-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-als-nub-mod-for-safariland-als-holsters-52.jpgcustom-itemoptacticalgear-pagesahoandacXXOTD26.99OT Defense ALS NUB MOD for Safariland ALS HolstersOT Defense111NOTE: This model is ONLY for ALS Level 1 retention 6000 and 7000 series holsters. Also fits 6000 series RDS holsters such as the 6354DO and 6390RDS.
Your ALS lever must be the standard height version as shown in the inset photo. If you have a longer ALS lever it will not be compatible. This model will NOT fit 1911/2011/Staccato and other large thumb safety pistol holsters. It will NOT fit SLS or Level 3 Retention models. Made in the U.S.A., this aluminum product is blasted and finished with mil-spec anodizing. Faster: The reversed angle matches up with the pad of your thumb sooner than the factory button. You will find the gun in your hand just by grabbing it. Weak hand drawing becomes faster as well. More Reliable: The wider release button means you have even less potential to miss the activation, especially on thigh rigs or mounting systems that push the holster away from your body. If you have ever found yourself pulling up on the gun before hitting the release you've noticed that gun is difficult to almost impossible to get out. The additional leverage of the Nub Mod fixes this stress induced or poor training problem if it ever arises due to the increased surface area for the thumb to engage. Simple Install: Simply press the larger nub piece over the factory button from the inside of the holster. Align the smaller narrow piece with the top of the larger one. Insert screw and tighten with supplied allen wrench. You may add Loc Tite or finger nail polish to the threads if desired. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/ot-defense-als-nub-mod-for-safariland-als-holsters-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-als-nub-mod-for-safariland-als-holsters-65.jpgOT Defense
https://s.turbifycdn.com/aah/optacticalgear/ot-defense-sls-nub-mod-for-safariland-holsters-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-sls-nub-mod-for-safariland-holsters-39.jpgcustom-itemoptacticalgear-pagesahoandacXXOTDSLS29.99OT Defense SLS NUB MOD for Safariland Duty HolstersOT Defense111NOTE: Your ALS lever must be the standard height version as shown in the inset photo. If you have a longer ALS lever it will not be compatible. The SLS NUB MOD is needed for users running Level III Safariland Holsters with the ALS lever and the SLS hood. It also works with the ALS only (Level I) holsters for those with a larger waist girth to allow a smoother contact with the body over the ALS Nub Mod. Upon engaging the SLS hood downward with the thumb, the users thumb cannot help but land on the NUB MOD, releasing the weapon into the drawstroke. Starting in 2020 Safariland has started releasing some new ALS levers on the 7TS holsters. If your lever has 3 planes on the outside, YOU WILL NEED TO FILE THE LEVER FLAT as shown in the image above to make the Nub Mod fit. 7TS RDS holsters may require a different version of the Nub Mod to work. Slightly grooved to keep the thumb in contact with the lever, blasted and hard anodized black for a long lasting finish. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/ot-defense-sls-nub-mod-for-safariland-holsters-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-sls-nub-mod-for-safariland-holsters-49.jpgOT Defensehttps://s.turbifycdn.com/aah/optacticalgear/otis-223-cal-5-56mm-9mm-defender-series-cleaning-kit-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-223-cal-5-56mm-9mm-defender-series-cleaning-kit-17.jpgcustom-itemoptacticalgear-pageotweclkiXXFG-901-556-994.99Otis .223 cal / 5.56mm / 9mm Defender Series Cleaning KitOtis Technology111• .223 cal/5.56mm and 9mm Ripcords® for quick, one-pass cleaning
• 100% cotton 2" and 3" patches (10 each) and small & large slotted tips
• .223 cal/5.56mm and 9mm bronze bore brushes with size marked on brush stem
• 8" and 30" aircraft grade Memory-Flex® cables for proper Breech-to-Muzzle® cleaning
• Blue Nylon All Purpose Brush removes fresh carbon or powder residue but won't scratch your firearm finish
• .223 cal/5.56mm chamber brush for more precise chamber cleaning
• 8-32 thread solid rod set
• Also includes 0.5 fl.oz. of Shooter's Choice FP-10 Lubricant Elite® CLP and instruction manual
• All items packed neatly in a 10"x4"x2" soft pack case
• No Nonsense Warranty
• Made in the USA ]]>
1https://s.turbifycdn.com/aah/optacticalgear/otis-223-cal-5-56mm-9mm-defender-series-cleaning-kit-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-223-cal-5-56mm-9mm-defender-series-cleaning-kit-30.jpgOtis Technology
https://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-deluxe-kit-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-deluxe-kit-14.jpgcustom-itemoptacticalgear-pageotweclkiXXFG-RCD24.99Otis Ripcord Deluxe Kit for Rifle / PistolOtis Technology111• Offers complete cleaning for field/on-the-go use
• Includes Ripcord® plus caliber/gauge specific bore brush & cotton bore mop
• Shooter’s Choice FP-10 Lubricant Elite® CLP (0.5 oz) dropper tip bottle for an all-in-one cleaning, lubricating and protecting formula
• Short AP brush locks into the notch of the T-handle for better grip
• Microfiber gun cloth works great to wipe fingerprints, fouling and extra solvent from the exterior of your firearm
• Available in all calibers Ripcord® is sold
• Made in the USA
.22 / 5.56 cleans: .22 Rimfire/.22LR/ 22 Long, .22 Short,.22 Magnum. 220/.22-250 and more
9mm cleans: .38 cal /9mm, 35 Caliber, .350 Legend .357 cal
.264 / 6.5mm cleans: .260 cal/.264 cal/6.5mm
]]>
1https://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-deluxe-kit-22.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-deluxe-kit-23.jpgOtis Technology
https://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-for-rifle-pistol-12.jpgcustom-itemoptacticalgear-pageotweclkiXXFG-RC15.99Otis Ripcord for Rifle / Pistol Otis Technology111• Length: 36"
• 10 inches of aggressive cleaning surface
• Caliber specific molded rubberized core for 360 degree cleaning
• Heat resistant up to 700 degrees F
• Nomex® fibers act as both a brush to loosen and a patch to capture fouling particles
• Easy-feed design makes for quicker cleaning from Breech-to-Muzzle®
• Equipped with 8-32 threaded ends to fit all Otis cleaning components
.22 / 5.56 cleans: .22 Rimfire/.22LR/ 22 Long, .22 Short,.22 Magnum. 220/.22-250 and more
9mm cleans: .38 cal /9mm, 35 Caliber, .350 Legend .357 cal
.264 / 6.5mm cleans: .260 cal/.264 cal/6.5mm
]]>
1https://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-for-rifle-pistol-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-for-rifle-pistol-21.jpgOtis Technology
https://s.turbifycdn.com/aah/optacticalgear/otis-sectional-rod-cleaning-kit-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-sectional-rod-cleaning-kit-17.jpgcustom-itemoptacticalgear-pageotweclkiXXFG-SRS30.99Otis Sectional Rod Cleaning KitOtis Technology111• Solid brass rod section with female 8/32 threaded end and swivel handle for easy cleaning
• Bronze phosphor bore brush
• Cotton bore mop
• Brass component adaptor
• 100 count 1”x1” cleaning patches for the .22 / 5.56 and 9mm options; 20 count 2.5"x2.5" cleaning patches for the .30 Cal option
• Nylon All-Purpose cleaning brush
• Brass pierce point jag
• 0.5 fl. oz. bottle of FP-10 Lubricant Elite® CLP
• Precision machined and proudly made in the USA
.22 / 5.56 cleans: .22, .22 Rimfire, .22LR
.30 Cal cleans .30,.30-06,.30-30,.303,.308 caliber,300 Win Mag,.32 cal, 7.62mm & 8mm rifles
9mm cleans .38 cal/9mm/.357 pistols
]]>
1https://s.turbifycdn.com/aah/optacticalgear/otis-sectional-rod-cleaning-kit-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-sectional-rod-cleaning-kit-30.jpgOtis Technology
https://s.turbifycdn.com/aah/optacticalgear/otto-noizebarrier-micro-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/otto-noizebarrier-micro-45.jpgcustom-itemoptacticalgear-pagehepr141V4-11029452.35439.99Otto NoizeBarrier MicroOtto Communications111Features
- Up to 40 dB of impulse noise protection
- Up to 15 dB adaptive noise attenuation
- Hearing enhancement mode – amplifies soft sounds up to 5X
- Natural hearing for safe sounds
- Accu-Technology® high-definition sound quality
- One-button touch pad, 2-mode operation
- Rechargeable with up to 16 hours of continuous use
- Earpiece and case IP67 water resistant
- Charging status LCD panel
- 1-year warranty Specs
- NRR: 28 dB(Foam Tips); 23 dB (3-Flange Tips)
- Frequency Response: 40Hz - 16kHz
- Transducers: Balanced armature receivers (speakers), Wide bandwidth, low-noise MEMS microphones
- Battery Performance:
Earplugs: Up to 16 hours
Charge Station: 20 earplug charge cycles This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/otto-noizebarrier-micro-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/otto-noizebarrier-micro-58.jpgOtto Communications
https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-allies-microgravity-jacket-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-allies-microgravity-jacket-56.jpgcustom-itemoptacticalgear-pageinoulal761300211300259.95Outdoor Research Allies Microgravity JacketOutdoor Research111Fabric: AscentShell™ 3L, 100% nylon 70D plainweave with 100% polyester 30D knit backer Fabric Performance:
•Waterproof
•Windproof
•Breathable
•Air Permeable
•Electrospun Membrane
•Movement-Mirroring Stretch (solids only) Design Features:
•Helmet Compatible Halo-Hood with Hood Lock™
•YKK AquaGuard™ Zippers
•Internal Front Stormflap
•Fully seam sealed
•Elastic Drawcord Hem
•Zip Chest and Hand
•Pockets
•Left Hand Pocket Doubles As Stuff Sack
•Carabiner Loop and Key Clip
•Dynamic Reach™ Underarm Panels
•Torsoflow side zippers
•Hook / Loop Cuff Closure]]>
1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-allies-microgravity-jacket-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-allies-microgravity-jacket-69.jpgOutdoor Research
https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ferrosi-hoody-coyote-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ferrosi-hoody-coyote-66.jpgcustom-itemoptacticalgear-pagesoftshells6155531OR149124.99Outdoor Research Ferrosi HoodyOutdoor Research111sizechart11Features:
• Water Resistant
• Wind Resistant
• Breathable
• Durable
• Quick Drying
• Lightweight
• Movement-Mirroring Stretch
• Adjustable Hood Fits over Climbing Helmet
• Single-Separating Front Zipper
• Zippered Napoleon Pocket
• Two Zippered Hand Pockets
• Drawcord Hem Details:
• Fit: Standard Fit
• Fabric: 86% nylon, 14% spandex 90D stretch woven ripstop body and hood // Cordura®, 91% nylon, 9% spandex 120D stretch woven shoulders and lower sleeves
• Avg. Weight (oz./g): 13.9oz Backed by Outdoor Research's Infinite Guarantee lifetime warranty. SIZING: See link to Size Chart Below]]>
1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ferrosi-hoody-coyote-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ferrosi-hoody-coyote-76.jpgOutdoor Research
https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-foray-jacket-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-foray-jacket-coyote-35.jpgcustom-itemoptacticalgear-pageinoulal76155011OR225199.99Outdoor Research Foray JacketOutdoor Research111sizechart6Features
• Waterproof
• Breathable
• Windproof
• Lightweight
• Fully Seam-Taped
• Fully Adjustable Hood
• YKK® AquaGuard® Double-Separating Center Front Zipper, allows for unzipping from top or bottom end, perfect for conceal carry use
• Internal Front Stormflap
• Double-Sliding TorsoFlo™ Hem-To-Bicep Zippers
• Zippered Chest Pocket
• Two Zippered Hand Pockets
• Left-hand Pocket Doubles as Stuff Sack
• Hook/Loop Cuff Closures
• Carabiner Loop
• Key Clip Details
• Fit: Standard Fit
• Fabric: GORE-TEX® with Paclite® product technology 2L, 100% polyester 50D plain weave
• Avg. Weight (oz./g): 15.8 oz (Large size) Backed by Outdoor Research's Infinite Guarantee lifetime warranty. Colors:
-Coyote Brown
-Black SIZING: See link to Size Chart Below]]>
1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-foray-jacket-coyote-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-foray-jacket-coyote-42.jpgOutdoor Research
https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-helium-ii-jacket-coyote-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-helium-ii-jacket-coyote-55.jpgcustom-itemoptacticalgear-pageinoulal76155230OR170144.99Outdoor Research Helium JacketOutdoor Research111sizechart10Features:
• Waterproof
• Breathable
• Lightweight
• Fully Seam-Taped
• YKK® AquaGuard® Center Front Zipper
• Adjustable Hood
• Single-Separating Front Zipper
• Zippered Napoleon Pocket
• Chest Pocket Doubles as Stuff Sack
• Carabiner Loop
• Elastic Cuffs
• Elastic Drawcord Hem Details:
• Product #: 275386
• Fit: Standard
• Fabric: bluesign® approved Pertex® Shield Diamond Fuse 2.5L and bluesign® approved 100% Nylon, 30D Ripstop
• Avg. Weight (oz./g): 6.2 oz Backed by Outdoor Research's Infinite Guarantee lifetime warranty. SIZING: See link to Size Chart Below]]>
1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-helium-ii-jacket-coyote-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-helium-ii-jacket-coyote-65.jpgOutdoor Research
https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ironsight-gloves-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ironsight-gloves-65.jpgitem.optacticalgear-pagegloves61702904537.99Outdoor Research Ironsight Sensor GlovesOutdoor Research111Ironsight Gloves are now touch-screen compatible! Legendary within the tactical community for their amazing tactility and grip, the Ironsight Gloves are quick drying, highly breathable gloves made with dexterous and supple synthetic leather for solid grip yet are extremely sensitive during delicate tasks. Slip-free grip pads on the palms and fingers and seamless Precision Grip™ construction provide superior tactility. Shell:
-Breathable, stretch nylon
-Synthetic leather with flex cutouts for abrasion and impact protection while maintaining dexterity Palm:
-Touch-screen compatible on the index finger and thumb
-Highly breathable synthetic palm
-Hybrid leather and fabric finger sidewalls offer superior flex at joints and reinforcement at high abrasion points
-Silicone pads provide solid grip of weapons and tools Details:
-Injection molding on back of hand for impact protection
-Precision grip for seamless, next-to-skin tactility
-Pull-on loop doubles as attachment for securing gloves Backed by Outdoor Research's Infinite Guarantee lifetime warranty.]]>
1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ironsight-gloves-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ironsight-gloves-75.jpgOutdoor Research
https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-wind-pro-hat-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-wind-pro-hat-72.jpgitem.optacticalgear-pagewatchcaps61838054436Outdoor Research Wind Pro Hat - USAOutdoor Research111Staff Favorite. This is a very warm yet slim beanie that has excellent water resistance in light rain and snow. + Polartec® Wind Pro® with Hard Face™ finish and soft fleece interior is highly wind and abrasion resistant. + Three-dimensional design for head-conforming fit + Double layer of fabric on ear band area for added warmth Backed by Outdoor Research's Infinite Guarantee lifetime warranty. Sizing: Hat will break in and stretch a slightly with use.
• Small/Medium: Head Circumference = 21.5 - 22.9 inches
• Large/XLarge: Head Circumference = 23 - 24 inches Made in the USA, Berry Compliant.]]>
1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-wind-pro-hat-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-wind-pro-hat-82.jpgOutdoor Research
https://s.turbifycdn.com/aah/optacticalgear/outerwear-78.jpgcustom-itemoptacticalgear-pageunclOuterwear1javeswsoftshellsinoulal7Clothing Layering System: Level 1- Light Weight Base Layer
Level 2- Mid-Weight Base Layer
Level 3- Heavy Weight Base Layer (fleece)
Level 4- Wind Jackets (Ultra-Thin Barriers)
Level 5- Weather Resistant Outer Layer (Soft Shell)
Level 6- Water Repellant Outer Layer (Hard Shell)
Level 7- High Loft Outer Layer Level 7 can often be worn right over individual armor or load bearing equipment, some versions are also designed to be used in lieu of a sleeping system, so the wearer can don them, get warm, and sleep in them in the field. This reduces gear taken to the field and makes fighting from a sleeping system much easier. The layering system of clothing is designed around the concept that fabrics pushing moisture away from the body will keep you warm while in motion, once you go static you can don waterproof or warm layers to insulate yourself. While in motion, you will not be 100% protected from precipitation, however, at the same time you will not have water retention in your fabrics that will keep you cold. We hope this helps you in your selection for cold weather outerwear.]]>
1https://s.turbifycdn.com/aah/optacticalgear/outerwear-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/outerwear-77.jpg
https://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-falx-trigger-for-glock-9.jpgcustom-itemoptacticalgear-pagestweliandmo15592C135121.5Overwatch Precision FALX Trigger for Glock (R)Overwatch Precision111• Reduced Pre-Travel
• Tactile Reset
• Machined out of billet 7075-T6 aluminum alloy
• Type III hard coat anodized to MIL-A-8625 standard, so you can get rough with it. (See above) Compatible Glock Models:
• Glock Gen 2-4 G17/19 22/23 24 26 27 31 33 34/35
• Glock Gen5 G17/19 19X 22/23 24 26 27 31 33 34/35 45 What is NP3 Coating?
NP3 coating is a space age material used for coating the external and internal parts of firearms. A proprietary blend of submicron particles makes for an excellent surface treatment on all metal surfaces including stainless steel and hard chrome. NP3 coating offers high lubricity, corrosion resistance, micro hardness, and is self-lubricating. This is achieved via a process which binds the NP3 to the metal surfaces at the molecular level. The color options reflect the color of the trigger shoe. The trigger safety for all models is black. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-falx-trigger-for-glock-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-falx-trigger-for-glock-16.jpgOverwatch Precision
https://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-glock-magwell-r-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-glock-magwell-r-56.jpgcustom-itemoptacticalgear-pagestweliandmo1552210X89.9981.9Overwatch Precision Glock Magwell (R)Overwatch Precision111Fits Respectively:
• Gen 4- G19, G23, G32 (with or without Backstrap)
• Gen 5- G19, G23, G44 without Cutout, No Backstrap
• Gen 5- G17, G34, G45 without Cutout, No Backstrap Features:
• Ultra strong and lightweight 7075-T6 Aluminum construction
• Single piece design limits potential failure points
• Aggressive funnel for rapid magazine insertion
• Includes screw and Allen wrench for assembly
• Color: black Made in the USA, Lifetime Warranty. WARNING: This product can expose you to chemicals including lead, which is known in the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warningsca.gov]]>
1https://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-glock-magwell-r-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-glock-magwell-r-70.jpgOverwatch Precision
https://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-polydat-trigger-for-glock-np3-coated-r-11.jpgcustom-itemoptacticalgear-pagestweliandmo155262269.9962.99Overwatch Precision PolyDAT Trigger for Glock - NP3 Coated (R)Overwatch Precision111• Reduced Pre-Travel
• Tactile Reset
• Machined out of billet 7075-T6 aluminum alloy
• Type III hard coat anodized to MIL-A-8625 standard, so you can get rough with it. What is NP3 Coating?
NP3 coating is a space age material used for coating the external and internal parts of firearms. A proprietary blend of submicron particles makes for an excellent surface treatment on all metal surfaces including stainless steel and hard chrome. NP3 coating offers high lubricity, corrosion resistance, micro hardness, and is self-lubricating. This is achieved via a process which binds the NP3 to the metal surfaces at the molecular level. Color: Black Shoe with Black Safety Compatible Glock Models:
• Glock Gen 2-4 G17/19 22/23 24 26 27 31 33 34/35
• Glock Gen5 G17/19 19X 22/23 24 26 27 31 33 34/35 45 This trigger will NOT work in the G42, G43, or Large Frame Glocks. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-polydat-trigger-for-glock-np3-coated-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-polydat-trigger-for-glock-np3-coated-r-21.jpgOverwatch Precision
https://s.turbifycdn.com/aah/optacticalgear/pact-club-timer-iii-available-soon-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/pact-club-timer-iii-available-soon-33.jpgcustom-itemoptacticalgear-pageshottimers51CT3129.95Pact Club Timer IIIPACT Inc Shooting Products111A Display Big Enough You Can Read Easily The purpose built display on the PACT Club Timer 3 tells you everything you need to know about your shot string at a glance. Shot Number and Total Time are highlighted with FIRST SHOT and last SPLIT displayed with no button pushing required. As you press the REVIEW button, each shot Total Time and split are displayed. PAR time (if any) is also displayed along with letting you know if the timer is set to a delayed or instant GO. Club Timer III Ultra Loud Buzzer Shooting Timer A Buzzer You Can Hear OK…OK We hear you, you wanted a louder buzzer. You got it. Way back, 1982 or so, there were some really great buzzers. Unfortunately the federal specs changed for smoke alarm\’s, and those great old buzzers went away. The buzzer used in almost all the shooting timers really are the loudest commercially available low frequency buzzers on the market – but they just aren\’t loud enough. We went on a quest to come up with a better buzzer, and after testing dozens of them over the course of a year we were not impressed – so we decided to make our own. You will be pleased with the results. Club Timer III Shooting Timer by PACT Form Follows Function The Club Timer III is designed to fit the hand. Both the buzzer and microphone are located to the side of the timer, away from your hand, to minimize the possibility of blocking them. All the control buttons are recessed below the top of the Club Timer III so that there is no chance of accidentally pressing them as you run with the timer. Yet, when you want to press them, you\’ll find they fall naturally under your fingers – no more hunting for the GO button. And speaking of buttons, our custom sealed conductive rubber keypad is water proof and there are no mechanical switches to fail at the worst possible time. Weight: 1 lb. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/pact-club-timer-iii-available-soon-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/pact-club-timer-iii-available-soon-43.jpgPACT Inc Shooting Productshttps://s.turbifycdn.com/aah/optacticalgear/patches-32.jpgitem.optacticalgear-pageindex-Patches / Morale1stickersflagpatchesmedicalpatchespvcpatchesgrpalacutpahodepaandstwagl1ininirr1https://s.turbifycdn.com/aah/optacticalgear/patches-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/patches-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-hand-warmer-aor1-exclusive-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-hand-warmer-aor1-exclusive-67.jpgcustom-itemoptacticalgear-pageglovesXXWMAOR1129.99116.99Perroz Designs Hand Warmer - AOR1 ExclusivePerroz Designs111Exclusively at O P Tactical, custom Hand Warmers in AOR1 directly from Perroz Designs! Keep your hands warm and dry. Lightweight, compressible and wind resistant - a must have for anyone outdoors. Constructed with AOR1 pattern 330D Cordura and insulated with high loft Polartec® polar fleece that is soft and retains heat. Worn via adjustable waist strap. Currently all Hand Warmers use BLACK color high loft Polartec polar fleece. Quality guaranteed. Made in Canada. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/perroz-designs-hand-warmer-aor1-exclusive-79.jpghttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-hand-warmer-aor1-exclusive-80.jpgPerroz Designshttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-triple-5-56-magazine-placard-aor1-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-triple-5-56-magazine-placard-aor1-45.jpgcustom-itemoptacticalgear-pagemaveclqacoXXTMPAOR1149129Perroz Designs Triple 5.56 Magazine Placard - AOR1Perroz Designs111litopedelpaoExclusively at O P Tactical, custom Triple 5.56 Magazine Placard in AOR1 directly from Perroz Designs! Secure and fast attachment via hooked Velcro® back and buckles. Clips directly into ITW QASM female buckles - height adjustable utilizing Velcro® One-Wrap. Magazines individually retained by 1/8th inch bungee cord and synthetic rubber S&S Precision® pull tabs which provide a non-slip ergonomic grip. Integrates seamlessly with Haley Strategic MP2 Magazine Pouch Inserts (sold separately), which lock into place by an internal nylon webbing strip. AOR1 Material: 330D Cordura. Quality guaranteed. Made in Canada. Triple Magazine Placard Only. Mags sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/perroz-designs-triple-5-56-magazine-placard-aor1-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-triple-5-56-magazine-placard-aor1-58.jpgPerroz Designshttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-iwb-universal-holster-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-iwb-universal-holster-50.jpgcustom-itemoptacticalgear-pagephhoandpr101PHLFLOOD124.99112.99PHLster Floodlight (IWB) - Universal HolsterPHLster111The Floodlight confirmed fit list is as follows:
- 1911 and 2011 pistols
- Glock 19/17/34 (and .40 and .357 variants)
- Glock 20/21
- S&W M&P and SD series pistols
- HK VP9, VP40, and P30
- FN 509 and FNS
- CZ P10, P07, P09, 75 SP01
- Sig P226, 229, 220, and P320
- Walther PPQ (any gen)
- Polymer 80
- Beretta 92, M9, PX4, APX
- XD and XDM DOES NOT FIT STEYR PISTOLS.

- Weight 0.34 lbs
- Dimensions 9 × 6 × 3.5 in No Hassle Warranty:
Phlster offers a no-hassle warranty policy. It doesn’t matter if you’re the original owner or if you acquired your gear second hand, if it’s broken, they’ll repair or replace the item. ]]>1https://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-iwb-universal-holster-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-iwb-universal-holster-64.jpgPHLsterhttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-owb-universal-holster-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-owb-universal-holster-51.jpgcustom-itemoptacticalgear-pagephhoandpr101PHLFLOOD2119112.99PHLster Floodlight (OWB) - Universal HolsterPHLster111Compatible with Blade Tech, G-Code, and Safariland attachments The OWB Floodlight is ambidextrous and adjustable to fit just about any pistol capable of mounting a Surefire X300 or Streamlight TLR-1. The OWB Floodlight includes a Blade Tech Tek Lok belt attachment and three adjustment hardware kits to achieve the best fit on your pistol. The hardware kits are color coded, to keep the appropriate screw lengths with their respective spacers. Please be sure to refer to the Instructions page for details on adjusting your holster. Like all Phlster holsters, the OWB Floodlight accommodates muzzle devices, suppressor height sights, and slide-mounted optics. The Floodlight confirmed fit list is as follows:
- 1911 and 2011 pistols
- Glock 19/17/34 (and .40 and .357 variants)
- Glock 20/21
- S&W M&P and SD series pistols
- HK VP9, VP40, and P30
- FN 509 and FNS
- CZ P10, P07, P09, 75 SP01
- Sig P226, 229, 220, and P320
- Walther PPQ (any gen)
- Polymer 80
- Beretta 92, M9, PX4, APX
- XD and XDM DOES NOT FIT STEYR PISTOLS.

- Weight 0.34 lbs
- Dimensions 9 × 6 × 3.5 in No Hassle Warranty:
Phlster offers a no-hassle warranty policy. It doesn’t matter if you’re the original owner or if you acquired your gear second hand, if it’s broken, they’ll repair or replace the item. ]]>1https://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-owb-universal-holster-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-owb-universal-holster-64.jpgPHLsterhttps://s.turbifycdn.com/aah/optacticalgear/phlster-holsters-and-products-36.jpgcustom-itemoptacticalgear-pageholstersPhlster Holsters and Products1phfliunhophflounhophprosehogl11https://s.turbifycdn.com/aah/optacticalgear/phlster-holsters-and-products-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-holsters-and-products-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-pro-series-holster-glock-17-19-26-34-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-pro-series-holster-glock-17-19-26-34-36.jpgcustom-itemoptacticalgear-pagephhoandpr101PHLPRO0379.9969.99PHLster Pro Series Glock HolsterPHLster111Types:
• Standard comes with a pair of adjustable IWB loops and an adjustable ModWing to reduce printing (Main picture)
• TuckStrut (see inset picture)
• Grip Hooks (Pair) (see inset picture)
• Discreet Carry Concepts Monoblock Clip (see inset picture) The Pro Series is compatible with optics, suppressor sights, threaded barrels, and Gen5 Glocks. Compatible Glock Models:
• 9mm/40 Glock (26-34 lengths) No Hassle Warranty:
Phlster offers a no-hassle warranty policy. It doesn’t matter if you’re the original owner or if you acquired your gear second hand, if it’s broken, they’ll repair or replace the item. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/phlster-pro-series-holster-glock-17-19-26-34-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-pro-series-holster-glock-17-19-26-34-46.jpgPHLster
https://s.turbifycdn.com/aah/optacticalgear/picatinny-rail-and-geiselle-smr-416-accessories-36.jpgcustom-itemoptacticalgear-pageweacPicatinny Rail, and Geiselle SMR 416 Accessories1ardehastpirtrnocopiragrmamoervgraveardeingesmr4ardefistpirmaxtmmoracomaxthastkit1mabifor19pirvitalplprslmmarsraslat1https://s.turbifycdn.com/aah/optacticalgear/picatinny-rail-and-geiselle-smr-416-accessories-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/picatinny-rail-and-geiselle-smr-416-accessories-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-delta-utility-glove-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-delta-utility-glove-55.jpgcustom-itemoptacticalgear-pagegloves7375429.95PIG Full Dexterity Tactical (FDT) - Delta Utility GlovePIG (FDT)111sichforpigfd1-Full touchscreen compatible forefinger and thumb
-Fold-over finger construction to eliminate fingertip discomfort
-Single-layer palm for tactile sensitivity
-Bar-tacked paracord pull loop
-Silicon printed grip on the palm
-Elastic wrist for quick don and doff sequence Designed as a "Utility" glove, if you use your tactical shooting gloves both on and off the range, the PIG FDT Delta Utility Glove is the best solution on the market today for ease of use, durability and the tactile-dexterity you need to make your shot count! OPT will not take returns on this item if it has been used or has hangtags removed. Thoroughly inspect your item prior to removal of the hangtag. No shipping to the UK, Denmark, Finland, Sweden, Hong Kong, and South Korea See link below for sizing chart.]]>
1https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-delta-utility-glove-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-delta-utility-glove-69.jpgPIG (FDT)
https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-fr-glove-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-fr-glove-44.jpgcustom-itemoptacticalgear-pagegloves73PIG72664.95PIG Full Dexterity Tactical (FDT) Alpha FR GlovePIG (FDT)111Features
- Touchscreen Compatible Leather thumb and forefinger
- Leather padded knuckles
- Flame resistant Nomex® material
- Isolated knife-edge padding
- Bar-tacked webbing wrist pull
- Low profile hook and loop wrist strap
- Tailored Fourschettes
- Sensitized Trigger Finger
- Single Layer Palm
- Short cuff with loop-maximum comfort and convenience There will be temporary color transfer from the conductive leather onto wearer's forefinger and thumb which will diminish with use and washing.]]>
1https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-fr-glove-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-fr-glove-58.jpgPIG (FDT)
https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-gloves-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-gloves-44.jpgcustom-itemoptacticalgear-pagegloves73PIGFDT44.95PIG Full Dexterity Tactical (FDT) Alpha GlovesPIG (FDT)111sichforpigfdNo shipping to the UK, Denmark, Finland, Sweden, Hong Kong, and South Korea See link below for sizing chart.]]>1https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-gloves-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-gloves-58.jpgPIG (FDT)https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-cold-weather-glove-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-cold-weather-glove-54.jpgcustom-itemoptacticalgear-pagegloves73FDT-CWG59.95PIG Full Dexterity Tactical (FDT) Cold Weather GlovePIG (FDT)111 The ALL-NEW PIG FDT Cold Weather Glove (CWG) finally brings PIG’s unsurpassed dexterity to a wind-resistant insulated glove. Maintaining the PIG-FDT line-up’s short cuff design, the ALL-NEW CWG includes features such as Touch Screen Compatibility (all 5 digits), grippy Silicon-print palm and a Terry cloth nose-wipe. When the temperatures drop, transition from your current FDT Gloves to the ALL-NEW WARMNESS that is the PIG FDT Cold Weather Glove!1https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-cold-weather-glove-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-cold-weather-glove-68.jpgPIG (FDT)https://s.turbifycdn.com/aah/optacticalgear/pistol-accessories-83.jpgitem.optacticalgear-pageweacPistol Accessories 1ovprfatrforgovprpotrforgedshdeesdmakkmprrspgl19raweaframicozevz19dustslzevconisisetzevopmabag19zevopmabag192zevopmabathpzevprocogen5ovprglmarmaglenmawefo1racofrmargetarelaaiglmosacmop(R)=ITEMS WILL NOT BE SHIPPED OUT OF UNITED STATES1https://s.turbifycdn.com/aah/optacticalgear/pistol-accessories-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/pistol-accessories-82.jpghttps://s.turbifycdn.com/aah/optacticalgear/pistol-magazine-pouches-54.jpgitem.optacticalgear-pageammopouchesPistol Magazine Pouches1shcodoelpidpfecodoelpies40ansipikyessipikymagpesdopikymagpesdopigapkyphsgen2pitahsgen2dopitahsgipistoltacohspitaltmopopitav2moanhspopitamoanhspomipitamohsdopitamohstrpitamohsgen2expitahsexpitaitwfapimoblfotesipimablfogetedopiblfogesipimafisppimaposp2fisppimapospespikyinatssipisuleatsdopisulepmsmwrmupo1https://s.turbifycdn.com/aah/optacticalgear/pistol-magazine-pouches-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/pistol-magazine-pouches-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-1-litre-flask-31.jpgcustom-itemoptacticalgear-pagenalgene1338298878.95Platatac 1 Litre FlaskPlatatac111Features:
- 51 grams approx per flask
- Robust construction
- Measurements on the side in 100ml increments
- 2 flasks will fit into a issued SAW pouch
- BPA free
- Freezer safe
- Dish Washer Safe
- Food safe
- Large mouth screw top for ease of filling
- Resistant to Odors
- Olive
- Made in Australia ]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-1-litre-flask-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-1-litre-flask-41.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-accessories-small-flask-152-w-front-pouch-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-accessories-small-flask-152-w-front-pouch-45.jpgcustom-itemoptacticalgear-pagewabopo13383279349.95Platatac Accessories Small Flask 152 W/Front PouchPlatatac111Features:
- Weighs 180 grams
- Front zippered pouch for additional storage
- PALS on sides to attach additional pouches
- Internal radio pouch with Hook and loop/shock cord retention
- Silent Para Cord Zipper pulls for ease of use with gloved hands
- Button Hole at the base of the pouch for drainage
- Reversed gauge 10 YKK zippers to keep out dust and moisture
- Multicam® 500D Cordura® tactical nylon Dimensions: 20cm (H) x 90cm (W) x 80cm (D) Bottle not included]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-accessories-small-flask-152-w-front-pouch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-accessories-small-flask-152-w-front-pouch-58.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-billy-patrol-pouch-v2-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-billy-patrol-pouch-v2-47.jpgcustom-itemoptacticalgear-pageoptopmapo133838XXX149.9999.99Platatac Billy Patrol Pouch V2Platatac111Billy Pouch Includes the following inserts:
• Double M4 style magazine insert
• Single M4 style magazine insert
• Double 9mm pistol magazine insert
• Pistol holster insert
• Zippered admin insert The Billy Patrol V2 is fabricated in tough 500d Nylon with ultralight laser-cut ULTRAcomp® panels on the sides. ULTRAcomp® is a high-performance laminate that far exceeds the strength and durability of traditional nylon fabrics. These side panels feature 2 rows of Molle for the mounting of any additional pouches the user may require, the back of the pouch also utilises ULTRAcomp® to shed weight and increase strength. Features:
• Fits up to 200 rounds of 5.56mm link or 6x m4-style magazines in the main compartment
• Internal hard plate face protects link integrity
• Fastex® clip closure
• Drainage grommets
• 2 column x 5 rows PALS field on sides for additional pouches made from laser-cut Ultracomp fabric
• MOLLE attachment system made Lightweight laser-cut Ultracomp fabric
• D Rings on top of the pouch to attach a PLATATAC Jungle Harness, or similar harness system. Weight & Dimensions:
• Weight: 250g
• Dimensions: 150 (w) x 200 (h) x 90 (d) mm
• Requires Four PALS Columns Materials:
• Outer Fabric: 500d Cordura
• Blue Force Gear Ultracomp Laminate
• Fastex Clips
• Elastic: Mil-W-5664
• Hook and Loop: Mil-Spec AA-A 55126 ]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-billy-patrol-pouch-v2-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-billy-patrol-pouch-v2-61.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-mk-3-with-straps-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-mk-3-with-straps-62.jpgcustom-itemoptacticalgear-pageassaultpacks133833076249209.99Platatac Bullock Echo Pack MK 3 with StrapsPlatatac111- Padded shoulder straps with quick detach option
- Padded back for added comfort and protection of contents
- 6 x 4 MOLLE field on the main compartment for attachment of extra pouches
- Fixed adjustable cargo carrier to hold ballistic helmet, cold/wet weather jacket or additional gear
- External zippered pocket on the front of cargo carrier
- Internal bladder sleeve that holds up to a 3ltr bladder i.e. Platatac Insertion bladder (Include link)
- 2 x Internal mesh cargo pockets on front
- Removable internal zippered mesh pocket for small items
- 2 x side pockets for storing smaller additional items.
- 150x75mm loop field for IFF, ANFs or nametape
- 4 x 3 MOLLE field on cargo cradle for extra pouches
- 1” web tape handle for carriage or hanging in vehicles
- 2 x hydration tube/radio antenna routing ports
- Drainage eyelets on main compartment, side pockets and front pocket
- Double stitched and bar tacked on all major seams
- Made from 500 denier nylon Dimensions and weight;
- Main compartment 36cm (H) x 23.5cm (W) x 9.5cm (D)
- Side pockets: 19cm (H) x 9cm (W) x 5cm (D)
- Front zippered pouch: 25cm (at widest) x 6cm (D)
- Mesh cargo compartment: 20cm (H) x 23.5cm (W) x 14.5cm (D)
- Weight 1.02Kg COLOR PICTURED IS NOT COYOTE]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-mk-3-with-straps-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-mk-3-with-straps-74.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-v4-with-straps-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-v4-with-straps-12.jpgcustom-itemoptacticalgear-pageassaultpacks133840856269.99219.99Platatac Bullock Echo Pack V4 with StrapsPlatatac111• Padded shoulder straps with quick adjust/detach option
• Padded back for added comfort and protection of contents
• 6 x 4 PALS field on the main compartment for attachment of extra pouches
• Fixed adjustable/expandable cargo carrier to hold a ballistic helmet, cold/wet weather gear or additional MEIs
• External zippered pocket on the front of cargo carrier with internal cyalume loops
• Internal bladder sleeve that holds up to a 3ltr bladder e.g. Platatac Insertion bladder
• 2 x Internal zippered pockets
• Removable internal zippered pocket for small items
• 2 x Zippered side pockets sized to fit a Platatac 1L flask or 1L Nalgene
• 150 x 75mm loop field for IFF, ANFs or nametape
• 5 x 3 PALS field with Velcro loop on cargo cradle
• 1” web tape handle for carriage or hanging in vehicles
• Web tape daisy chain on each side
• Hydration tube/radio antenna routing ports
• Drainage eyelets on main compartment, side pockets and front pocket
• Double stitched and bar tacked on all major seams
• Made from 500 denier nylon Dimensions and weight
• Main compartment 38cm (H) x 23.5cm (W) x 9.5cm (D)
• Side pockets: 21.5cm (H) x 9cm (W) x 8cm (D)
• Front zippered pouch: 19.5cm (H) x 25cm (W) (at widest) x 6.5cm (D)
• Mesh cargo compartment: 20cm (H) x 23.5cm (W) x 17cm (D) (When fully expanded)
• Weight 1.02 Kg / 2.20 Lbs ]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-v4-with-straps-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-v4-with-straps-17.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-lw-h-harness-31.jpgcustom-itemoptacticalgear-pagechrigac338320577954.95Platatac Chicom LW H-HarnessPlatatac111- 55mm Folded 500D Cordura nylon to support heavy loads
- Folded construction with soft edges for optimized comfort
- 25mm elastic to attach PTTs or route hydration tube/antenna/comms cable
- Low profile, lightweight without affecting durability
- Adjustable 1 inch web tape straps
- Velcro loop at rear to attach individual ID markers
- All ITW Nexus Hardware ]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-lw-h-harness-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-lw-h-harness-40.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-y-harness-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-y-harness-46.jpgcustom-itemoptacticalgear-pagevests13382718X119.9589.95Platatac Chicom Y-HarnessPlatatac111• ITW-Nexus style 1-inch male-end buckles on the sides; female-end buckles on the front/chest portion to integrate with several chest rig manufacturers
• Full MOLLE backing for hydration/comms pouches
• Mesh design to enhance breathability
• Comms cable / hydration tube routing
• Reinforced drag handle
• Compatible with Chisel MK IV and Chicom Lightweight rig
• Rig height adjustable via ITW SR Split bar clips
• ITW nexus hardware
• Manufactured from water and abrasion resistant 500 Denier Nylon and mesh
• Weight: 10.5 oz ]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-y-harness-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-y-harness-60.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-echo-pack-straps-pair-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-echo-pack-straps-pair-44.jpgcustom-itemoptacticalgear-pageassaultpacks1338337364432.95Platatac Echo Pack Straps (Pair)Platatac111Features
Compatible with Bullock Echo and Echo Hydration Pack series
3D Airmesh backing for added comfort
Removable sternum strap (Only included with Multicam straps)
Quick release mechanism
Strap Keep-Tidy system ]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-echo-pack-straps-pair-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-echo-pack-straps-pair-58.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-gbh-r-hat-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-gbh-r-hat-55.jpgcustom-itemoptacticalgear-pagemilitaryhats13383198239.9534.95Platatac GBH-R HatPlatatac111- Lightweight and crushable to stow easily in a uniform pocket
- Medium height crown with a 4.5cm brim
- Self-fabric sweatband
- Internal hi-vis panel/pocket
- Internal mesh lining with heat dissipation vents
- 35x35mm square Velcro® brand loop on the crown for attaching IFF patches
- Self-fabric foliage loops
- Elastic shock cord adjustment
- Adjustable para cord neck strap
- Fours sizes available - 7", 7.25", 7.5" and 7.75"
*3 Color Desert is also referred to as "DCU," and 6 Color Desert is also referred to as "Chocolate Chip."* ]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-gbh-r-hat-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-gbh-r-hat-68.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-jaywick-shorts-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-jaywick-shorts-65.jpgcustom-itemoptacticalgear-pagecombatshirts133833704-C149.99104.99Platatac Jaywick ShortsPlatatac111See Sizing Info Below Before Ordering. 2 September 1943. Under the cover of darkness and disguised as a fishing vessel, the MV Krait snuck out of Exmouth in Australia’s North, bound for Singapore on a daring raid known as Operation JAYWICK. Operation JAYWICK was a joint UK Special Operations Executive and Royal Australian Navy mission, supported by the Allied Intelligence Bureau (AIB), through its Army support unit – Z Special Unit. AIB – including Z Special Unit – would later become the genesis for Australia’s first special forces units which have developed into what is now Special Operations Command. The PLATATAC Jaywick Shorts are a full featured, above the knee tactical short. Taking inspiration from our TAC DAX, we have simplified the design to create a slim profile. Made from tactical 50-50 Nyco Ripstop, the Jaywick shorts feature a reinforced seat, a range of pockets, and the same dynamic movement and comfort our TAC DAX are famous for. The Jaywick shorts are suitable for long-duration operations in all-round conditions and will keep you mission-ready and in the fight. Features:
• Dedicated knife pocket in hand pockets
• Zippered fly with Canadian button closure
• Rear pockets with Velcro closure
• Large thigh pockets with Canadian Button closure
• Open top pockets behind large pockets
• Dual-layer seat to reduce wear Sizing: Measurements shown are actual Waist measurement size, NOT generic Jeans Size. Please measure your waist before ordering.
• 30": Waist 30", Inseam 9.3"
• 32": Waist 32", Inseam 9.3"
• 34": Waist 34", Inseam 9.6"
• 36": Waist 36", Inseam 9.6"
• 38": Waist 38", Inseam 9.6"
• 40": Waist 40", Inseam 9.6"]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-jaywick-shorts-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-jaywick-shorts-79.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-kurtz-shirt-tigerstripe-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-kurtz-shirt-tigerstripe-69.jpgcustom-itemoptacticalgear-pageprun133837459-C229179.99Platatac Kurtz ShirtPlatatac111Designed to be close-fitting, yet a comfortable garment, with a long tail for easy tuck into pants. A full Zip and bar button front closure for redundancy, allowing you to use just the buttons, thereby maximising airflow. Mesh in the pockets to drain water and ventilation points in strategic areas, provide maximum comfort and performance. Features:
• Made with an accurate reproduction of a classic Tiger stripe pattern
• Two large angled top opening chest pockets with a mesh bottom and ITW slotted bar button and Velcro closure
• Two upper-arm zip and top access pockets allow for convenient access when wearing LCE or body armour
• Pen sleeve in bicep pocket zip placard and eye protection stowage loop in the top flap
• Bellowed compass pocket on the front placard will hold most in-service Silva prismatic compasses
• Velcro loop fields on sleeve pockets for ID & IFF patches
• Paracord lanyard points in all pockets to secure small items
• Underarm and upper back mesh vents keep airflow to a maximum when active or static
• Three-piece fold down collar with an extension for added sun protection
• YKK zip and bar button closure behind the front placard
• Three-button adjustable wrist cuff Materials:
• 50/50 NYCO (Nylon Cotton Mix) Rip-Stop]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-kurtz-shirt-tigerstripe-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-kurtz-shirt-tigerstripe-78.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-jw-chest-rig-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-jw-chest-rig-60.jpgcustom-itemoptacticalgear-pagevests133JWCR299Platatac Peacekeeper JW Chest RigPlatatac111Note from OPT: We reached out to Platatac and are now currently including the Chicom Y-Harness with the PK-JW, which we feel is a perfect match. These Platatac PK-JW Chest Rigs originally come with just two harness options - the standard CHICOM H Harness and the CHICOM low pro adjustable shoulder straps; there are now 3 included harness options. The PLATATAC Peacekeeper JW (Jungle Warfare) chest rig is a low profile, light weight general purpose chest rig designed for close country patrols, or hot weather/water operations which can be worn standalone, or in conjunction with over body armour systems. The PK-JW features dedicated pouches that hold just the right amount of essentials and features a front centre zip for easy doffing and donning. The dual centre mounted magazine pouches, one each side of the zip, will hold two M4 mags each, with an recently added magazine pouch for 2x M4 mags, and two vertically mounted frag grenade pouches beside the magazine pouches allow easy access to EO. At the extreme ends of the PKJW are two medium sized zippered accessory pouches with additional clip closure, these will hold a water bottle such as the Platatac 1L flask, 1L Nalgene, or a medium sized radio utilising the internal open-top mesh pouch with bungee retention to hold a 152 or similar sized radio when utilising the 19mm clip to close the pouch. On the sides of each GP pouch are TQ or Strobe pouches that will also hold other similar sized items. All Mag and EO pouches have velcro and 19mm clip closures for added security, and all pouches feature mesh areas in the bottom to provide rapid drainage. Against the body are two open-top mesh pouches which can hold flat items such as maps, GRGs or marker panels. Included with the PK-JW are two harness options, the standard CHICOM low pro adjustable shoulder straps and the CHICOM LW H-Harness which provides a lightweight general-purpose alternative to the low pro straps. Both harnesses are flat sewn, and are designed to remain as flat as possible for use with packs and other harness systems. Features
- Can carry up to six 30 Round AR/M4 style magazines
- 2 x Accessories/Water bottle/GP pouches with the ability to hold an ANPRC 152 radio at left and right of rig
- 2 x Frag Grenade Pouches
- Dedicated TQ and Strobe Light on GP pouches that will hold other like sized items.
- Mesh areas in all pouches to provide rapid drainage
- Comes standard with PLATATAC CHICOM Low Pro strap set, CHICOM LW H Harness and adjustable back strap Materials and weight
- 500 Denier Cordura nylon
- ITW Nexus hardware
- YKK Zips with heat shrink paracord pulls Compatible Items:
- Chicom LW H Harness
- Chicom Y Harness
- Chicom Back Panel Large
- Chicom Back Straps Note from OPT: We reached out to Platatac and are now currently including the Chicom Y-Harness with the PK-JW, which we feel is a perfect match. These Platatac PK-JW Chest Rigs originally come with just two harness options - the standard CHICOM H Harness and the CHICOM low pro adjustable shoulder straps; there are now 3 included harness options.]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-jw-chest-rig-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-jw-chest-rig-76.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-mk4-chest-rig-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-mk4-chest-rig-73.jpgcustom-itemoptacticalgear-pagevests133831373349239.99Platatac Peacekeeper MK5 Chest RigPlatatac111• Can carry up to six 30 Round AR/M4 style magazines (Each pouch will also accommodate 2 x AK mags, or a single 20rnd. 417/.308 mag)
• 2 x Accessories/Water bottle/GP/ANPRC 152 pouches with front zip admin pockets
• 1 x Large Velcro mesh pocket with included Velcro in zipper insert (removable)
• 2 x Tweave 4 way stretch pockets at the flanks
• 1 x Horizontal zippered pocket with webbing loops to attach elastic loop inserts to carry a TQ, Plasti Cuffs or Cyalume
• 2 x Elastic Inserts included, one holds SOF or CAT TQ and the other can hold two 4" or 6" cyalume
• PALS areas between pouches and on the sides of the GP pouches to attach additional MOLLE-compatible pouches
• Velcro sandwich for sub load pouches to boost carrying capacity
• Color matched velcro loop for IFF, C/S or Flag patch with embroidered Platatac logo
• Sewn drainage holes in all pouches
• 2 x Harness options: standard Chicom low pro adjustable shoulder straps (X straps) and Chicom LW H-Harness Materials and weight:
• 500 Denier Cordura nylon
• Tweave 520E 4 way Stretch
• ITW Nexus hardware
• YKK Zips with heat shrink paracord pulls]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-mk4-chest-rig-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-mk4-chest-rig-82.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-silks-alpha-jacket-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-silks-alpha-jacket-18.jpgcustom-itemoptacticalgear-pagejavesw13383855229Platatac Silks Alpha JacketPlatatac111• Regulates Warmth
• Advanced Breathability
• Fast Drying
• Compressible
• Lightweight
• Highly Durable ]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-silks-alpha-jacket-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-silks-alpha-jacket-30.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/platatac-spur-tropical-pack-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-spur-tropical-pack-66.jpgcustom-itemoptacticalgear-page72hourpacks133823394389269.99Platatac SPUR Tropical PackPlatatac111Features
• 56 litre capacity
• Weight 1.9kg
• Ventilated harness with internal frame
• 3 zippered compartments
• 4 External pockets with dual closure
• Hydration hanger and removable mesh pocket
• 3 zippered mesh pockets inside the main compartment
• 2 zippered mesh pockets inside the second compartment
• Sewn drainage holes
• 500 denier Multicam® nylon
• 140mm x 50mm loop for IFF, patches ect.
• Milspec thread and stitching
• YKK zips with paracord pulls Dimensions approx.
• Main compartment 50cm (H) x 34cm (W) x 20cm (D)
• Front large compartment 44cm (H) x 29cm (W) x 6.5cm (D)
• Flat zippered pocket 27cm (H) x 28cm (W) x 2.5cm (D)
• External pockets x4 24cm (H) x 12cm (W) x 11.5cm (D) 3L Hydration Bladder Sold Separately. UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item (due to the size of item).]]>
1https://s.turbifycdn.com/aah/optacticalgear/platatac-spur-tropical-pack-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-spur-tropical-pack-79.jpgPlatatac
https://s.turbifycdn.com/aah/optacticalgear/plate-carriers-45.jpgitem.optacticalgear-pagemollevestsrigsPlate Carriers and Vests1crprjpc20andfecoslandcocrprrsecrpraispcandcrprjuplcajafecofcv5andcspsylvplcaanmarcasplcaaavesyscplcaanvesyliweplcacrprlvsandpacrprlvandcofispaacandovopmbasplcavesylawenplcagkplcafispstv3sacufispslulliplfispfionwigppedelowprslppedetr5maplaeamumiarcamaloasarca20maloarca20vearrekitNone of the items in this section come with body armor in any form (unless noted), they are not designed to stop bullets, have no ballistic rating and are not to be employed as life-support equipment.]]>1https://s.turbifycdn.com/aah/optacticalgear/plate-carriers-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/plate-carriers-44.jpgcustom-itemoptacticalgear-pageindexPouch, Ammo1avssmposuandoptopmapocltopmapohyamporandpipimapohagrsmgrflflshsmcrsemgpomacllopkgof4maclshpkgof4shcoreba1item.optacticalgear-pageindexPouch, Other 1avssmposuandspsyworadiopouchesinmedpoipomohypagepuutpoadminpouchesdupoevbacocavebahogpcopowrdohobrpowabopophflpdbapocbrngasmaskswalletsmaclshpkgof4macllopkgof4madapo1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-byte-tactical-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-byte-tactical-44.jpgcustom-itemoptacticalgear-pageheadlamps59BYTTAC29.99Princeton Tec Byte TacticalPrinceton Tec111LAMP: 1 Maxbright LED, 1 Red Ultrabright LED
BURN TIME: 8 hours
BATTERIES: 2 AAA Alkaline or Lithium
WEIGHT: 2.25 oz / 64g
WATER RESISTANT: IPX4
WARRANTY: 5 Years ]]>
1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-byte-tactical-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-byte-tactical-58.jpgPrinceton Tec
https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-46.jpgcustom-itemoptacticalgear-pageheadlamps59xxx138.99125.99Princeton Tec Charge MPLS - AA BatteryPrinceton Tec111• Standard Nylon Headstrap
• Helmet Side Mount
• ARC Rail
• EXFIL Rail
• MOLLE/PALS
• Picatinny
• Above the Rail Specs:
• NSN: 6230-01-606-1473
• Power: 55 Lumens
• Lamp: 1 x Maxbright LED (regulated), (dimmable)3 Ultrabright LEDs
• Burn Time: 24 hours
• Batteries: 1 AA Lithium
• Weight: 1.67oz / 47g
• Water Resistant: IPX7
• Warranty: 1 Years IR Version is not available for export. Must ship inside the USA or to an APO Address.]]>
1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-56.jpgPrinceton Tec
https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-pro-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-pro-56.jpgcustom-itemoptacticalgear-pageheadlamps59CPRBI149.99134.99Princeton Tec Charge Pro MPLS - CR123 BatteryPrinceton Tec111 The Charge Pro model provides increased run time of 40 hours and a more compact profile. It is designed to use 1 x CR123 Lithium battery. The Charge Pro mounts to various helmet rail systems, but has become more versatile including a wide variety of mounts that allow you to use the light on all of your gear. The Charge Pro runs off of a single CR123 Lithium battery, keeping it lightweight, extending burn time and standing up to colder climates. The Charge Pro offers a clean white flood light for distance spotting or large area lighting and a lower lumen light output for close at hand administrative tasks when in the field. The white flood light is fueled by a Maxbright LED, while the lower lumen administrative lighting comes from 3 Ultrabright LEDs, which are available in a number of specialty color configurations. (Read more about our specialty LED color options here.) Choose your LED configuration in the drop down menu above. Ease of performance in exacting situations was kept top-of-mind while designing the user interface, so the Charge Pro’s Maxbright white mode requires a full two-second button press to be turned on to avoid accidental activation. Versatile, smart and tough, the Charge Pro (along with our other MPLS Helmet Lights) were created with our exclusive flexi-neck design allowing you to direct light where you need it, regardless of the angle of your helmet. All Princeton Tec MPLS Helmet Lights come with the following mounts:
• Standard Nylon Headstrap
• Helmet Side Mount
• ARC Rail
• EXFIL Rail
• MOLLE/PALS
• Picatinny
• Above the Rail POWER: 55 Lumens
• LAMP: 1 Maxbright LED (regulated), (dimmable) 3 Ultrabright LEDs
BURN TIME: 40 hours
• BATTERIES: 1 CR123 Lithium
• WEIGHT: 1.67oz / 47g
• WATER RESISTANT: IPX7
• WARRANTY: 1 Year ]]>
1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-pro-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-pro-66.jpgPrinceton Tec
https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-x-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-x-12.jpgcustom-itemoptacticalgear-pageheliandac59C23149.99Princeton Tec Charge X111 Standard Nylon Headstrap
Helmet Side Mount
ARCs
EXFIL Rail
MLOK®
MOLLE/PALS
Picatinny
Above the Rail
POWER: 100 Lumens
LAMP: 1 Maxbright LED w/ Spot1 Red Ultrabright LED1 Blue Ultrabright LED1 Green Ultrabright LED1 IR Ultrabright LED
BURN TIME: 50 hours
BATTERIES: Dual-Fuel (1) CR123 Lithium or (1) AA Lithium or (1) AA Alkaline
WEIGHT: 2oz / 55g
WATER RESISTANT: IPX8
WARRANTY: 1 Year thru manufacturer ]]>
1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-x-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-x-14.jpg
https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-point-mpls-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-point-mpls-64.jpgitem.optacticalgear-pageheliandac59MPLS-150.9945.99Princeton Tec Point MPLSPrinceton Tec111• Helmet Side Mount
• ARC Rail Mount
• EXFIL Rail
• MOLLE/PALS
• Picatinny
• Above the Rail
• Hat Brim Clip Specs:
• Power: 10 Lumens
• Lamp: 1 Ultrabright LED
• Burn Time: 36 hours
• Batteries: 2 x 2016 Lithium Coin Cells
• Weight: 0.6oz / 17g
• Water Resistant: IPX4
• Warranty: 1 Year IR Version is not available for export. Must ship inside the USA or to an APO Address. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-point-mpls-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-point-mpls-77.jpgPrinceton Tec
https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-multicam-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-multicam-61.jpgitem.optacticalgear-pageheadlamps59HYB12364.9956.99Princeton Tec Remix ProPrinceton Tec111• NSN: 6230-01-606-1095
• Power: 300 Lumens
• Lamp: 1 x Maxbright LED3 Ultrabright LEDs
• Burn Time: 116 hours
• Batteries: 1 x CR123 Lithium
• Weight: 2.3oz / 66g
• Water Resistant: IPX4
• Warranty: 5 Years IR Version is not available for export. Must ship inside the USA or to an APO Address. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-multicam-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-multicam-71.jpgPrinceton Tec
https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-mpls-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-mpls-47.jpgcustom-itemoptacticalgear-pageheliandac59RMX150PRO-NOD102.9992.69Princeton Tec Remix Pro MPLS - NODs KitPrinceton Tec111• Flashing IR model option (RBI, RGI models only)
• Large, simple to operate switch for activation
• Headlamp rotates 185 degrees, even when mounted on helmet, to direct IR in various angles Includes MPLS Headlamp mounts:
• NVG Adapter Plate
• Bracket mount for MOLLE and/or standard nylon headstrap
• Standard nylon headstrap Specs:
• NSN: 6230-01-633-4682
• Power 300 Lumens
• Lamp: 1 Maxbright LED3 Ultrabright LEDs
• Burn Time: 40 hours
• Batteries: 1 CR123 Lithium
• Weight: 2.3oz / 66g
• Water Resistant: IPX4
• Warranty: 5 Years IR Version is not available for export. Must ship inside the USA or to an APO Address.]]>
1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-mpls-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-mpls-57.jpgPrinceton Tec
https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-mpls-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-mpls-55.jpgitem.optacticalgear-pageheliandac59MPLS-572.9965.69Princeton Tec Switch MPLS with Helmet Mounts IncludedPrinceton Tec111• Helmet Side Mount
• ARC Rail
• EXFIL Rail
• MOLLE/PALS
• Picatinny
• Above the Rail
• Hat Brim Clip Specs:
• NSN: 6230-01-622-7180
• Power: 10 Lumens
• Lamp: 2 Ultrabright LEDs
• Burn Time: 36 hours
• Batteries: 2 x 2016 Lithium Coin Cell
• Weight: 0.6oz / 17g
• Water Resistant: IPX4 IR Version is not available for export. Must ship inside the USA or to an APO Address. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-mpls-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-mpls-65.jpgPrinceton Tec
https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-rgb-mpls-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-rgb-mpls-17.jpgcustom-itemoptacticalgear-pageheliandac59-SWITCH-RGB79.99Princeton Tec Switch RGB MPLSPrinceton Tec111• POWER: 10 Lumens
• LAMP: 1 Red Ultrabright LED, 1 Blue Ultrabright LED, 1 Green Ultrabright LED, 1 White or IR Ultrabright LED
• BURN TIME: 16 hours
• BATTERIES: (2) CR2016 Lithium Coin Cells
• WEIGHT: 0.6oz / 17g
• WATER RESISTANT: IPX4
• WARRANTY: 1 year through the manufacturer The MPLS platform includes all equipment necessary to tailor Switch RGB to your personal needs:
• Helmet Side Mount
• ARCs
• MOLLE/PALS
• Picatinny
• Above the Rail
• Hat Brim Clip
• M-LOK® ]]>
1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-rgb-mpls-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-rgb-mpls-30.jpgPrinceton Tec
https://s.turbifycdn.com/aah/optacticalgear/princeton-tectactical-quad-multicam-38.jpgitem.optacticalgear-pageheadlamps59QUAD-TAC-MC44.9939.99Princeton Tec Tactical Quad - MulticamPrinceton Tec111• NVG Adapter Plate
• Bracket mount for MOLLE and/or standard nylon headstrap
• Standard nylon headstrap Specs:
• NSN: 6210-01-614-7831
• Power: 78 Lumens
• Lamp: 4 x White Ultrabright LEDs (regulated)
• Burn Time: 60.5 hours
• Batteries: 3 x AAA Alkaline or Lithium
• Weight: 3.6oz / 101g
• Water Resistant: IPX7
• Warranty: Lifetime ]]>
1https://s.turbifycdn.com/aah/optacticalgear/princeton-tectactical-quad-multicam-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tectactical-quad-multicam-45.jpgPrinceton Tec
https://s.turbifycdn.com/aah/optacticalgear/proctor-sling-installation-video-21.jpglink.frprsl1https://s.turbifycdn.com/aah/optacticalgear/proctor-sling-installation-video-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/proctor-sling-installation-video-20.jpglink.blfogetrkitn21https://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-coat-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-coat-44.jpgcustom-itemoptacticalgear-pageprun62F540969.99Propper OCP IHWCU CoatPropper111Features
- Single-breasted
- Raglan sleeve front with a 5-button closure and pen slot
- Fold down collar with a fusible interlining
- Long sleeves with cuffs and one button, three buttonholes adjustable cuff tab
- Loop fields on front
- Two bellow style top opening upper sleeve pockets with eyelet drain hole
- 100% nylon elbow reinforcements
- Identification Friend or Foe tab covers with hook and loop fasteners on both sleeves
- Double-turned and cleaned finished hem]]>
1https://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-coat-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-coat-58.jpgPropper
https://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-trouser-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-trouser-44.jpgcustom-itemoptacticalgear-pageprun62F591669.99Propper OCP IHWCU TrouserPropper111Features
- Covered fly with button fly
- Seven belt loops
- Two side hanging pockets
- Two front side pleated cargo pockets with button closure flaps
- High end of cargo pockets at front of pocket rather than rear like ACU
- Two lower leg side pockets with button closure flaps
- Side bellow cargo pockets with eyelet drain holes
- Double needle seat patch with gusset
- 100% nylon knee reinforcements
- Nylon tape at leg hem
- Drawstring waistband
- Internal anti-chafing knit fabric at knees for added comfort]]>
1https://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-trouser-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-trouser-58.jpgPropper
https://s.turbifycdn.com/aah/optacticalgear/opt-punisher-patch-32.jpgitem.optacticalgear-pagegrpa12CP5070923Punisher PatchOPT1112 inches by 2 inches, backed with hook side VELCRO Brand fastener. Unlicensed modified version of the original.1https://s.turbifycdn.com/aah/optacticalgear/opt-punisher-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-punisher-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/pvc-patches-60.jpgitem.optacticalgear-pagepaemPVC Patches1optmoinpvcpaoptomsepaoptmefoshinpoptmileshpvcspsyhotdogpvoptmasofpvcpoptpvcusflpaoptlapvcflpaoptgujoelopaoptgrlopvcpaoptnodepvcpaha4papahodeoptdulop1https://s.turbifycdn.com/aah/optacticalgear/pvc-patches-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/pvc-patches-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/quick-clot-combat-gauze-49.jpgitem.optacticalgear-pagebandages7041253.2446.99Quick Clot Combat GauzeQuick Clot Combat Gauze111•Easy to use and remove
•Flexible and pliable
•3 in x 4 yds (12 ft) roll The QuikClot family of products for hemostasis has been chosen by EMS, Law Enforcement, Military, and Healthcare Professionals to save lives every day. USES:
•Emergency Departments
•Trauma and Critical Care
•Orthopedics
•Podiatry Precautions:
•For external use only
•Sterility not guaranteed if package is damaged or opened
•Discard if package is damaged
•Single use only
•Do not reuse or re-sterilize
•Avoid contact with eyes Currently the choice of JSOC and approved by DoD for combat operations. There are no returns or exchanges on medical items.]]>
1https://s.turbifycdn.com/aah/optacticalgear/quick-clot-combat-gauze-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/quick-clot-combat-gauze-59.jpgQuick Clot Combat Gauze
https://s.turbifycdn.com/aah/optacticalgear/radian-weapons-afterburner-ramjet-micro-comp-and-barrel-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-afterburner-ramjet-micro-comp-and-barrel-62.jpgcustom-itemoptacticalgear-pagestweliandmo72-G19-IL-RN389.95Radian Weapons Afterburner + Ramjet Micro Comp and BarrelRadian Weapons111FEATURES
• 44% recoil reduction in combination with RAMJET (115g ammunition)
• Hardened 17-4 stainless steel
• Taper-lock screw interface; no Loctite, shims, or setscrews needed
• Angled front faces aid in holstering
• Available in black DLC
• No threads, legal for sale in all 50 states
• Makes length of G19 into G17 length, fitting all G17 holsters This Item is Excluded from ALL Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/radian-weapons-afterburner-ramjet-micro-comp-and-barrel-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-afterburner-ramjet-micro-comp-and-barrel-61.jpgRadian Weapons
https://s.turbifycdn.com/aah/optacticalgear/radian-weapons-raptor-ambidextrous-charging-handle-ar15-m4-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-raptor-ambidextrous-charging-handle-ar15-m4-42.jpgcustom-itemoptacticalgear-pagem4arupreandp72-R000194.95Radian Weapons Raptor Ambidextrous Charging Handle AR15/M4 (R)Radian Weapons111This is the AR15/M4 variant and will not fit any AR10-patterned rifles ]]>1https://s.turbifycdn.com/aah/optacticalgear/radian-weapons-raptor-ambidextrous-charging-handle-ar15-m4-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-raptor-ambidextrous-charging-handle-ar15-m4-52.jpgRadian Weaponshttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-talon-ambidextrous-safety-selector-2-lever-kit-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-talon-ambidextrous-safety-selector-2-lever-kit-44.jpgcustom-itemoptacticalgear-pagem4arupgrades72-R002059.95Radian Weapons Talon Ambidextrous Safety Selector 2-Lever KitRadian Weapons111The Talon™ 45/90 ambidextrous safety selector is a modular design that can be installed as a standard 90° or as a 45° short throw by simply rotating the shaft 180° inside the lower receiver. Selector levers install using a precision machined dovetail interface with spring-loaded retention stud to lock the lever in place – no screws to come loose or break. The Talon is compatible with most semi-automatic AR15 & AR10/SR25-pattern rifles as well as MCX and MPX platforms.
• Designed & Manufactured in the USA
• 2-Lever Combo: Short + Long
• Levers Machined from Billet aircraft grade aluminum w Milspec Type 3 Hard Coat Anodized Finish or Cerakote
• Center Shaft Machined from Hardened Steel w/ Black Nitride Finish ]]>
1https://s.turbifycdn.com/aah/optacticalgear/radian-weapons-talon-ambidextrous-safety-selector-2-lever-kit-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-talon-ambidextrous-safety-selector-2-lever-kit-58.jpgRadian Weapons
https://s.turbifycdn.com/aah/optacticalgear/radio-pouches-46.jpgitem.optacticalgear-pagemollepouchesRadio Pouches1crprrserasipplacsmfl152wrataatanrepocrpradpohasteudbrssprnaflcocaresttwnepttofputdiupttrespsymurachmkvesyhewhmorahigrgesidrprhsmuaccotamohsratamoblfogehewhmuatsmbtirapohsmomirapofispmurapomiwechdemumswlibarapomiwebarapo1https://s.turbifycdn.com/aah/optacticalgear/radio-pouches-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/radio-pouches-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/raid-xe-spec-sheet-11.jpglink.wiraxelowpo1https://s.turbifycdn.com/aah/optacticalgear/raid-xe-spec-sheet-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/raid-xe-spec-sheet-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/raine-bridger-panel-for-first-spear-strandhogg-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/raine-bridger-panel-for-first-spear-strandhogg-33.jpgcustom-itemoptacticalgear-pagecaac1XX054PANEL69.9959.99Raine Bridger Panel for First Spear TubesRaine Tactical Gear111• Adds back the MOLLE/PALS real-estate lost from using FirstSpear® Tubes™ (Bridges the Gap)
• Smooth quick release function
• Covers and protects FirstSpear® Tubes™ quick release hardware
• Increases service life of Tubes™ quick release hardware
• Increased protection from accidental opening of Tubes™ quick release hardware
• Attachment options compatible with MOLLE/PALS, 6/12™, and 6/9™ platforms
• Ambidextrous, works with left and right FirstSpear® Tubes™ cummerbunds
• Quick release pull cord extender for ease of donning & doffing with mounted dual stacked ammo and radio pouches Lifetime Warranty, Made in the USA 1 x individual Bridger Panel and accessory parts included. Additional panels sold separately. Vest sold separately. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/raine-bridger-panel-for-first-spear-strandhogg-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/raine-bridger-panel-for-first-spear-strandhogg-43.jpgRaine Tactical Gear
https://s.turbifycdn.com/aah/optacticalgear/ram-raised-angle-marker-40.jpgitem.optacticalgear-pagefigemi593110007330299.99RAM Raised Angle MarkerRaised Angle Marker IN STOCK!111NOTE: This item does not include any poles or similar hardware. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/ram-raised-angle-marker-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/ram-raised-angle-marker-50.jpgRaised Angle Marker IN STOCK!https://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-24.jpglink.hrfcora1https://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-23.jpglink.hrfcodura1https://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-22.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-carrying-backpacks-weapon-cases-drag-bags-65.jpgitem.optacticalgear-pagebaRange / Gear Bags1shcorebaeogshootingbagemspamsacemdomammosactewetrpabymyfisphehutmahodeunca1https://s.turbifycdn.com/aah/optacticalgear/weapon-carrying-backpacks-weapon-cases-drag-bags-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-carrying-backpacks-weapon-cases-drag-bags-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/range-gear-70.jpgitem.optacticalgear-pageweaponsRange Gear1octaheprcosunandshtrtaargescmidsigargegachargepisigachargefatbaargesqrebagargewacaopgaeogshootingbagtrnoratrnorashcorebamadataoutmadatalamadavopomadaliposmmadalipomemadalipolamadawiposmmadawipomemadawipolamadaposmmadapomemadapolamadautormadacan20madacanlahpgstockcufftatarabagmeemdomammosacemspamsactwnebipov2hamisychwrlema412tasps1https://s.turbifycdn.com/aah/optacticalgear/range-gear-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/range-gear-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/range-supplies-35.jpgcustom-itemoptacticalgear-pageindexRange Supplies1otweclkiriteinrainbrtokitargetsshottimersrangegeartrnoratrnorabagesttrcotatrcasetrcotapi1demahashde1https://s.turbifycdn.com/aah/optacticalgear/range-supplies-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/range-supplies-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-dip-can-holster-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-dip-can-holster-44.jpgcustom-itemoptacticalgear-pagephflpdbapo126RTDIP9.99Raptor Dip Can HolsterRaptor Tactical111The Raptor Tactical Dip Can Holster is a simple, versatile way to store and protect your dip. It not only gives you quick access when needed but also has a sleek, lightweight design. Weight 1.85 oz. Clips easily into MOLLE/ PALS, or (up to) 1.75" belt systems Compatible with shredded beef jerky chew and other similar products Made in USA1https://s.turbifycdn.com/aah/optacticalgear/raptor-dip-can-holster-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-dip-can-holster-58.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-athena-antenna-relocation-pouch-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-athena-antenna-relocation-pouch-49.jpgcustom-itemoptacticalgear-pageradiopouches126RT-ANTENNAPOUCH32.2430.49Raptor Tactical Athena - Antenna Relocation PouchRaptor Tactical111-Weight: 0.70 oz
-Dimensions: 6.5" x 1.5" Made in the USA; Lifetime Warranty. Pouch Only, Antenna and Cables not included.]]>
1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-athena-antenna-relocation-pouch-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-athena-antenna-relocation-pouch-63.jpgRaptor Tactical
https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-birger-3-in-1-pouch-30.jpgcustom-itemoptacticalgear-pagecobamanpumeb126RT-BIRGER104.4899.99Raptor Tactical BIRGER 3 in 1 PouchRaptor Tactical111"BIRGER - in the Norse language means the Keeper" This item is a 3 in 1 pouch that can be worn as a dangler affixed to your gear via velcro hook, worn as a fanny pack with our attached waist strap, or slide onto any belt. This item has 2 rear chem-light holders, a rear molle channel, and a discreet rear pocket for sensitive items. This pouch also sports elastic loops on the underside for tourniquets, epi-pens, or other similarly sized items for easy access. The Center Compartment is the largest compartment with an interior divider made of netting material to allow separate storage of items, and a panel of velcro loop to affix blood type patches, call signs, or to avoid the scratching of equipment. This compartment is large enough to hold an M1911A1 MS Tactical Handgun and close easily. The front-most compartment is similarly designed to the center and fits 3 Double stacked 9mm magazines. And finally, The exterior panel of this pouch is affixed with our favorite honeycomb cut velcro loop, perfect to rock any number of patches, and two retainer loops made of laminated Cordura for any number of uses. Dimensions: 9" long, 5" tall, and 2.5" wide, empty. 1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-birger-3-in-1-pouch-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-birger-3-in-1-pouch-40.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-dump-pouch-with-chemlight-holder-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-dump-pouch-with-chemlight-holder-35.jpgcustom-itemoptacticalgear-pagedupoevba126RT-DP45.05Raptor Tactical Dump Pouch with ChemLight holder - Short ModelRaptor Tactical111• Collar with double drawcord for optimal maintenance of content.
• Stiffening made of stainless steel ensures optimal maintenance of shape when unfolded.
•Can be stowed by either rolling the pouch up while still retaining access to chemlights, or folded up for smallest profile
• 500D Cordura material with Mil-spec mesh bottom to allow dirt and water to drain out
• Mounting system compatible with MOLLE and up to 2-inch wide belts via the belt sleeve
• Perfect for your empty pods, tubes, or mags.
• Holds up to 9 M4 magazines
• Weight: 0.28 lbs Made in the USA, Lifetime Warranty. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-dump-pouch-with-chemlight-holder-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-dump-pouch-with-chemlight-holder-45.jpgRaptor Tactical
https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-headset-cable-hider-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-headset-cable-hider-41.jpgcustom-itemoptacticalgear-pagehepr126RTHCH15Raptor Tactical Headset Cable HiderRaptor Tactical111OPT Note: Be sure that your headset will work with the Headset Cable Hider. It is compatible with most Peltor-style headbands and 3M Peltor ARC Adapters Headset not included]]>1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-headset-cable-hider-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-headset-cable-hider-54.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-marvn-rucksack-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-marvn-rucksack-16.jpgcustom-itemoptacticalgear-page72hourpacks126MAR270Raptor Tactical MARVN RucksackRaptor Tactical111Product Features:
• Made of 500D Cordura
• Weight: 3.07 lbs
• Size: 13" x 6" x 20.5"
• Padded Shoulder Straps
• Chest Strap
• Webbing Handle
• Removable Spring Steel Frame
• MOLLE Webbing
• Top Flap Pouch
• Quick Access Zipper Top
• Interior MOLLE Panel
• Cinch Closure ]]>
1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-marvn-rucksack-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-marvn-rucksack-30.jpgRaptor Tactical
https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-micro-hand-warmer-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-micro-hand-warmer-21.jpgcustom-itemoptacticalgear-pageglovesRAPMICRO120109.95Raptor Tactical Micro Hand WarmerRaptor Tactical111Features:
- Quick Heat: Thanks to its advanced materials and insulation, this hand warmer heats up quickly, providing instant relief from the cold.
- Versatile Design: The hand warmer is designed with versatility in mind. It can be easily attached to a belt, backpack, or tactical gear, making it readily accessible when needed.
- Highly Pack-able and Lightweight: this hand warmer is very easy to pack down and will fit into a cargo pocket without excess bulk. The advanced materials allow it to be extremely warm without all the fluff and bulk of traditional hand warmers.
- Durable and Long-lasting: The combination of Quattro Assault, Radiance, and Alpha Direct ensures that this hand warmer is built to withstand heavy use and harsh conditions, promising long-lasting durability. Materials: Quattro Assault: The exterior of the Raptor Tactical Micro Hand Warmer is constructed using Quattro Assault, a rugged and abrasion-resistant fabric. This material is specially engineered to withstand the harshest conditions, making it perfect for tactical applications. It ensures that your hand warmer can endure the rigors of outdoor adventures, whether you're hiking through rough terrain or navigating demanding tactical scenarios. Radiance Insulation: Beneath the Quattro Assault exterior, the hand warmer features Radiance insulation, which is renowned for its exceptional heat-retaining properties. Radiance insulation efficiently traps and retains body heat, keeping your hands warm even in freezing temperatures. This means you can stay comfortable and focused on the task at hand without worrying about the cold. Alpha Direct Lining: The interior of the hand warmer is lined with Alpha Direct, a high-performance fleece material. Alpha Direct offers an incredible combination of warmth and moisture management. It wicks away sweat and moisture from your hands, ensuring that you stay dry and comfortable during prolonged use. Additionally, Alpha Direct is known for its lightweight and breathable properties, ensuring that you don't feel weighed down while on the move. Made in the USA This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-micro-hand-warmer-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-micro-hand-warmer-35.jpgRaptor Tactical
https://s.turbifycdn.com/aah/optacticalgear/raptor-odin-mk-iii-belt-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-odin-mk-iii-belt-50.jpgcustom-itemoptacticalgear-pagemowebe126RTODIN3116.55Raptor Tactical Odin MK III BeltRaptor Tactical111• Regular Model: 1 layer of rigger webbing, flexible like a standard rigger belt.
• 3-Gun Model: 2 layers of rigger webbing, more rigid for holding a larger load out of gear, recommended model for most users. SIZE: size should be determined by measuring with your waist with pants on, measure around the belt loops. Do Not Use Jeans Size. SMALL: 30.5-33.5"
MEDIUM: 34-36.5"
LARGE: 37-40"
EXTRA LARGE: 40-43" Outer belt: 1 3/4" wide
Inner belt: 1 1/2" wide Made in the USA.]]>
1https://s.turbifycdn.com/aah/optacticalgear/raptor-odin-mk-iii-belt-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-odin-mk-iii-belt-60.jpgRaptor Tactical
https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-sentinel-skull-crusher-gen-2-0-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-sentinel-skull-crusher-gen-2-0-61.jpgcustom-itemoptacticalgear-pagenvgmoso126SENTINEL219.99209.99Raptor Tactical Sentinel Skull Crusher GEN 2.0Raptor Tactical111demovideo7• One-size fits all
• Side rail mounting holes compatible with MOE rails by MAGPUL
• Internal cables fitting
• Compatible with all base plates available on the market
• Molle-loop back panel
• Super ergonomic ]]>
1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-sentinel-skull-crusher-gen-2-0-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-sentinel-skull-crusher-gen-2-0-75.jpgRaptor Tactical
https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-copia-magazine-carrier-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-copia-magazine-carrier-46.jpgcustom-itemoptacticalgear-pageracohoandac108DS940U39.99Raven Concealment Copia Pistol Mag Carrier - Single and DoubleRaven Concealment111-Glock 9mm/40/357
-M&P 9mm/40 Double Stack
-Sig 226
-Beretta M9/92/96
-HK P30
-HK P2000
-XDm 9/40
-Styer 9/40
-Beretta PX4
-CZ-75
-FNP 9
-FNX 9
-FNS 9
-Baby Eagle
-Browning HiPower
-XD9/40
-SW-99
-Walther P99
-Walther PPQ
-SW 4006 And many more! Mounting loops:
-Tall model includes standard OWB Belt Loops, 1.5-inch width
-Short model includes new shorter Closed Loops, 1.5-inch width. Made in the USA. Unconditional Lifetime Warranty. USA and APO Addresses only. No International shipping.]]>
1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-copia-magazine-carrier-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-copia-magazine-carrier-56.jpgRaven Concealment
https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-belt-claw-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-belt-claw-46.jpgcustom-itemoptacticalgear-pageeibakitandac108CLAW14.99Raven Concealment Eidolon Belt ClawRaven Concealment111-Right-Hand: made for use with Right-Hand holster (pictured)
-Left-Hand: made for use with Left-Hand holster. This accessory is specifically made to work with the Eidolon Holster only. Claw and mounting screws only, all other parts sold separately. Made in the USA. Unconditional Lifetime Warranty. USA and APO Addresses only. No International shipping.]]>
1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-belt-claw-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-belt-claw-60.jpgRaven Concealment
https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-system-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-system-58.jpgcustom-itemoptacticalgear-pageeibakitandac108EGXXXX99.99Raven Concealment Eidolon Holster - Full KitRaven Concealment111Holster Kit Only. No other parts or items included. The Eidolon is the culmination of over three years of design and development. It is designed to be the most refined and functional inside-the-waistband holster on the market. At the core of the Eidolon is the holster shell. The shell is precisely fitted to the weapon on the inside and is smooth on the outside to work in conjunction with the body, belt, and clothing -in nearly any carry position- to maximize comfort and concealment. At the same time, the shell provides attachment points for a host of accessories to allow the user to tailor the holster for their specific carry needs. The holster shells feature an innovative, adjustable retention feature that isolates the tension solely on the front of the trigger guard. This provides for an extremely clean “feel” when drawing and holstering - unlike other companies’ adjustable retention holsters which simply compress the holster body along the entire trigger guard and/or frame, resulting in a mushy feel as the pistol drags against the inside of the holster. All Eidolon holster shells are fully compatible with most extended controls, factory and after-market sights of any height (including suppressor sights), any type of RDS mounted behind the ejection port, and most extended/threaded barrels. Full Kit
-The Eidolon Full Kit gives you all the accessories needed to optimize your holster for either AIWB or IWB carry on nearly any body type. The Eidolon Full kit is a tuckable, versatile, and comprehensive IWB/AIWB holster package that can be used with one or both belt attachments and give you hundreds of potential configuration options. The Full Kit includes: -One holster shell of your specification
-One pair of belt attachments of your choice
-One Tall Spacer for mounting the belt attachment below the trigger guard
-One 8-hole Extension Wing
-One 10-hole Extension Wing
-One Short Spacer for mounting the Extension Wing below the trigger guard, angled up toward the belt line.
-One set of Belt Claws
-One Holster Wedge for right or left hand configurations
-All needed hardware and full instruction manual Shell Models
-The Glock 26/19/Universal model has a pass-through open bottom design and will fit any Gen 3-5. Glock 9mm/.40cal double stack pistol. The holster shell itself is equal in length to a Glock 19 pistol.
-The Glock 17 model has a closed bottom design equal in length to a Glock 17 pistol, but will fit any Glock 26/27/19/23/17/22 Gen 3-5.
-NOTE: Both models feature a tall body shield on the inboard side (body-facing side) and a short shield on the outboard side of the holster. Included Accessories
-Tuckable Overhook Set: Choose between Overhooks for 1.5" or 1.75" belts. Can be used as a pair or individually mounted to the holster shell or the Offset Wings (also included). Overhooks offer two ride height positons 5/8” up or down, and approximately 15 degrees of cant adjustment, forward or back. Made in the USA. Unconditional lifetime warranty. USA and APO Addresses only. No International shipping. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-system-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-system-68.jpgRaven Concealment
https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-iwb-basic-kit-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-iwb-basic-kit-48.jpgcustom-itemoptacticalgear-pageeibakitandac108EGXX69.99Raven Concealment Eidolon Holster - IWB Basic KitRaven Concealment111litoeipaHolster Kit Only. No other parts or items included. The Eidolon from Raven Concealment Systems is the culmination of over three years of design and development. Eidolon is designed to be the most refined and functional Inside the Waistband holster on the market. At the core of the Eidolon system is the holster shell. The shell is precisely fitted to the weapon on the inside and is designed to be smooth on the outside and work with the body, belt and clothing in any carry position to maximize comfort and concealment. At the same time the shell provides attachment points for a host of accessories to allow the user to tailor the system for their specific carry needs. The holster shells feature an innovative adjustable retention feature that isolates the tension on only the front of the trigger guard. This provides for an extremely clean feel when drawing and holstering with minimal adjustment - unlike other adjustable retention holsters that grossly squeeze the entire trigger guard and/or frame and result in a mushy feel as the pistol drags against the inside of the holster. All holster shells are fully compatible with most extended controls, any brand or size sights, any type of MRDS mounted behind the ejection port and most extended/threaded barrels. Our “Basic” Inside-the-Waistband Eidolon kit is excellent for IWB carry between 3 and 5 o’clock for a right handed shooter (reverse for lefties). Accessories are sold separately to aid in Appendix carry and other mounting options for greater concealment. The Basic IWB kit is a tuckable, compact IWB system that can be used with one or both belt attachments and give you scores of cant and ride height adjustments. The Basic IWB Kit includes:
-One holster ambi shell of your specification
-One pair of 1.5" Overhook belt attachments
-One Tall Spacer for mounting the belt attachment below the trigger guard
-All needed hardware and full instruction manual Models: All Models are Ambidextrous
-The Glock 26/19/Universal model has a pass-through open bottom design and will fit any Gen 3-5. Glock 9mm/.40cal pistol. The holster shell itself is equal in length to a Glock 19 pistol.
-The Glock 17 model has a closed bottom design equal in length to a Glock 17 pistol, but will fit any Glock 26/27/19/23/17/22 Gen 3-5. Body Shield:
The Ambidextrous Short body shield is cut to clear the hand completely but yet still help prevent clothing from entering the mouth of the holster and provide a visual and tactile guide for re-holstering the weapon. Color: Black Made in the USA. Unconditional Lifetime Warranty. USA and APO Addresses only. No International shipping.]]>
1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-iwb-basic-kit-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-iwb-basic-kit-62.jpgRaven Concealment
https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-overhooks-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-overhooks-57.jpgcustom-itemoptacticalgear-pageeibakitandac1081XX03OH24.99Raven Concealment Eidolon Tuckable OverhooksRaven Concealment111-Two Overhook struts in your choice of 1.5" or 1.75" belt size
-One Tall Spacer (for mounting the strut below the trigger guard)
-All needed hardware and instructions Made in the USA. Unconditional Lifetime Warranty. USA and APO Addresses only. No International shipping. ]]>
1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-overhooks-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-overhooks-71.jpgRaven Concealment
https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-soft-loops-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-soft-loops-49.jpgcustom-itemoptacticalgear-pageeibakitandac10830435TA34.99Raven Concealment Eidolon Tuckable Soft Loops - Infinite Ride Height AdjustmentRaven Concealment111These Soft Loops allow for infinite ride height adjustment, meaning you can adjust the height of the holster to the exact right spot for best concealment, speed and comfort. Can be used on multiple Raven Concealment products. Tuckable Soft Loops can be used as a pair or individually mounted to the holster shell or Offset Wings. The polymer struts provide two ride height positions 5/8” up or down and approximately 15 degrees of cant adjustment forward or back. Soft Loops are adjustable and will fit 1.25”, 1.5” and 1.75” belts. The soft loop itself mounts in a slot to allow infinite ride height adjustment within the slot envelope. The loop itself can be rotated to allow infinite cant adjustments forward and back. Once tightened down, little nibs in the strut face lock the loop in place and prevent movement. The Tuckable Soft Loop Set includes:
-Two Soft Loop straps
-Two polymer struts
-One Tall Spacer (for mounting the strut below the trigger guard)
-All needed hardware and instructions Made in the USA. Unconditional Lifetime Warranty. USA and APO Addresses only. No International shipping.]]>
1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-soft-loops-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-soft-loops-59.jpgRaven Concealment
https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-freya-magwell-r-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-freya-magwell-r-46.jpgcustom-itemoptacticalgear-pagestweliandmo108FREYA94.99Raven Concealment Freya Mag Well (R)Raven Concealment111See Chart for magazine capability. NOTE: 10-Round Glock Magazines will NOT fit. Magazine Well and mounting hardware only. Made in the USA. Unconditional Lifetime Warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-freya-magwell-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-freya-magwell-r-56.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-ar-mag-carrier-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-ar-mag-carrier-48.jpgcustom-itemoptacticalgear-pageracohoandac108ARSMCU49.99Raven Concealment Lictor AR Mag CarrierRaven Concealment111The Lictor M4 is ambidextrous, and works with rounds-forward and rounds-rearward magazine orientation. It has a slight "funnel top" to aid in guiding the magazine into the carrier. The Lictor M4 magazine carriers work with all common-issue AR-15/M-4 magazines (GI, PMag, Tango Down ARC, Lancer, etc). The design securely holds fully loaded magazines without the need for any retention screws, which are notorious for backing off gradually and falling out. The belt clip on the Lictor M4 allows the shooter to quickly don and doff the magazine carrier one-handed. The belt clip can be removed from the pouch, exposing mounting holes which are compatible with a variety of after-market belt attachments and MOLLE/PALS mounting adaptors. This provides end-users with an easy way adapt the carrier to a variety of applications on their body, a rifle stock, inside a bag, a vehicle, etc. This magazine carrier is equally suited for low-vis/CCW roles (like under a sport coat or untucked shirt) and overt roles, like being mounted on a war belt or plate carrier. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-ar-mag-carrier-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-ar-mag-carrier-61.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-g9-double-pistol-mag-carrier-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-g9-double-pistol-mag-carrier-45.jpgcustom-itemoptacticalgear-pagebemopipo108G9LPD49.99Raven Concealment Lictor G9 - Double Pistol Mag CarrierRaven Concealment111The Lictor G9 magazine carrier is ambidextrous and has relief cuts on the outboard face in order to facilitate rapid magazine access whether worn on the waistline or high up on a vest or plate carrier. The Lictor G9 magazine carrier is designed to accept mil-spec magazines from all of the “Big 3” modern service pistols (Glock 17/19/45, Sig M17/M18, and Beretta M9), and also happens to fit a variety of other popular commercial-market 9mm/.40 caliber pistols with similar magazine dimensions (such as the CZ P07, CZ-75, Beretta APX, Beretta PX4, Walther PPQ, and Springfield XD and XDM). The design securely holds two fully loaded magazines, and offers adjustable retention that can be dialed down for daily CCW or dialed way up for overt use on armor carriers without the need for flaps or bungies. The belt clip on the Lictor G9 allows the shooter to quickly don and doff the magazine carrier one-handed. The belt clip can be removed from the carrier, exposing mounting holes which are compatible with a variety of after-market belt attachments and MOLLE/PALS mounting adaptors. This provides end-users with an easy way adapt the carrier to a variety of applications on their body, inside a bag, a vehicle, etc. This magazine carrier is equally suited for low-vis/CCW roles (like under a sport coat or untucked shirt) and overt roles, like being mounted on a war belt or plate carrier. Made in the USA. 1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-g9-double-pistol-mag-carrier-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-g9-double-pistol-mag-carrier-58.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-holster-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-holster-59.jpgcustom-itemoptacticalgear-pageracohoandac108PX49.99Raven Concealment Perun HolsterRaven Concealment111Each holster includes three pair of 1.5” belt loops, which allows the end-user to configure the ambidextrous holster body for left-handed or right-handed use, with either a 0-degree or 10-degree cant. Retention in the Perun is crisp, defined, and consistent, thanks to innovative design features inside the holster body. Unlike other holsters that use the traditional “screw through a rubber grommet” style of retention, the Perun’s retention will not back off after repeated drawing and re-holstering. The Perun is compatible with most slide-mounted red-dot optics (like the Aimpoint T-1, Trijicon RMR, etc.) and accommodates suppressor-height front sights up to .350” tall. It is also fully compatible with the RCS Balor optic mount. The Glock Perun is compatible with generation 3-5 Glock pistol and all small frame 9mm, .40S&W, and .357sig Glocks.
Not compatible with large frame glocks like the Glock 21. The muzzle-end of the holster is rounded for comfort, yet has an opening sufficient to accommodate most common after-market extended and threaded barrels (with thread protectors). The opening at the muzzle is also specifically designed to allow foreign objects (like spent casings) to drop out the bottom so that nothing can block your pistol from being safely re-holstered. The ambidextrous holster body has both inboard and outboard full-height body shields. These body shields offer some protection for your pistol from sweat, as well as protecting your skin and cover garments (especially the thin material used for linings in sport coats and suit jackets) from being abraded by the serrations on the rear of the slide. They also enhance safety by helping keep cover garments and other foreign objects from falling into the mouth of the holster while you have your pistol drawn, and aid in proper, safe muzzle orientation during re-holstering. The holster is injection molded from a proprietary, extremely high-strength polymer blend that is significantly more durable than Kydex or Boltaron. Like all RCS products, it is made in the USA, and is backed by our lifetime warranty. Types:
• Glock 19
• Glock 17
• Sig P-320 Fullsize/M17/X5
• Sig P-320C/X-Carry/M18
• Glock 48 (Compatible with Victory First V43)
• Glock 43 and 43X
• M&P Shield *Legacy Phantom belt attachments are NOT compatible with the Perun holster. Made in the USA. Unconditional Lifetime Warranty.]]>
1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-holster-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-holster-72.jpgRaven Concealment
https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-lc-light-compatible-holster-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-lc-light-compatible-holster-55.jpgcustom-itemoptacticalgear-pageracohoandac108PXLC59.99Raven Concealment Perun LC Light Compatible HolsterRaven Concealment111Not compatible with large frame glocks like the Glock 21. The muzzle-end of the holster is rounded for comfort, yet has an opening sufficient to accommodate most common after-market extended and threaded barrels (with thread protectors). The opening at the muzzle is also specifically designed to allow foreign objects (like spent casings) to drop out the bottom so that nothing can block your pistol from being safely re-holstered. The ambidextrous holster body has both inboard and outboard full-height body shields. These body shields offer some protection for your pistol from sweat, as well as protecting your skin and cover garments (especially the thin material used for linings in sport coats and suit jackets) from being abraded by the serrations on the rear of the slide. They also enhance safety by helping keep cover garments and other foreign objects from falling into the mouth of the holster while you have your pistol drawn, and aid in proper, safe muzzle orientation during re-holstering. The holster is injection molded from a proprietary, extremely high-strength polymer blend that is significantly more durable than Kydex or Boltaron. Like all RCS products, it is made in the USA, and is backed by our lifetime warranty. Types:
• Sig P320F/M17/X5 with Surefire X300U
• Glock 19, 23, 32, 38, 45 , 19X with XC1-A/B
• Standard Frame Glock with Surefire X300U (A and B models), will fit up to Glock 34 length pistols including most "Roland Special" configurations
• Standard Frame Glock with Streamlight TLR1 HL, will fit up to Glock 34 length pistols including most "Roland Special" configurations *Legacy Phantom belt attachments are NOT compatible with the Perun holster. Made in the USA. Unconditional Lifetime Warranty.]]>
1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-lc-light-compatible-holster-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-lc-light-compatible-holster-68.jpgRaven Concealment
https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-qms-adaptor-kit-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-qms-adaptor-kit-43.jpgcustom-itemoptacticalgear-pageracohoandac108PXQMSSMP29.99Raven Concealment Perun QMS Adaptor KitRaven Concealment111Designed for Perun Holster models only. Not compatible with older model Raven Concealment Holsters and Carriers. NOTE: Quick Mount Straps require some break-in before they snap open and closed easily. Made in the USA. Unconditional Lifetime Warranty. QMS Adaptor Kit only; holster sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-qms-adaptor-kit-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-qms-adaptor-kit-56.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-holsters-and-accessories-60.jpgcustom-itemoptacticalgear-pageholstersRaven Concealment Systems Holsters and Accessories1racopehoracopelclicoracopeqmsadkeibakitandacracova2hofukracova2kitforacova2hoadkracova3licohracoliarmagcracocomacaracosykapima1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-holsters-and-accessories-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-holsters-and-accessories-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-systems-kari-pistol-magazine-carrier-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-systems-kari-pistol-magazine-carrier-18.jpgcustom-itemoptacticalgear-pageracohoandac108G9ACBK49.99Raven Concealment Systems Kari Pistol Magazine CarrierRaven Concealment1111https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-systems-kari-pistol-magazine-carrier-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-systems-kari-pistol-magazine-carrier-31.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-topstop-ar-upper-receiver-cover-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-topstop-ar-upper-receiver-cover-61.jpgcustom-itemoptacticalgear-pagem4arupreandp108TOPSTP14.99Raven Concealment TopStop AR Upper Receiver CoverRaven Concealment111The TopStop cover is designed to snap on most AR15 or M4 type upper receivers when they are detached from the lower receiver. The TopStop completely seals the upper reciever preventing fouling from getting in or out and it stops the bolt carrier group and charging handle from sliding out as the upper is moved around. The TopStop is made out of super tough polymer and is impervious to most solvents and chemicals. This product is perfect for storing or transporting your spare upper recievers, especially in low-profile bags where the rifle must be broken down to fit. Made in the USA. Unconditional Lifetime Warranty.1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-topstop-ar-upper-receiver-cover-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-topstop-ar-upper-receiver-cover-75.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-advanced-kit-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-advanced-kit-48.jpgcustom-itemoptacticalgear-pageracohoandac108VG2ADV49.99Raven Concealment Vanguard 2 Holster - Advanced KitRaven Concealment111Types:
-IWB Overhooks: Includes both 1.5-inch and 1.75-inch width Overhooks for quick attach and detachment from the belt.
-Soft Loop and Strut: adjustable for 1.25-inch, 1.5-inch and 1.75-inch width belts. Soft loop has infinite height adjustment for more precise ride height fit and can easily attach/detach from the belt. Please note that the VG2 Advanced kit is not compatible with the Basic Kit Strut or the Lanyard option. VG2 CLAWs are only compatibe with the model of VG2 shell specified. For example, a Glock VG2 CLAW will NOT fit a M&P VG2 holster shell. Please be aware, we do not advise attempting to re-holster the weapon while the VG2 is inside your clothing. You should remove the VG2 and install it on the weapon outside of your waistband. USA and APO Addresses only. No International shipping.]]>
1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-advanced-kit-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-advanced-kit-61.jpgRaven Concealment
https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-full-kit-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-full-kit-64.jpgcustom-itemoptacticalgear-pageracohoandac108VG2FULL39.99Raven Concealment Vanguard 2 Holster - Full KitRaven Concealment111Please be aware, we do not advise attempting to re-holster the weapon while the VG2 is inside your clothing. You should remove the VG2 and install it on the weapon outside of your waistband. Made in the USA. Unconditional Lifetime Warranty. NOTE - This item will NOT work with a Glock 42 or M&P Shield. USA and APO Addresses only. No International shipping.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-full-kit-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-full-kit-77.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-kit-for-sig-p365-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-kit-for-sig-p365-43.jpgcustom-itemoptacticalgear-pageracohoandac108VG2P365BKOH39.99Raven Concealment Vanguard 2 Kit for Sig P365Raven Concealment111Please be aware, we do not advise attempting to re-holster the weapon while the VG2 is inside your clothing. You should remove the VG2 and install it on the weapon outside of your waistband, which is easily done using the over-hook clip. Made in the USA. Unconditional Lifetime Warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-kit-for-sig-p365-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-kit-for-sig-p365-56.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-3-light-compatible-holster-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-3-light-compatible-holster-46.jpgcustom-itemoptacticalgear-pageracohoandac108VG354.99Raven Concealment Vanguard 3 - Light Compatible HolsterRaven Concealment111RCS has physically verified the fit of the X300U A and B on the following pistols. As a general rule, any Pistol + X300U A/B combination will fit as long as the distance between the muzzle end of the gun and the bezel end of the light is ¾” or more. Compatible pistol models:
Glock:

19/23/32, 17/22/31, 20/21/21sf, 29/30/30s/30sf, 37, 38
Smith&Wesson:
M&P Fullsize 9mm/.40cal, M&P45 Midsize, M&P45 Compact
Sig:
P226R/MK-25/P226 Navy, P228R, P229R, P220R, P320 Compact, P250, SP2022
H&K:
VP9 9mm/.40cal, P30, P2000, HK45, USP 9mm/.40cal (w/ aftermarket rail), USP Compact 9mm/.40cal (w/ aftermarket rail), USP45 (w/ aftermarket rail), USP45 Compact (w/ aftermarket rail)
Springfield Armory:
XD 9/49/45 4”bbl., XDm 9/40/45 4.5”bbl., XDm 9/40/45 3.8”bbl., XD MOD2 4”bbl.
FN:
FNP/X-45, FNP/X-9/40, FNS 9/40, FN Five Seven (w/ square trigger guard)
Beretta:
PX4 Storm 9mm, PX4 Storm .45cal
CZ:
P-07, P-01, CZ-75 SP-01 Phantom
Ruger:
SR-9, P95
Walther:
PPQ Gen 1&2 4”bbl., PPQ .45cal 4”bbl.
Steyr:
M9A1
1911 Pistols:
4.25” w/ rail, 4” w/ rail USA and APO Addresses only. No International shipping. NOTE - Thread Locker is needed on the mounting screws in order to maintain secure lock-up of mounting hardware and avoid loosening over time. Sur-Lok threadlocker is included with the holster.]]>
1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-3-light-compatible-holster-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-3-light-compatible-holster-59.jpgRaven Concealment
https://s.turbifycdn.com/aah/optacticalgear/rds-red-dot-sights-and-mounts-34.jpgcustom-itemoptacticalgear-pageopticsRDS Red Dot Sights, Magnifiers, and Mounts1sigsaro1xmmr1sigsaro1xmmraidurdsreddoaimit22moadoaiparioppavsbaorc1ait2moaraimimomk2arexpibaruntafamimoruntafaftcaimuntafacosemountafaqdleeohwsexreotechexps3runtafarirai3xmanomoreog33manomoreog43manomoreog45manomoreog33mareog43mareog45maruntafaftcommhrfconceptsamcgesuprt12seoknarcohirimoardeofopmobaardeofopbaplonehucohe11https://s.turbifycdn.com/aah/optacticalgear/rds-red-dot-sights-and-mounts-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/rds-red-dot-sights-and-mounts-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/dead-man-s-hand-shooting-deck-28.jpgcustom-itemoptacticalgear-pagetargets110RFDMHSD19.9918.49RE Factor Dead Mans Hand Shooting DeckRE Factor111demovideo1Designed to work with RE Factor IQ Targets, the Dead Man’s Hand Shooting Deck is the perfect way for shooters to learn how to “think before you shoot.” The deck features 52 different shooting drills that teach the shooter to recognize their target(s) before firing. The deck allows shooters to progress from simple drills (for beginners) to more advanced drills as they continue through the deck. Advanced shooters can also performed these drills with shooting timers for added stress. Each deck comes with an instruction guide, and metal case for easy storage in a range bag. 1https://s.turbifycdn.com/aah/optacticalgear/dead-man-s-hand-shooting-deck-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/dead-man-s-hand-shooting-deck-35.jpgRE Factorhttps://s.turbifycdn.com/aah/optacticalgear/re-factor-essentials-target-30.jpgcustom-itemoptacticalgear-pagetargets11021372.5RE Factor Essentials TargetRE Factor111Unlimited amount of shooting combinations
Designed to maximize range time
Made in the USA
This product is designed to be used specifically with RE Factor's Essentials Shooting Guide. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/re-factor-essentials-target-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/re-factor-essentials-target-40.jpgRE Factor
https://s.turbifycdn.com/aah/optacticalgear/re-factor-iq-target-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/re-factor-iq-target-49.jpgcustom-itemoptacticalgear-pagetargets110RFTGTIQ2.5RE Factor IQ TargetRE Factor111• Measures: 23" x 35"
• Unlimited amount of shooting combinations
• Pistol shapes measure 3″
• Rifle shapes measure 5″ This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/re-factor-iq-target-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/re-factor-iq-target-63.jpgRE Factor
https://s.turbifycdn.com/aah/optacticalgear/recondo-lrrp-vietnam-1960-s-51.jpgcustom-itemoptacticalgear-pagegearloadoutsRecondo / LRRP Vietnam 1960's1STABO harness
Rifle
SOI
FA kit
2 canteens
18 magazines
Swiss rope
Ground sheet
Map
Davron tablets
Knife
Mirror
Compass
Water purification
D-rings
Ruck
Towel
Poncho
Gloves (heavy)
Notebook
Snivel drugs Source: "Recondo: LRRPs in the 101st Airborne", Larry Chambers, (current edition 2003), Presidio Press]]>
1https://s.turbifycdn.com/aah/optacticalgear/recondo-lrrp-vietnam-1960-s-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/recondo-lrrp-vietnam-1960-s-50.jpg
https://s.turbifycdn.com/aah/optacticalgear/recovery-handler-user-guide-21.jpglink.spsyreha1https://s.turbifycdn.com/aah/optacticalgear/recovery-handler-user-guide-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/recovery-handler-user-guide-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/retention-lanyards-71.jpgitem.optacticalgear-pagebeltsRetention Lanyards1215geoprelaz215geoprelast3perela21https://s.turbifycdn.com/aah/optacticalgear/retention-lanyards-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/retention-lanyards-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/rigger-s-belts-trouser-belts-64.jpgitem.optacticalgear-pagebeltsRigger's Belts / Trouser Belts / Duty Belts1arhribevitacobefispasgunbea215geulribehsgidutybeltmegeleviaebemegeleshbemategunbeeloblintrbemoveeainbeforopgfisplionebeb1https://s.turbifycdn.com/aah/optacticalgear/rigger-s-belts-trouser-belts-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/rigger-s-belts-trouser-belts-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-45.jpgitem.optacticalgear-pagefigemiRite In The Rain / Data Books1riinradolosniperdatabookusmosndabotrnoratrnoraussnte215geopnoriinrawomeperiinrablinalriinraallwet1riinraallwetriinrashponoriinrahipponriinrafiribiriinraloleshriinratarecariinra25mezeriinra91al25riinra25meze2riinra25meze11https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-m16a2-m16a4-40.jpgitem.optacticalgear-pageriteinrain69912523.95Rite in the Rain 25 Meter Zeroing Target M16A2/M16A4Rite in the Rain111Soldiers have asked for it and now you have it! Zeroing target for the M16A2/M16A4 weapon printed on heavier “Rite in the Rain” tagstock. Shoot at it, get it wet, and write on it without worries. The tough sheets will survive the range and protect your valuable data. 8 1/2” x 11” Desert Tan sheets, sold in packs of 100. (2 lbs / pack)1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-m16a2-m16a4-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-m16a2-m16a4-49.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-mil-multipurpose-100-pack-24.jpgcustom-itemoptacticalgear-pageriteinrain69913023.95Rite In The Rain 25 Multipurpose Meter Zeroing Target - True-MILRite in the Rain111ALL-WEATHER PAPER Designed to zero mutliple platforms including military Laser/Illuminators. COLOR: Tan
SHEET SIZE: 8.5" x 11"
SHEETS: 100
WEIGHT: 100# heavyweight
INK COLOR: Black
IMPRINT: Multipurpose MIL 25 Meter Zeroing Target (front), blank (back)
WEAPONS: Applies to a variety of platforms, to be used with milliradian-adjusted optics and systems FEATURES
REFERENCE: Increment and direction of adjustment for common aiming devices
DESIGN: True-MIL grid is 12.5% more accurate than current military specs, developed by US Military Marksmanship experts
MANUFACTURED: U.S.A.]]>
1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-mil-multipurpose-100-pack-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-mil-multipurpose-100-pack-31.jpgRite in the Rain
https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-9126-all-weather-25-meter-zeroing-target-m4-pistol-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-9126-all-weather-25-meter-zeroing-target-m4-pistol-45.jpgcustom-itemoptacticalgear-pagetargets69912623.95Rite in the Rain 9126 All-Weather 25 Meter Zeroing Target M4/PistolRite in the Rain111 These targets are the new style Army zeroing target with Minute of Angle adjustment and designed to make it easier to zero different optics and sighting systems in one format. Short Range and Pistol Marksmanship target displayed on the front, and Graphic Training Aid/Offset Tool on back including information referencing M885A1 and M885 ammunition. Printed on waterproof heavy-duty 100# Rite in the Rain sheets, size 8 1/2" x 11". These tough sheets will survive the range! Tan sheets. Sold in packs of 100. 1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-9126-all-weather-25-meter-zeroing-target-m4-pistol-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-9126-all-weather-25-meter-zeroing-target-m4-pistol-58.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-all-weather-pen-metal-40.jpgitem.optacticalgear-pageriteinrain699716.95Rite in the Rain All Weather Pen - MetalRite in the Rain111Pencils work great on "Rite in the Rain". For those times when you need a pen, use the All-weather Pen. The ideal ball point pen for use outdoors, with its pressurized ink cartridge and permanent ink. Writes underwater and upside down, and it will write in all weather conditions, even temperatures as low as - 50 degrees F, fine point. Ink color: Black.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-all-weather-pen-metal-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-all-weather-pen-metal-49.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-dope-logbook-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-dope-logbook-45.jpgcustom-itemoptacticalgear-pageriteinrain69D7469.95Rite in the Rain DOPE LogbookRite in the Rain111Specifications: COVER
COLOR: Black
MATERIAL: Polydura, 19 gauge
REFERENCE: Wind effect chart, MIL and MOA rulers, conversion charts, imperial and metric rulers BINDING
STYLE: Wire-O
PROPERTIES: Rust-resistant
FINISH: Rounded corners ALL-WEATHER PAPER
COLOR: Gray
SHEET SIZE: 4" x 6"
PAGES: 104 pages / 52 sheets
WEIGHT: 20# Rite in the Rain
PERFORATED: No PAGE PATTERN
Pattern: D.O.P.E. Form (front), Universal (back)
INK COLOR: Dark gray
NUMBERED: No
TITLE PAGE: Yes ISBN: 978-1-60134-282-9 SIZE: 4" x 6.25" x .375"
WEIGHT: 0.21 lbs]]>
1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-dope-logbook-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-dope-logbook-58.jpgRite in the Rain
https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-field-ring-binder-44.jpgitem.optacticalgear-pageriteinrain69920014.95Rite in the Rain Field Ring BinderRite in the Rain111These are the perfect companion for the tactical loose leaf sheets. Durable poly cover protects your field notes. Overall size is 5 5/8" x 7 3/4". A Tough nylon zippered cover is now available.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-field-ring-binder-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-field-ring-binder-53.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-hip-pocket-notebook-41.jpgitem.optacticalgear-pageriteinrain699465.95Rite in the Rain Hip Pocket NotebookRite in the Rain111 4" x 6" spiral bound with Universal pattern. 50 sheets. Useful reference material is also printed on the back and inside covers.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-hip-pocket-notebook-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-hip-pocket-notebook-50.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-loose-leaf-sheets-41.jpgitem.optacticalgear-pageriteinrain6998215.95Rite in the Rain Loose Leaf SheetsRite in the Rain111Loose Leaf Sheets have an oval six-hole punch to fit in a variety of binders. 4 5/8" x7". The Universal Grid sheets are great for notes and sector sketches. 100 sheets/pack. Binder not included.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-loose-leaf-sheets-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-loose-leaf-sheets-50.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-moa-multipurpose-25.jpgcustom-itemoptacticalgear-pageriteinrain69912923.95Rite In The Rain Multipurpose 25 Meter Zeroing Target - True-MOARite in the Rain111ALL-WEATHER PAPER COLOR: Tan
SHEET SIZE: 8.5" x 11"
SHEETS: 100
WEIGHT: 100# heavyweight
INK COLOR: Black
IMPRINT: Multipurpose MOA 25 Meter Zeroing Target (front), blank (back)
WEAPONS: Applies to a variety of platforms, to be used with milliradian-adjusted optics and systems FEATURES
REFERENCE: Increment and direction of adjustment for common aiming devices
DESIGN: True-MOA grid is 12.5% more accurate than current military specs, developed by US Military Marksmanship experts
MANUFACTURED: U.S.A.]]>
1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-moa-multipurpose-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-moa-multipurpose-32.jpgRite in the Rain
https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-shirt-pocket-notebook-41.jpgitem.optacticalgear-pageriteinrain699354.95Rite in the Rain Shirt Pocket NotebookRite in the Rain1113" x 5" spiral bound with Universal pattern. 50 sheets. Universal grid ruled, useful information printed on the inside covers.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-shirt-pocket-notebook-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-shirt-pocket-notebook-50.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-field-book-44.jpgitem.optacticalgear-pageriteinrain6998016.95Rite in the Rain Tactical Field BookRite in the Rain111All-Weather Tactical Field Books are 4 5/8" x 7 1/4". Pages have the Universal page pattern. Perforated sheets with universal grid pattern. Field-Flex cover, 160 pages including 16 pages of valuable tactical reference information. A Tough nylon zippered cover is now available.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-field-book-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-field-book-53.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-memo-book-41.jpgitem.optacticalgear-pageriteinrain699649.95Rite in the Rain Tactical Memo BooksRite in the Rain1113 1/2" x 6". Pages have the Universal page pattern. Field-Flex cover, 120 pages. Pages have universal grid pattern, useful information on the inside covers.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-memo-book-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-memo-book-50.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-reference-cards-41.jpgitem.optacticalgear-pageriteinrain699200-R11.95Rite in the Rain Tactical Reference Cards Rite in the Rain111The 4 5/8" x 7" Tactical Reference Cards are printed on sturdy Polydura sheets that fit into the Tactical Field Binders (.18 lbs/set). Card sets are available in Green or Tan and include 16 pages (8 card set) of reference material, including: · Tactical Missions Graphics · Classes of Supply · Sector Sketch Example · Evaluate a Casualty / First Aid · Attack Helicopter Capabilities · Call for Fire · Enemy Unit Symbols · Sector Sketch Preparation · Range Card Example · U.S.M.C. Troop Leading Steps · NBC-4 Report · Immediate CAS Report · 9 Line Medical Evac. Request · Friendly Unit Symbols · Standard Range Card Preparation · Troop Leading Procedures · Mortar/Artillery Capabilities · NBC-1 Report · Spot Report/Salute1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-reference-cards-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-reference-cards-50.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-work-ready-mechanical-pencil-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-work-ready-mechanical-pencil-17.jpgcustom-itemoptacticalgear-pageriteinrain69BK1516.95Rite in the Rain Work-Ready Mechanical PencilRite in the Rain111The #15 Pencil is built to be tough. From lead to eraser and everything in between, its durability makes it a worthy addition to any tool belt. Uses 1.3mm lead - one pack of 12 leads included, refills sold separately1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-work-ready-mechanical-pencil-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-work-ready-mechanical-pencil-30.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-fighter-t-shirt-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-fighter-t-shirt-45.jpgcustom-itemoptacticalgear-pagetshirts131TREXTS25Road Sqdn T-Rex Wing Fighter T-ShirtRoad Sqdn111 The item speaks for itself, a simply incredible design... Printed on a comfortable Gildan Softstyle 100% Cotton T-Shirt. Regular Fit.1https://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-fighter-t-shirt-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-fighter-t-shirt-58.jpgRoad Sqdnhttps://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-sticker-38.jpgcustom-itemoptacticalgear-pagestickers131TREXSK6Road Sqdn T-Rex Wing StickerRoad Sqdn111Features:
-Long-lasting printed vinyl sticker
-5" x 4.61"]]>
1https://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-sticker-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-sticker-47.jpgRoad Sqdn
https://s.turbifycdn.com/aah/optacticalgear/roger-s-rangers-1789-44.jpgcustom-itemoptacticalgear-pagegearloadoutsRoger's Rangers 178911Basic Load -Musket (clean as a whistle) -Hatchet (scoured) -Sixty rounds powder and ball ROGER'S RANGERS STANDING ORDERS: 1. Don’t forget nothing. 2. Have your musket clean as a whistle, hatchet scoured, sixty rounds powder and ball, and be ready to march at a minute’s warning. 3. When you are on the march, act the way you would if you were sneaking up on a deer. See the enemy first. 4. Tell the truth about what you see and what you do. There is an army depending on us for correct information. You can lie all you please when you tell other folks about the rangers, but don’t never lie to a ranger or officer. 5. Don’t never take a chance you don’t have to. 6. When we’re on march we march single file, far enough apart so no one shot can go through two men. 7. If we strike swamps, or soft ground, we spread out abreast, so it’s hard to track us. 8. When we march, we keep moving till dark, so as to give the enemy the least possible chance at us. 9. When we camp, half the party stays awake while the other half sleeps. 10. If we take prisoners, we keep ‘em separate till we have time to examine them, so they can’t cook up a story between ‘em. 11. Don’t ever march home the same way. Take a different route so you won’t be ambushed. 12. No matter whether we travel in big parties or little ones, each party has to keep a scout 20 yards ahead, 20 yards on each flank, and 20 yards in the rear, so the main body can’t be surprised and wiped out. 13. Every night you’ll be told where to meet if surrounded by a superior force. 14. Don’t sit down to eat without posting sentries. 15. Don’t sleep beyond dawn. Dawn’s when the French and Indians attack. 16. Don’t cross a river at a regular ford. 17. If somebody’s trailing you, make a circle, come back onto your own tracks, and ambush the folks that aim to ambush you. 18. Don’t stand up when the enemy’s coming against you. Kneel down, lie down, hide behind a tree. 19. Let the enemy come till he’s almost close enough to touch. Then let him have it and jump out and finish him up with your hatchet. Source: SH 21-76, Ranger Handbook.]]>1https://s.turbifycdn.com/aah/optacticalgear/roger-s-rangers-1789-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/roger-s-rangers-1789-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-skeletonized-mag-retention-smr-system-42.jpgcustom-itemoptacticalgear-page1ssprsmrskmarssprsmrmoadssprdussprsmrbeadssprhoexgrtcThis system can be adapted to quick-attach GRT pouches to PALS (MOLLE) webbing or Belts.1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-skeletonized-mag-retention-smr-system-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-skeletonized-mag-retention-smr-system-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-holster-extender-grt-compatible-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-holster-extender-grt-compatible-53.jpgcustom-itemoptacticalgear-pageholsters80HE-0002207.4111litogeretr1The newly designed hole pattern makes the Holster Extender compatible with Safariland, Blackhawk and G-Code holsters. With the included GRT-Belt, spacers, and screw kit, you will be able to get the standoff you need to make your preferred holster function properly. With a push of a button the Holster Extender gives the shooter three set drop positions to set their holster. (0", 1.5", 3") This distance can be critical for clearing the holster when wearing bulkier gear. Please note that selecting a color option from the drop down list corresponds to BOTH the GRT Belt Adapter as well as the Holster Extender. Black color features Black GRT Belt Mount and Grey Holster Extender. Made in the USA. GRT Belt Mount Included. ]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-holster-extender-grt-compatible-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-holster-extender-grt-compatible-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-m-ax-mount-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-m-ax-mount-52.jpgcustom-itemoptacticalgear-pageheliandac80MX002OC154.5111litosukminwhM-Ax Mount Only. Tailcap and Light Head sold separately. Mounts to the Ops-Core, Team Wendy, and Galvion Helmets For those that require a powerful helmet mounted flashlight during search operations, you will appreciate the maximum range of motion of the Multi-Axis Mount. Aim the light where you need it…done. Dubbed the M-Ax Mount, this compact assembly mounts to the Ops-Core, Team Wendy and Galvion Helmets and takes the flashlight up and above the helmet rail, nesting it in a low profile position. Features:
Mounts to the Ops-Core, Team Wendy, and Galvion Helmets
• Positions the flashlight up and above the helmet rail
• Lightweight, low profile design
• Small assembly with multi-axis range of motion
• Compatible with all SureFire® 3V and M300 components
• Compatible with all B.E. Meyers® KIJI components (newer gen models)
• Mount body holds 1 x CR123A Battery (not included) ]]>
1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-m-ax-mount-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-m-ax-mount-65.jpg
https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-manta-strobe-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-manta-stobe-r-42.jpgcustom-itemoptacticalgear-pageheliandac80MS-00XX219111• New stronger Hybrid Tailcap is a select mix of robust materials to optimize performance and increase reliability throughout the spectrum of an operator's environmental demands.
• Includes the Manta Strobe Webbing Adapter
• Zero overt light AD
• 100% user confidence in Infrared Mode with Vibrating feedback
• Intuitive One-handed operation
• Multiple Infrared and Overt LEDs generate an overlapping and omnidirectional light emission
• Curved base specifically for helmets
• Lightest weight and lowest profile in its power class - 2.12 oz. with battery
• Tool-less battery change out, 3V CR-123
• Downward (”Low”) facing Infrared Emitter (positive IFF for close in work with minimal glare)
• Upward (“High”) facing Infrared Emitters (multiple emitters delivering a peak IR signal for maximum distance)
• IPX8 = Manufacturer Rated – Waterproof 150’, Zero water penetration in Main Housing or Partitioned Battery Compartment
• Primary Overt LED/s are visible beyond the FAR105.19 requirement (3 Statute Miles) Made in the USA. Battery Sold Separately. THIS ITEM CAN SHIP TO APO ADDRESSES. It cannot ship international. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-manta-stobe-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-manta-stobe-r-49.jpg
https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-navboard-fliplite-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-navboard-fliplite-18.jpgcustom-itemoptacticalgear-pageradiopouchesXXNBFL0288.8111Features:
• Offering enhanced durability and performance
• Molded with impact modified Nylon
• Case agnostic - fits smart devices up to 3.5” W x 6.75” L x 0.6875” with or without case
• Enables users to utilize their preferred case
• Adjustable friction hinge
• Silicone smart device retention straps featuring internal ribbing to prevent the straps from peeling off the user’s smart device
• Bungee lock auto-stows out of the way and does not interfere while using a smart device
• Attaches to 4 x 2 MOLLE/PALS field via two mounting straps
• Rapid donning / doffing
• Integrated belly band slots ]]>
1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-navboard-fliplite-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-navboard-fliplite-30.jpg
https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-pull-tabs-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-pull-tabs-65.jpgcustom-itemoptacticalgear-pagemagpoup80PT-D601XX8.25111Bungees not included (made to use your current pouch bungees). Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-pull-tabs-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-pull-tabs-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-v-lite-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-v-lite-54.jpgcustom-itemoptacticalgear-pageheliandac80VL-X012V44.75111New programmable features to customized your V-Lite! The V-LiteTM is a versatile personal lighting/identification marker. A simple and intuitive alternative to chemical light sticks. One button to cycle through the preset functions, keeps it simple. Fully encapsulated to ruggedize the electronics, the flexible silicone body not only protects the good stuff inside but also conforms to curved surfaces. Mounting is made simple with the V-LiteTM sleeve, providing the operator with a Velcro-backed attachment system. Weighing in at a mere 0.8 ounces, it’s an unnoticeable addition to your helmet during routine operations and low-profile enough to reduce snag hazards during airborne operations. Use it in the field, at home or abroad; or slip it into PALS webbing. Programmable Settings: 5 settings available to allow the user to customize V-Lite functions. You can now choose constant or blink settings, multiple brightness settings, or a combination of these. Colors: Green, Red, IR Run-time: 120+ Hours (continuous)
* Run-times vary depending on frequency of use and duration of "ON" cycles
* Battery is not replaceable
Includes Plastic V-Lite sleeve with Velcro backing and Lanyard THIS ITEM CAN SHIP TO APO ADDRESSES. It cannot ship international. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-v-lite-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-v-lite-64.jpg
https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-blocs-1-quart-canteen-nalgene-gp-pouch-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-blocs-1-quart-canteen-nalgene-gp-pouch-59.jpgitem.optacticalgear-pagewabopo77B1QCNGP3935.49S.O. Tech BLoCS 1 Quart Canteen/ Nalgene/ GP Pouch S.O. Tech111Pouch only, sorry we can't get you the grenades, mags etc... Colors: Coyote, Ranger Green, Multicam(+$5)1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-blocs-1-quart-canteen-nalgene-gp-pouch-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-blocs-1-quart-canteen-nalgene-gp-pouch-73.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-extended-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-extended-62.jpgitem.optacticalgear-pagecobamanpumeb77SGB-X155139.99S.O. Tech Go Bag ExtendedS.O. Tech111The only thing worse than getting shot out of the sky or hit by an IED is knowing that you now have to get your kit and get the hell out of the area. Our Go-Bag was designed for Helicopter crews and Humvee personnel, so that in the event of a crisis, they could grab the bag on the way out of the vehicle. It fits perfectly in the spaces that exist in a Helicopter or Humvee, which are too small for a ruck, but could be a great storage site for an E & E bag. The options for this bag are endless. The Medics fit a roll-up stretcher in it, the Spec Op shooters use it for E & E kits, and when you're not shooting and moving, it's a great Bail-Out-Bag for your car, home or gym. Concealed Carry Device Bag
The tubular design gives a civilian look and masks large devices. Extended version is 3" longer and can be used as a concealed device bag. This extended version of the Go-Bag was designed as a covert carry option for the shooters who need a device close by, while still being low profile. This is the perfect system for 17.5" devices and the upper and lower components of a similar dev ice. This is perfect for contractor work where the principal understands the need for such devices, but the situation dictates a low profile signature. The outside has two pouches where you can store and assortment of mission related items. The inside has room for a Cordura® covered foam divider, the SO TECH Go Bag Insert (SGBI), sold separately - for a broken down device, or any other kit your mission dictates. NOTE: Coyote color is now the same as Tan 499, a slightly more gray color that is made to better blend with Multicam.]]>
1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-extended-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-extended-75.jpgS.O. Tech
https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-61.jpgitem.optacticalgear-pagecobamanpumeb77SGB-NP160144.99S.O. Tech Go-BagS.O. Tech111- A main compartment with double linked zippers (dimensions: 20' x 8' x 8')
- Internal hydration reservoir slot (canteen not included)
- 4 zippered flat side pockets for small items or documents
- 3 larger zippered external pockets (dimensions: 5.5' x 5' x 3')
- MOLLE/PALS attachment webbing on both sides
- Padded contour single shoulder strap with quick-ditch side locking buckle
- Shoulder attachment points and carrying handles on each end
- Made in the U.S out of military grade cordura cloth down to the webbing and fasteners to the demanding specifications of SO Tech's high standard of quality. NOTE: Coyote color is now Coyote Brown / Tan 498 (MARPAT Brown).]]>
1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-74.jpgS.O. Tech
https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-go-bag-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-go-bag-73.jpgitem.optacticalgear-pagecobamanpumeb77MGB130119.99S.O. Tech Mission Go Bag A1S.O. Tech111• Classic go bag for all occasions
• Shoulder strap included
• 2 rows of MOLLE across front
• Compression straps on both sides
• Front Velcro for morale patch
• 2 compartments
• 4 large interior pockets
• Side flaps can tuck away inside for briefcase carry
• Non Slip material on back
• Material: 500D Cordura® Nylon
• Dimensions: 12.5"x 14"x 3"
• 1.4lbs
• Lifetime Warranty
• Mission Go Bag Front Flap (sold separately) available for additional organization options
• Made in the USA NOTE: Coyote color is now the same as Tan 499, a slightly more gray color that is made to better blend with Multicam. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-go-bag-82.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-go-bag-83.jpgS.O. Tech
https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-marker-panel-orange-39.jpgitem.optacticalgear-pagesukiandtoMMP-O5.954.95S.O. Tech Mission Marker Panel - OrangeS.O. Tech111This is NOT a VS-17 Panel. 2 ft x 1 ft blaze orange signaling panel. Great for survival, evacuation, escape/evade kits. Made in the USA Highly visible from long distances. Extremely useful in signalling aircraft, helicopters, or any type of search and rescue units in rugged terrain. Dimensions: 2' x 1'1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-marker-panel-orange-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-marker-panel-orange-49.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/so-tech-recce-vest-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-recce-vest-37.jpgcustom-itemoptacticalgear-pagevests91RECCE-XX130119.99S.O. Tech Recce VestS.O. Tech111• 6 Fully adjustable straps
• Mesh support straps
• 5 Compartments (4 front pockets, 1 Rear pack)
• Dual closure options for smaller front pockets
• Lightweight design
• Elastic strap retention Dimensions:
• Rear Pack- 10" x 12" x 4.5"
• Large Front Pockets- 9.5" x 6" x 2.5"
• Smaller Front Pockets- 5" x 4" x 1.5" Material: 500D Cordura Nylon®, Elastic, Polymer Buckles, Heavy webbing, Made in the USA]]>
1https://s.turbifycdn.com/aah/optacticalgear/so-tech-recce-vest-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-recce-vest-47.jpgS.O. Tech
https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-viper-flat-ifak-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-40.jpgitem.optacticalgear-pageinmedpoipo77VFIFAK9585.49S.O. Tech VIPER Flat IFAK - A1S.O. Tech111• Accommodates SOF-IFAK Medical Contents
• Ambidextrous deployment
• Flex-Tab MOLLE attachment system for attaching to MOLLE/PALS Webbing (Patented)
• Flat design for ultra-thin profile and minimal weight
• Folding and overlapping flaps provide maximum utility and versatility
• Quick closure for movement with cinch strap
• Cinch strap can allow for IFAK to be hung around neck for hands free use
• Approximately same thickness as standard plate carrier for low profile
• When worn on lower back provides lumbar support
• Rides snug in case and will not dispense without deliberate side force by operator
• Front 2 x 2 Velcro® field for cross patch
• Overall Dimensions (empty): 8" x 6.5" x 1"
• Material: 500D Cordura® Nylon
• Lifetime Warranty
• Made in the USA, Berry compliant Medical contents not included]]>
1https://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-47.jpgS.O. Tech
https://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-basic-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-basic-71.jpgcustom-itemoptacticalgear-pageinmedpoipo91VFIFAK-B-XXX8879.99S.O. Tech Viper Flat IFAK - A1 LES.O. Tech111• Slimmer more compact than the full size Viper Flat IFAK
• Ambidextrous deployment
• Flex-Tab MOLLE attachment system (Patented)
• Now compatible with duty / riggers belts carry
• Flat design for ultra-thin profile and minimal weight
• Folding and overlapping flaps provide maximum utility and versatility
• Quick closure for movement with cinch strap
• Cinch strap can allow for IFAK to be hung around neck for hands free use
• When worn on lower back provides lumbar support
• Rides snug and will not dispense without deliberate side force by operator
• Approximately same thickness as standard plate carrier for low profile
• Front 2 x 2 Velcro® field for cross patch
• Overall Dimensions (empty): 7.5" x 7" x 1"
• Material: 500D Cordura® Nylon
• Lifetime Warranty
• Made in the USA, Berry compliant]]>
1https://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-basic-80.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-basic-81.jpgS.O. Tech
https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-arvn-pack-redux-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-arvn-pack-redux-44.jpgcustom-itemoptacticalgear-page72hourpacks77IRP-ARVN220S.O.Tech ARVN Pack ReduxS.O.Tech111• Updated 500D Nylon Cordura vs canvas
• Snap closure front 2 pockets for easier and faster access
• Hidden HDPE insert with foam backer for extra comfort
• Updated frame, from steel to modern laser cut Tegris
• Repositioned bottom shoulder strap ring to the side for extra comfort ]]>
1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-arvn-pack-redux-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-arvn-pack-redux-58.jpgS.O.Tech
https://s.turbifycdn.com/aah/optacticalgear/safariland-6360-universal-ride-belt-loop-with-qls-22-receiver-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6360-universal-ride-belt-loop-with-qls-22-receiver-38.jpgcustom-itemoptacticalgear-pagesahoandac436070UBL-55-MS225039.99Safariland 6070 Mid-Ride Universal Ride Belt Loop with QLS 22 ReceiverSafariland111litocolegstThis item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. This Universal Mid Ride Belt Loop includes a QLS 22 Receiver to attach to a QLS 19 Fork. It is constructed from polymer materials and can be used by both right and left handed shooters. Designed to work in conjunction with the Safariland 6354DO ALS Optic Tactical Holster, sold separately. Universal Belt Loop features 2.25 inch wide belt slots. Features a small rectangular cut at the top for using a zip-tie to secure tighter against 1.75 or 1.5 inch width belts as needed.]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-6360-universal-ride-belt-loop-with-qls-22-receiver-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6360-universal-ride-belt-loop-with-qls-22-receiver-48.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-6075-low-ride-universal-ride-belt-loop-with-qls-22-receiver-37.jpgcustom-itemoptacticalgear-pagesahoandac436075UBL5039.99Safariland 6075 Low-Ride Universal Ride Belt Loop with QLS 22 ReceiverSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. This Universal Low-Ride Belt Loop provides 1.5 inches of drop down length and includes a QLS 22 Receiver to attach to a QLS 19 Fork. It is constructed from polymer materials and can be used by both right and left handed shooters. Designed to work in conjunction with the Safariland 6354DO ALS Optic Tactical Holster, sold separately. Universal Belt Loop features 2 inch wide belt slots. Features a small rectangular cut at the top for using a zip-tie to secure tighter against 1.75 or 1.5 inch width belts as needed. ]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-6075-low-ride-universal-ride-belt-loop-with-qls-22-receiver-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6075-low-ride-universal-ride-belt-loop-with-qls-22-receiver-46.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-6354do-available-soon-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6354do-31.jpgcustom-itemoptacticalgear-pagesahoandac436354DO-83-701-MS19182.5154.99Safariland 6354DO ALS Red Dot Holster with QLS 19 Fork Safariland111lito60miunriThis item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. NOTE: Depending on where your Micro Red Dot Sight is mounted to the slide of the pistol, you may be required to trim material from the holster in order to ensure proper fit and retention of the pistol. This usually applies if you have rear ironsight behind the red dot. This includes "Roland Special" configurations. The Safariland® 6354DO ALS® Red Dot Holster w/Tactical Lights features a Cordura® wrap that both limits the infrared signature and provides a unique finish. This holster has a compact profile for minimal interference with other equipment - perfect in a tactical environment. This Safariland 6354DO ALS® Optic Tactical Holster has a Safariland QLS 19 Locking Fork attached for use with a QLS22/22L Receiver Plate (sold separately). ALS retention is an open-top design that is drawn with a natural thumb only operation; no fingers in trigger guard area. This model can also be used in conjunction with the model 6006 ALS Guard for increased security. Safariland 6354DO ALS Optic Tactical Holster Features:
• ALS® (Automatic Locking System) secures weapon once holstered
• Simple straight up draw once release is deactivated
• Open-top design without SLS for quick retrieval of weapon
• For use with red dot optic-equipped weapons
• Cordura® nylon-wrap finish reduces Infrared (IR) Signature
• SafariLaminate™ thermal-molded construction protects handgun and sights
• QLS 19 Locking Fork (Requires QLS 22 Receiver Plate to mount to belts, sold separately)
• Suede lined to protect handgun's finish
• Cordura Colors: MultiCam® and Coyote Brown
• Available for Glock 19, 17, 22, 34, 35 weapons with tactical lights and the Glock 19 "Roland Special" Models: also compatible with Gen 5 Glock pistols EXCEPT the Glock 22/23 Gen 5
Weapon Light Models add $13.00
• Model 83: Glock 17, 22 (will Fit Glock 19 as well)
• Model 283: Glock 19, 23
• Model 2832: Glock 19, 19C, 23, 23C, w/ TLR-1, SureFire X200, X300, X300U; Inforce APL Gen 3, Insight XTI Procyon (NOTE: Gen 5 Glock 23 will NOT fit due to thicker slide width)
• Model 832: Glock 17, 22 w/ TLR-1 OR SureFire X200 X300, X300U (NOTE: Gen 5 Glock 22 will NOT fit due to thicker slide width)
• Model 6832: Glock 34, 35 w/ TLR-1 OR SureFire X200, X300, X300U, Will fit Roland Special Glock 19 with KKM Barrel/Compensator and SureFire X300 Ultra NOTE: Depending on where your Micro Red Dot Sight is mounted to the slide of the pistol, you may be required to trim material from the holster in order to ensure proper fit and retention of the pistol. This usually applies if you have rear ironsight behind the red dot. This is includes "Roland Special" configurations.]]>
1https://s.turbifycdn.com/aah/optacticalgear/safariland-6354do-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6354do-38.jpgSafariland
https://s.turbifycdn.com/aah/optacticalgear/safariland-6378-available-soon-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6378-31.jpgcustom-itemoptacticalgear-pagesahoandac1256378149.25104.99Safariland 6378USN ALS Low Signature HolsterSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The Model 6378USN features the Automatic Locking System (ALS®). Once the weapon is holstered, it locks into place, providing an extra measure of security from the standard open top holsters. A simple straight draw is possible once the ALS® is deactivated by your thumb while obtaining shooting grip. IDPA approved. The Model 6378USN features an all new injection molded paddle design that is highly concealable and rides close to the body with a slightly forward weapon cant. Additionally it features suede lining to help protect the gun's sights and finish. Its SafariLaminate™ structure with wraparound design provides the strongest design combination. Holster includes both Belt Slide and Paddle mounting options. Holster will also mount to the Safariland Mid-Ride Universal Belt Loop (sold separately). Features
-ALS® (Automatic Locking System) secures weapon once holstered; simple straight up draw once release is deactivated
-Reduces Infrared (IR) Signature Compact profile for minimal interference with other equipment
-ALS® retention is an open-top design that is drawn with a natural thumb only operation; no fingers in trigger guard area
-Genuine Safarilaminate™ thermal-molded construction with suede lining to help protect the guns finish
-Includes both Belt Slide and also Paddle mounting options OPT only sells specific models and colors of the 6378USN. Models:

(283) Glock 19, 19C, 23, 23C, 25, 32, 26, 27, 33, 28, 36 (2832) Glock 19, 19C, 23, 23C, w/ TLR-1, SF X200, X300, X300U; Inforce APL Gen 3, Inforce APL Compact Glock, Insight XTI Procyon This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-6378-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6378-38.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-model-6390-als-mid-ride-level-i-retention-duty-holster-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-model-6390-als-mid-ride-level-i-retention-duty-holster-45.jpgcustom-itemoptacticalgear-pagesahoandac43390151.5122Safariland 6390 ALS Mid-Ride Level I Retention Duty HolsterSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. This model features the STX Tactical finish, a thermoplastic alloy thermoformed around the firearm at close tolerances for an exact fit. This hard shell finish is renowned for its incredible strength and abrasion resistance. Exceptionally easy to clean and maintain. The Safariland® 6390 holster is a popular mid-ride duty holster with the added security of ALS® (Automatic Locking System), which provides Level I Retention™ without inhibiting the draw stroke. The ALS engages immediately upon holstering, but releases quickly and easily with a swipe of the thumb during the draw. Constructed from durable SafariLaminate™, the Model 6390 holster has a suede lining to protect your firearm’s finish. The mid-ride design carries comfortably and includes a removable Hood Guard to protect the thumb release. A variety of textures and finishes make it easy to match the 6390 holster to your duty belt, and adding the ALS Guard allows the user to upgrade the holster to Level II Retention. ALS "Chop Block" Guard is removable if not desired. Designed to mount on 2 inch duty belts. Works perfect with the Blue Force Gear, Velocity Systems, HSGI, Viking Tactics, and ATS War Belts. OPT only sells specific models and colors of the 6390. We may be able to do custom orders, please email us with your needs and we will get back to you about availability. For ordering purposes: SF=SureFire
CL=Classic
IT=Insight
SL=Streamlight Please note: The M3 and M6 are not the same as the M3X or M6X, do not assume cross compatibility of these lights. Modifying holsters with a heat gun works well, but will void manufacturer's warranty. Weapon Model Types: (83) Glock 17, 17C, 22, 22C, 31 (283) Glock 19, 19C, 23, 23C, 25, 32, 26, 27, 33, 28, 36 (832) Glock (All Gens) 17, 22 w/ ITI/SL M3, TLR-1, TLR1HL, SF X200, X300, X300U (+$13.50) (2832) Glock (All Gens) 19, 19C, 23, 23C, 25, 32, 32C w/ SF X200, X300, X300U, TLR-1, TLR-1 HL, M3, Insight XTI Procyon (+$13.50) (7742) Sig Sauer P220R, P226R, DASA/ DAK w/ ITI M3, TLR-1, TLR-1HL, SF X200, X300, X300U, Insight XTI Procyon, RETAINS WEAPON WITH OR WITHOUT LIGHT (+$13.50) (4502) Sig Sauer P320, P250 (9/40), w/ ITI M3, TLR-1, TLR-1HL, SF X200, X300, X300U (+$13.50) (450) Sig Sauer P320 P320 (9mm, 40) This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/safariland-model-6390-als-mid-ride-level-i-retention-duty-holster-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-model-6390-als-mid-ride-level-i-retention-duty-holster-55.jpgSafariland
https://s.turbifycdn.com/aah/optacticalgear/safariland-6395rds-als-low-ride-duty-holster-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6395rds-als-low-ride-duty-holster-53.jpgcustom-itemoptacticalgear-pagesahoandac436390RDS188156.99Safariland 6390RDS ALS Red Dot Mid-Ride Duty HolsterSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The 6390RDS holster is specifically designed for firearms with red dot sights mounted to them.This open top holster features the Automatic Locking System (ALS®), an internal locking device that retains the weapon in all directions with no straps or snaps to manipulate. Once the weapon is holstered, it locks into place. The holster is completely operable with the thumb and once the ALS® is deactivated a simple straight up draw is used. Features a low-ride belt loop that rides close to the body, and has a suede lining to protect the gun's sights and finish. Compatible Optics: Other models/brands may work, but have not been tested
• Trijicon RMR
• Deltapoint Series
• JP JPoint
• Aimpoint ACRO (Clam Shell Cover may not close all the way; it can be removed if needed)
• Vortex Viper
• Burris Fastfire Features:
• ALS® (Automatic Locking System) secures weapon once holstered
• ALS Chop Block Guard to prevent unauthorized access to the ALS. The Guard can be removed if not desired
• Clam Shell cover designed to protect the red dot from water and debris. Cover pops open during the draw. Cover can be removed if not desired.
• SafariLaminate™ thermal-molded construction protects handgun and sights
• 6070 UBL Mid Ride Mount clears body armor and gear for an easier draw
• Suede lined to protect handgun's finish Models: Glock options compatible with Gen 1-5 Glock pistols EXCEPT the Glock 22/23 Gen 5
Model 2832: Glock 19, 19C, 23, 23C, w/ TLR-1, TLR-1HL, SureFire X200, X300, X300U; Inforce APL Gen 3, Insight XTI Procyon (NOTE: Gen 5 Glock 23 will NOT fit due to thicker slide width)
Model 832: Glock 17, 22 w/ TLR-1, TLR-1HL, SureFire X200, X300, X300U, X300V (NOTE: Gen 5 Glock 22 will NOT fit due to thicker slide width)
Model 6832: Glock 34, 35 w/ TLR-1, TLR-1HL, SureFire X200, X300, X300U, X300V. Will fit "Roland Special" Glock 19 with KKM Barrel/Compensator and SureFire X300 Ultra weapon light
Model 4502: Sig P320, P320RX w/ TLR-1, TLR-1HL, SureFire X300U, X300V
Model 1582: STI Staccato P 4.4-inch w/ TLR-1, TLR-1HL, SureFire X300U, X300V (Can Fit Staccato C2 DUO with Light Attached, TEST BEFORE USE ON DUTY) Finish Options:
• STX Tactical finish: Dark Earth or Black models; hard shell finish that's easy to clean and maintain.
• Cordura finish: (Add $51.00) Multicam, Coyote Brown, Ranger Green, and Black models; reduces Infrared (IR) Signature.]]>
1https://s.turbifycdn.com/aah/optacticalgear/safariland-6395rds-als-low-ride-duty-holster-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6395rds-als-low-ride-duty-holster-65.jpgSafariland
https://s.turbifycdn.com/aah/optacticalgear/safariland-cubl-cantable-universal-belt-loop-32.jpgcustom-itemoptacticalgear-pagesahoandac436070CUBL26.520.99Safariland CUBL Cantable Universal Belt LoopSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The Cantable Belt Loop (CUBL) allows the user to choose the cant position on their holster based on their preference. Extremely adaptable, the CUBL integrates with Safariland UBL products and 3-hole patterned holsters. Features:
• Allows for forward and rearward cant including straight drop with most compatible duty holsters
• Mid-Ride Height
• For use with Safariland 3-hole patterned duty holster
• Passes Retention pull test
• QLS compatible
•2-inch belt loop width for better fit on 1.75-inch rigger belts / gun belts Color: black]]>
1https://s.turbifycdn.com/aah/optacticalgear/safariland-cubl-cantable-universal-belt-loop-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-cubl-cantable-universal-belt-loop-41.jpgSafariland
https://s.turbifycdn.com/aah/optacticalgear/safariland-holsters-and-accessories-76.jpgitem.optacticalgear-pageholstersSafariland Holsters and Accessories1sa63sa63alsloduh1safariland6378samo63alsmiltrnocomohoadtrnocomhalegel10ritqcahootdealsnubmootdeslsnubmosacucaunbelosavuvebelosa63un2midrisa60lounribesaqls19duholsaqlqudureplsasilegstsaublmiunbelssprhoexgrtc1https://s.turbifycdn.com/aah/optacticalgear/safariland-holsters-and-accessories-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-holsters-and-accessories-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-qls-19-duty-holster-locking-fork-25.jpgcustom-itemoptacticalgear-pagesahoandac436004-1918.514.49Safariland QLS 19 Duty Locking ForkSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The QLS 19 Locking Fork mounts directly to the back of any Safariland® 2-hole pattern pouch or 3-hole pattern holster. The combination can then be connected to either the QLS 22 or QLS 22L Receiver Plate. Use with either of these receiver plates allows for quick transfer of holster between attachment points such as a belt loop, tactical leg shroud or other stable mounting platform. The QLS fork and plate combination passes the Level I Retention™ pull test. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-qls-19-duty-holster-locking-fork-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-qls-19-duty-holster-locking-fork-32.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-qls22-quick-duty-receiver-plate-25.jpgcustom-itemoptacticalgear-pagesahoandac436004-2223.518.49Safariland QLS 22 Quick Duty Receiver PlateSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The QLS 22 Receiver Plate is designed to accept the QLS 19 Locking Fork. Constructed of injection molded nylon, it screws onto mounting platforms such as a tactical leg shroud, belt loop, wall or any other stable location. The system (fork and plate) works with any Safariland® 2-hole pattern pouch or 3-hole pattern holster. Rearrange gear quickly and easily without the use of tools. The QLS fork and plate combination passes the Level I Retention™ pull test. QLS 19 Locking Fork sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-qls22-quick-duty-receiver-plate-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-qls22-quick-duty-receiver-plate-32.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-single-leg-strap-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-single-leg-strap-47.jpgcustom-itemoptacticalgear-pagesahoandac1253004-12822.4Safariland Single Leg StrapSafariland111lito60ublmimThis item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Single Leg Strap for use with the Safariland Universal Belt Loop (UBL) Mount to stabilize the holster and prevent torque when drawing the pistol. This is the same strap found on Safariland Leg Shrouds. Leg Strap only, accessories sold separately. ]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-single-leg-strap-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-single-leg-strap-60.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-ubl-mid-ride-universal-belt-loop-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-ubl-mid-ride-universal-belt-loop-47.jpgcustom-itemoptacticalgear-pagesahoandac436070UBL26.520.99Safariland UBL Mid-Ride Universal Belt LoopSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The 6070UBL Universal Belt Loop is contoured and angled to prevent pinching or pressure along the hip bone, locks onto the duty belt with belt slot design, and is compatible with any Safariland holster with the 3-hole pattern. This mount can be used in conjunction with Safariland 6354DO and 6378USN Model Holsters. 2 inch wide belt slots. Features a small rectangular cut at the top for using a zip-tie to secure tighter against 1.75 or 1.5 inch width belts as needed, or to use in conjunction with the P-2200 Belt Loop Insert. Includes screws and wrench for mounting.]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-ubl-mid-ride-universal-belt-loop-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-ubl-mid-ride-universal-belt-loop-60.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-vubl-vertical-belt-loop-32.jpgcustom-itemoptacticalgear-pagesahoandac43VUBL51.539.99Safariland VUBL Vertical Belt LoopSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. For added comfort and the ability to easily position a holster based on preference, Safariland is introducing the new Vertical Universal Belt Loop (VUBL) with a quick 3-position height adjustment. Compatible with any Safariland 3-hole patterned duty holster, the VUBL allows the user to quickly raise or lower their holster without any tools required. With the VUBL, a user can comfortably position their holster to sit in a Low-ride, Mid-ride or Hi-ride holster height position and will not pinch or add pressure to the hip bone. The VUBL passes the Retention™ pull test and locks onto any duty belt with a belt slot design. Features:
• For use with Safariland 3-hole patterned holsters
• Passes Retention pull test
• Quick 3-position height adjustment
• Adjustable for Cant/Angle of the Holster
Fits belt width up to 2-inches]]>
1https://s.turbifycdn.com/aah/optacticalgear/safariland-vubl-vertical-belt-loop-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-vubl-vertical-belt-loop-41.jpgSafariland
https://s.turbifycdn.com/aah/optacticalgear/salomon-footwear-143.jpgcustom-itemoptacticalgear-pagefootwearSalomon Footwear1saxafomidgtxsaxafomid20m2saspas2saspas2gtxsaxulfomidgtsaspcr6fosaxafogtxlowsaquprfogosaqu4dfosafoguar67cosaurjuulbo1https://s.turbifycdn.com/aah/optacticalgear/salomon-footwear-141.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-footwear-142.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-quest-4d-forces-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-quest-4d-forces-73.jpgcustom-itemoptacticalgear-pageassaultboots68381595259.95Salomon Quest 4D GTX Forces 2 ENSalomon111sizechart32• Weight: approx 665g / 23.5 oz (size dependent)
• Midsole Height: 29mm/17mm (12mm drop) Features:
• Anti-debris Mesh
• Full Grain Leather
• Medial protective pad
• High-cut profile for increased ankle support, stability and protection
• Gusseted Tongue: Material bridge connects tongue to the upper eliminating debris from entering the shoe.
• An abrasion resistant lining that allows for excellent breathability and quick drying.
• ISO 20344:2011: Puncture-resistant material added to the outsole prevents sharp objects from penetrating the bottom of the shoe.
• ISO 2419:2012: 2.0mm thick leather for increased durability.
• GORE-TEX® performance comfort footwear keeps your feet dry -from the outside as well as from the inside.
• Salomon's Contagrip® outsoles delivering optimal traction on varied surfaces
• Protective rubber heel cap
• Mud guard protective material all around the base of the shoe
• 4D advanced chassis for foot control and protection with active comfort
• Non-reflective materials
• breathable GORE-TEX water proofing THE CHOICE OF US ARMY SPECIAL OPERATIONS FORCES! Size Chart: See below for Link. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/salomon-quest-4d-forces-82.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-quest-4d-forces-83.jpgSalomon
https://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-47.jpgcustom-itemoptacticalgear-pagesafo68L41591500159.99Salomon Speed Assault 2Salomon111• With lightweight, quick-drying materials and a welded construction, this shoe won’t weigh you down or stay wet for long. All-terrain grip
• Packed with strategic chevron lugs, the durable Contagrip® outsole ups the traction on any terrain. Ankle support
• The protective mid cut wraps the ankle for extra support and stability when moving fast in loose terrain. Mud Contagrip®
• Built for maximum grip on loose, soft, rugged, and uneven surfaces, Mud Contagrip® uses deep, sharp lugs made from a compound that focuses on adhesion. Welded upper
• Stitch-free upper construction provides a smooth, glove-like, fit and feel. Quicklace
• Minimalistic and strong lace for one-pull tightening. Easy-on, easy-off. Chevron lugs
• Lug design with deep penetration and multi-directional grip, improving traction on soft surfaces like mud or loose dirt. EnergyCell
• A high performance EVA foam that provides shock attenuation. Anti-debris Mesh
• Tight mesh that prevents debris from being trapped between your foot and the footbed. Lycra®
• Stretch material provides a secure, comfortable fit. Non-reflective materials
• Built to be discrete and non-reflective for Tactical use. Ripstop fabric
• Woven fabrics, often made of nylon, with reinforcement to resist tearing, ripping and abrasion. Single layer Mesh
• A single layer of Mesh, close to the foot, for maximum feel. Textile lining
• A soft, breathable lining for extreme comfort. Gusseted tongue
• The tongue is connected to the upper on both sides, preventing debris from entering the shoe, and keeping the tongue centered. Lace pocket
• Provides easy storage for the Quicklace™ lacing system. Soft collar construction
• A soft collar improves comfort and creates a more ergonomic feel. Protective mudguard
• A wrap of leather, synthetic or rubber around the base of the foot that protects the lateral and medial sides of the foot. Molded OrthoLite® sockliner
• Molded to match the contours of your foot, this OrthoLite® insole provides superior cushioning, breathability and durability, to upgrade the comfort and performance of your shoe. Specs:
• Upper: Textile / Synthetic
• Drop: 6.5 in mm
• Heel stack height: 26.9 mm
• Forefoot stack height: 20.4 mm
• Weight: 320 g This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-60.jpgSalomon
https://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-gtx-13.jpgcustom-itemoptacticalgear-pagesafo68L47440300180Salomon Speed Assault 2 - GTXSalomon111• With lightweight, quick-drying materials and a waterproof construction, this shoe won't weigh you down or get wet inside. ALL TERRAIN GRIP
• Packed with strategic chevron lugs, the durable Contragrip outsole ups the traction on any terrain. ANKLE SUPPORT
• The protective mid wrap cuts the ankle for extra support and stability when moving fast in loose terrain.
• Weight: 11.64 oz (330 g)
• Lacing system: Quicklace
• Waterproofness: GORE-TEX
• Lining: Textile
• Inlay sole: Textile
• Outsole: Rubber
• Upper: Textile / Synthetic]]>
1https://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-gtx-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-gtx-21.jpgSalomon
https://s.turbifycdn.com/aah/optacticalgear/salomon-speed-cross-6-forces-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-cross-6-forces-47.jpgcustom-itemoptacticalgear-pagesafo68L47161200144.95Salomon Speed Cross 6 ForcesSalomon111Grip
An updated outsole means these Speedcross shed the mud quicker and deliver an even better grip on wet surfaces. Fit
Featuring Sensifit construction for precise, optimal foothold, and classic Speedcross comfort. Comfort
If it isn’t broke, don’t mess with it. Featuring the same level of classic, reassuring Speedcross comfort, with an EnergyCell+ midsole compound and welded, foot-hugging upper
Features OUTSOLE: Mud Contagrip®
Built for maximum grip on loose, soft, rugged, and uneven surfaces, Mud Contagrip® uses deep, sharp lugs made from a compound that focuses on adhesion. MIDSOLE: EnergyCell™+
EnergyCell™+ is a high-rebound midsole compound that provides exceptional energy return along with substantial cushioning and durability. SUSTAINABILITY: Recycled material
Materials made from recycled products such as PET bottles or material waste UPPER MATERIAL: Anti-debris Mesh
Tight mesh that prevents debris from being trapped between your foot and the footbed. UPPER MATERIAL: Ripstop fabric
Woven fabrics, often made of nylon, with reinforcement to resist tearing, ripping and abrasion. LACING SYSTEM: Quicklace™
Minimalistic and strong lace for one-pull tightening. Easy-on, easy-off. Details
Drop: 10 in mm
Heel stack height: 32 mm
Forefoot stack height: 22 mm
Weight: 262 g (9.24 ounces)
Waterproofness: None This Item is Excluded from Limited Sale Coupon Codes ]]>
1https://s.turbifycdn.com/aah/optacticalgear/salomon-speed-cross-6-forces-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-cross-6-forces-60.jpgSalomon
https://s.turbifycdn.com/aah/optacticalgear/salomon-x-ultra-forces-mid-gtx-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-x-ultra-forces-mid-gtx-17.jpgcustom-itemoptacticalgear-pagesafo68L47194900189.95Salomon X Ultra Forces Mid GTXSalomon111sizechart5Features:
Agility: Drawing on our trail-running expertise, this shoe feels light and agile, even on unpredictable terrain. Stability: The Advanced Chassis™ targets articulations on the outer foot to optimize stability without limiting mobility. All-Terrain Grip: An All-Terrain Contagrip® outsole grabs the ground, even when wet or slippery, providing excellent control. CHASSIS: Advanced Chassis™ is a molded insert embedded in the outsole. Providing strong lateral support and reassuring protection, it also delivers optimal mobility and flexibility. UPPER CONSTRUCTION: Active Support; These mobile wings help hold the foot in place and accompany its movement, adapting to its shape and volume. OUTSOLE: Chevron lugs; Lug design with deep penetration and multi-directional grip, improving traction on soft surfaces like mud or loose dirt. LACING SYSTEM: Quicklace™; Minimalistic and strong lace for one-pull tightening. Easy-on, easy-off. MEMBRANE: GORE-TEX keeps your feet dry -from the outside as well as from the inside. Inlay sole: Textile Lining: Textile Outsole: Rubber Upper: Leather / Synthetic Drop: 11 in mm Heel stack height: 32 mm Forefoot stack height: 21 mm Weight: 420 g Lacing system: Regular laces Waterproofness: GORE-TEX See below for link to Size Chart. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/salomon-x-ultra-forces-mid-gtx-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-x-ultra-forces-mid-gtx-30.jpgSalomon
https://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-gtx-low-cut-2020-model-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-gtx-low-cut-2020-model-45.jpgcustom-itemoptacticalgear-pageassaultboots68L409216179.95Salomon XA FORCES GTX Low CutSalomon111sizechart13New Model is now TAA Compliant and features Puncture and Oil/Slip Resistant soles, with Anti-static to meet ISO 20347:2012 Standards. The Salomon XA FORCES GTX is a lightweight, all conditions tactical shoe for moving fast on duty or on mission. Based on Salomon's iconic XA PRO 3D, this Forces model is more durable in every way, and has a beefier outsole. Features:
• Weight: 477g | 16,8 oz (SIZE US 9)
• Stack Height: 21mm/11mm (10mm drop)
• Contagrip MD Outsole Construction
• Midsole: Dual density midsole - EnergyCell
• Chassis: 3D Advanced Chassis
• Upper Material: Anti-debris Mesh, Non-reflective materials. PU coated leather, Single layer Mesh, Waterproof materials
• Upper Construction: Gusseted tongue, Lace pocket, Protective toecap, SensiFit
• Lining Material: Mesh and textile lining
• GORE-TEX breathable water-proof liner
• Quicklace System See below for link to Size Chart. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-gtx-low-cut-2020-model-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-gtx-low-cut-2020-model-55.jpgSalomon
https://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-2020-model-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-2020-model-40.jpgcustom-itemoptacticalgear-pageassaultboots68L40978200199.95Salomon XA Forces Mid - Regular and Wide SizesSalomon111Now TAA Compliant and features Puncture and Oil/Slip Resistant soles, with Anti-static to meet ISO 20347:2012 Standards. Salomon XA Forces Mid is a breathable and lightweight duty boot designed for moving fast on target. Based on Salomon's iconic XA PRO 3D MID, this model is more durable and effective than its predecessor with improved materials and features. Improvements:
• Stronger upper materials
• Wider toe box
• Triple and double needle stitching for greater durability
• Revised instep for fast roping and climbing
• Single-layer construction reducing the overlapping of material
• More durable outsole with an extra layer and additional rubber with deeper lugs Features:
• Breathable Anti-debris mesh
• Non-reflective materials
• Stealth design & printings
• Highly abrasion resistant textile
• Protective rubber toe cap
• Mud guard
• Medial protective pad
• Quick Lace one-pull tightening. Easy-on, easy-off
• Heel foam
• Lace pocket "Garage"
• Gusseted tongue
• OrthoLite footbed See below for link to Size Chart. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-2020-model-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-2020-model-50.jpgSalomon
https://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-gtx-2020-model-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-gtx-2020-model-57.jpgcustom-itemoptacticalgear-pageassaultboots68L40921800219.95Salomon XA Forces Mid GTX - Regular and Wide SizesSalomon111Now TAA Compliant and features Puncture and Oil/Slip Resistant soles, with Anti-static to meet ISO 20347:2012 Standards. Salomon XA GTX Forces Mid GTX is a GORE-TEX Waterproof and lightweight duty boot designed for moving fast on target. Based on Salomon's iconic XA PRO 3D MID, this model is more durable and effective than its predecessor with improved materials and features. Improvements:
• Stronger upper materials
• Wider toe box
• Triple and double needle stitching for greater durability
• Revised instep for fast roping and climbing
• Single-layer construction reducing the overlapping of material
• More durable outsole with an extra layer and additional rubber with deeper lugs Features:
• Waterproof and breathable GORE-TEX membrane
• Anti-debris mesh
• Non-reflective materials
• Stealth design & printings
• Highly abrasion resistant textile
• Protective rubber toe cap
• Mud guard
• Medial protective pad
• Quick Lace one-pull tightening. Easy-on, easy-off
• Heel foam
• Lace pocket "Garage"
• Gusseted tongue
• OrthoLite footbed See below for link to Size Chart. This Item is Excluded from Limited Sale Coupon Codes]]>
1https://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-gtx-2020-model-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-gtx-2020-model-67.jpgSalomon
https://s.turbifycdn.com/aah/optacticalgear/sawyer-micro-squeeze-water-filtration-system-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/sawyer-micro-squeeze-water-filtration-system-53.jpgcustom-itemoptacticalgear-pagenalgene131SP212932.9529.95Sawyer Micro Squeeze Water Filtration SystemSawyer Products111Bottom Line Up Front: The advantage of this model filter is you can squeeze water through it faster than gravity models. Enjoy clean and safe drinking water wherever you roam with the ultra-compact, lightweight, reusable Sawyer Micro Squeeze Water Filtration System — from backcountry adventures to everyday office work and from domestic and international travel to emergency prepping. This tiny filter fits in the palm of your hand. While small in size, the powerful Micro Squeeze removes 99.99999% of bacteria (salmonella, cholera and E. coli), 99.9999% of protozoa (cryptosporidium and giardia), and 100% of microsplastics — exceeding EPA recommendations for removal rates. Attach the Micro Squeeze to the included drinking pouch, use the included straw to drink directly from your water source, connect it to your hydration pack tubing, or screw it onto standard disposable bottles (28mm thread) (Smart Water fits perfectly). Made of a strong, softer material, the included 32-ounce (1-liter) Squeeze Pouch is half the weight of the standard 32-ounce Sawyer Squeeze Pouch and features a redesigned gusset for easy filling and stability. Kit Includes:
- Micro Squeeze Filter with Push/Pull Cap
- 1 x 32 ounce Collapsible Pouches
- Backwashing Plunger
- Cleaning Coupling
- Spare Gasket
- Drinking Straw Specifications
- Longevity: up to 100,000 Gallons
- Filter Material: Hollow Fiber Membrane
- Removes: Bacteria, Protozoa, and Cysts, including E. Coli, giardia, vibrio cholerea, Salmonella typhi, and microplastics
- Weight: 2 oz ]]>
1https://s.turbifycdn.com/aah/optacticalgear/sawyer-micro-squeeze-water-filtration-system-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/sawyer-micro-squeeze-water-filtration-system-67.jpgSawyer Products
https://s.turbifycdn.com/aah/optacticalgear/sawyer-mini-water-filtration-system-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/sawyer-mini-water-filtration-system-54.jpgcustom-itemoptacticalgear-pagenalgene131SP10724.9522.95Sawyer Mini Water Filtration System Sawyer Products111• Ideal for outdoor recreation, hiking, camping, scouting, domestic and international travel and emergency preparedness
• The MINI removes 99.99999% of all bacteria, such as salmonella, cholera, leptospirosis, and E.coli; removes 99.9999% of all protozoa, such as giardia and cryptosporidium
• High performance filter fits in the palm of your hand, weighs 2 ounces and filters up to 100,000 gallons (30 times more than comparable filters)
• Attaches to included drinking pouch, standard disposable bottles (28 mm thread), hydration packs, or use the straw to drink directly from your water source Kit Includes:
• 1 – Sawyer MINI Water Filter with Tip Cap
• 1 – 16 oz Reusable Squeeze Pouch
• 1 – 7″ Drinking Straw
• 1 – Cleaning Plunger (Syringe)
• Cleaning and Maintenance Instructions ]]>
1https://s.turbifycdn.com/aah/optacticalgear/sawyer-mini-water-filtration-system-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/sawyer-mini-water-filtration-system-67.jpgSawyer Products
https://s.turbifycdn.com/aah/optacticalgear/scout-light-pro-youtube-video-11.jpglink.susclipro10l1https://s.turbifycdn.com/aah/optacticalgear/scout-light-pro-youtube-video-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/scout-light-pro-youtube-video-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4395.jpglink.sudufusclipr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4187.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4188.jpgsearch.searchpage.1link.1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-placard-v3-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-placard-v3-17.jpgcustom-itemoptacticalgear-pagemaveclqacoXX001-003-0555Shaw Concepts ARC Placard V3Shaw Concepts111litoshcoramePLEASE NOTE: CALIBER INSERTS ARE SOLD SEPARATELY The ARC Placard V3 is the latest version of the ARC Placard series which is Shaw Concept's take on bridging the gap between traditional MOLLE magazine pouches and placards. At the inception of the ARC Placard the industry was filled with double stack styled placards that couldn’t be slimmed down so we decided to design a single pocket placard that could be run slick or built up. Each edition we’ve sought to evolve the product and this version is no different. The ARC Placard V3 is a single pocket placard meant to integrate into the front of Plate Carriers and Chest Rigs that allows users to build out their set ups according to their mission and weapon systems. The V3’s key improvement is its expanding main pocket. Most placards on the market can only run three 5.56 magazines or two .308 magazines, but this expanding pocket allows the placard to take up to four 5.56 magazines or three .308 magazines. Having an additional 25 to 30 rounds in your prime real estate is a significant improvement that few placards on the market currently offers. The V3 is available with four Elastic Magazine Inserts: our Quadruple 556, our Triple 556, a Triple 308 and our Quintuple 9mm Insert. The ARC Placard V3 features MOLLE along the sides and bottom which allow for additional pouches to be attached to real estate that would otherwise be empty on other placards out there. This allows users to attach Pistol Magazine Pouches, Tourniquet Pouches or the sort to the sides and bottom if desired. The placard continues to allow First Spear Tube™ Integration directly to the sides of the placard but now also allows 1" Hardware to be integrated so the placard can connect to Chest Rig Harnesses. The placard also features a hook Velcro® backing and adjustable height & hardware straps on top that will allow it to work with most carriers available on the market currently. Features: -Expandable Main Pocket capable of holding up to four M4 - STANAG (5.56x45mm) Pattern Magazines or three AR10 (7.62x51mm) Pattern Magazines. -Hook & Loop Velcro® Pocket for Multi-Caliber Inserts -MOLLE/PALS Front (6 Rows x 3 Columns) -MOLLE/PALS Sides for additional pouches -MOLLE/PALS Bottom for additional pouches -Side Webbing for First Spear Tubes™ and 1" Hardware -Adjustable Placard Height w/Velcro® OneWrap Straps and swappable 1" hardware -9.25" x 5" Hook Backing -Includes two lengths of Shock Cord for Pocket Expansion -Cordura Laminate Construction Proudly made in the USA / Berry Compliant]]>1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-placard-v3-22.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-placard-v3-23.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-shoulder-pads-v2-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-shoulder-pads-v2-16.jpgcustom-itemoptacticalgear-pagecaac1XX001-00555Shaw Concepts ARC Shoulder Pads V2Shaw Concepts111Features:
• 3/8" Close Cell Foam Padding
• Mil-Spec Spacer Mesh
• Spacer Mesh Lined Neck Protection
• Internal OneWrap Velcro Anchors to lock in position and cables
• Side Ports for Side Armor Mounted with 1" Straps
• 2" Internal channel fits most plate carriers on the market
• Weight: Less than 3 Oz Made in the USA / Berry Compliant Magazines, Gear and other accessories not included]]>
1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-shoulder-pads-v2-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-shoulder-pads-v2-30.jpgShaw Concepts
https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-double-elastic-pistol-dep-pouch-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-double-elastic-pistol-dep-pouch-16.jpgcustom-itemoptacticalgear-pagepimapoXX001-03826Shaw Concepts Double Elastic Pistol (DEP) PouchShaw Concepts111Features:
• Doubled Up Mil-Spec Elastic for Tight Mag Retention
• HANK Lined Inner for Friction & Retention
• Loops for Shockcord Retention if Desired
• 3" Deep Coverage to Allow Sufficient Grasp of the Magazine
• MOLLE / PALS Mounting
• Weight: 0.8 Oz Made in the USA / Berry Compliant Magazines, Gear and other accessories not included. The DEP can accept shock cord retention and pull tabs - not included.]]>
1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-double-elastic-pistol-dep-pouch-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-double-elastic-pistol-dep-pouch-30.jpgShaw Concepts
https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-flex-v2-pouch-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-flex-v2-pouch-27.jpgcustom-itemoptacticalgear-pageoptopmapoXX001-01438Shaw Concepts FLEX V2 PouchShaw Concepts111(Not included) for occasions such as Airborne or Amphibious Operations or just simple personal preference. On top of all that the pouch is constructed of Squadron B52 Laminate which consists of two 500D Cordura sheets laminated together which are then laser cut with perfect accuracy and consistency. This material helps keeps the weight down while keeping the pouch extremely durable. The mounting straps are designed to attach to standard Molle/PALS as well as half sized Molle found on shooter belts across the market. Features:
• Doubled Up Mil-Spec Elastic Retention
• HANK Friction Retention
• Shockcord Loop Built In (Shockcord not included)
• Molle/PALS for Stacking a Pistol Pouch
• Molle/PALS & Belt Compatible
• B52 Laminate Construction
• Weight: 1.5 oz Made in the USA / Berry Compliant Magazines not included]]>
1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-flex-v2-pouch-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-flex-v2-pouch-41.jpgShaw Concepts
https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-plate-carrier-panel-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-plate-carrier-panel-16.jpgcustom-itemoptacticalgear-pageassaultpacksXX001-003155Shaw Concepts Plate Carrier PanelShaw Concepts111Features:
• Tegris Thermoplastic Base w/6x6 MOLLE Mounting Slots
• Mounting real-estate on both sides
• Laminate Wrapped Carry Handle
• Flanking 'Mounting' Squares for Compression Straps
• Quick Adjust Shoulder Straps for use on a Plate Carrier or on its own.
• Soft Durable Stretch Fabric & Close Cell Foam Shoulder Pads
• Weight: 12 Oz (Entire Kit) Made in the USA / Berry Compliant Magazines, Gear and other accessories not included]]>
1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-plate-carrier-panel-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-plate-carrier-panel-30.jpgShaw Concepts
https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-ram-elastic-inserts-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-ram-elastic-inserts-11.jpgcustom-itemoptacticalgear-pagemaveclqacoXX001-003-05-0340Shaw Concepts RAM Elastic InsertsShaw Concepts111litoshcoarcpPLEASE NOTE: ARC PLACARD V3 SOLD SEPARATELY The RAM (Reinforced Ammunition Management) Elastic Insert is Shaw Concepts' update to the antiquated Elastic Inserts found across the market. This design was born from two problems: one was the lack of any suitable AK magazine placards out there that addressed the issue of the locking lugs tearing up pouches. and the second was users wishing to have an easier time re-indexing magazines into elastic cells that lay completely flat when empty. To solve these issues Shaw Concepts came up with a way to get Tegris Thermoplastic strips to line the side edges of each magazine cell so as to allow a magazine's rough lugs or pressure points to slide in and out without damaging the elastic that provides the magazine retention. This also helps keep the mouth of the elastic cell partially open at all times. This effectively offers the benefits of Kydex inserts without the impracticality of a pouch that is completely open. The RAM Elastic Insert works in our ARC Placard V3 and other placards that are Hook & Loop Velcro lined and that are wide enough to accept the various caliber sizes Shaw Concepts offers. This product is not compatible with the Spiritus Systems Microfight or Haley Strategic Micro Rig. Compatibility Guide: TRIPLE 556 RAM: Fits USGI 556 Magazines such as Issued Metal Mags and Polymer Mags including the Gen 3 PMAG. TRIPLE 308 RAM: Fits most 7.62x51mm Mags used by M110s as well as SCAR-H Mags. Features: -Tegris Thermoplastic Walls for snag-less insertion / extraction of magazines -Protected stitching for durability -Strong 4" Elastic for a tight grip on magazines -VelcroŽ Hook & Loop for plugging into compatible placards -Weighs less than 4 ounces -Berry Compliant Construction]]>1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-ram-elastic-inserts-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-ram-elastic-inserts-17.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-reup-bandolier-24.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-reup-bandolier-22.jpgcustom-itemoptacticalgear-pageammopouchesXX001-03845Shaw Concepts ReUp BandolierShaw Concepts111Features:
• Three to Four Magazine Retention & Protection
• Two Flanking Slim General Pockets
• Buckled Waist / Cross Body Band
• Shockcord w/Cord Loc for Rolling Up Tight
• Cordura & YKK Construction
• Weight: 7 Oz
Note: Some magazines may not fit the Cells such as 25 round 308 P-Mags from Magpul. Most 20 round 308 mags will fit. Most 30 round 556 STANAG mags will fit the 556 Cells as long as they lack a base plate extension. Made in the USA / Berry Compliant Magazines, Gear and other accessories not included]]>
1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-reup-bandolier-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-reup-bandolier-35.jpgShaw Concepts
https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-side-kick-v2-holster-pad-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-side-kick-v2-holster-pad-11.jpgcustom-itemoptacticalgear-pageholstersXX001-045-00150Shaw Concepts Side Kick V2 Holster PadShaw Concepts111 The ground breaking quality of life improvement Sidekick is back in its Version 2 form, now compatible with many more holster systems out there. Longevity and Comfort are a prime focus in all Shaw Concepts products and the Side Kick is no different. Carrying a two pound death brick on your hip is easy but can wear down your side after a few hours or even days in the field. This is where the Side Kick comes in. The Side Kick is the solution to comfortably carrying your Side Arm and mounting other items we may desire to carry next to said Holster. The Side Kick mounts to any holster system that has an isolated bottom screw post to piggyback off of. The Side Kick will work with the Safariland Mid Ride UBL, Safariland Low Ride UBL, True North Concepts MHA, the Guardian Warrior Solutions Bang Hanger and much more. The Side Kick uses Close Cell Foam and Spacer Mesh for padding and comfort and features two columns of MOLLE slots on both 'wings' of the pad. A 1" Thigh Strap is included that features a durable side release buckle and an elastic section for stretch. Features: -1/4" Close Cell Foam Padding -MOLLE Slots for PALS Pouches -1" Thigh Strap w/Elastic Comfort Stretch -35" Max Thigh Circumference -Reversible for Right and Left Hand Users -Mounts to UBLs, MHAs, QLSs and More -Included a Screw for Safariland Pattern Holsters and two Flanged Sleeve Bearings -Constructed of Cordura, Cordura Laminate and other Mil-Spec Materials Weight: 2.5 Oz Made in the USA / Berry Compliant1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-side-kick-v2-holster-pad-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-side-kick-v2-holster-pad-17.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shemaghs-veils-scarfs-bandanas-face-paint-57.jpgitem.optacticalgear-pageunclShemaghs / Veils / Camouflage / Face Paint1onehucoheonehucopashemaghfaceveilscarfvesybagistcafapast1misychwrcafocatacrprcoasgh1https://s.turbifycdn.com/aah/optacticalgear/shemaghs-veils-scarfs-bandanas-face-paint-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/shemaghs-veils-scarfs-bandanas-face-paint-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/shingles-open-top-mag-pouches-45.jpgitem.optacticalgear-pageammopouchesShingles / Open Top Mag Pouches, and Accessories1magpoupluanpospsyjspoplbipapov2fastmaggen3hsgen2ritahstamapohstaltmohspotav2hspotamagpomhsxtadorimaphstashshcoflv2pofecosielarblfogetesim4blfogetedom4blfogetetrm4es5sikytamages5dokytamages5trkymagpoes5sikymimages5trkymimages5sikyshmages5dokyshmages5trkyshmagfispmurapofispspreinkiatstrm4magshcrprmasof3atssctrshpoblfogetesrmaitwfahemo1https://s.turbifycdn.com/aah/optacticalgear/shingles-open-top-mag-pouches-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/shingles-open-top-mag-pouches-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/t-shirts-pt-shorts-52.jpgitem.optacticalgear-pageunclShirts and Sweaters1optgrlothodebehotjowabllahovesyborushvesyboruloslhodetophattehoderesilotemjsoadg3toptmasoftoptmaintrosqtwifitnonofatoptbeinlitoptoriginalteeoptacetoteeoptdotatfitoptsilotliweoptbuwalotli1https://s.turbifycdn.com/aah/optacticalgear/t-shirts-pt-shorts-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/t-shirts-pt-shorts-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/shorts-58.jpgitem.optacticalgear-pageunclShorts1pljashwogesirapamjsoadtrrushmjsopeshoptmainrapaoptsfrapasnloptmasofrapaoptsfrapa1https://s.turbifycdn.com/aah/optacticalgear/shorts-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/shorts-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/shot-timers-wind-meters-62.jpgitem.optacticalgear-pageweaponsShot Timers and Chronographs1pacltiiiiavsgaxec1proch1https://s.turbifycdn.com/aah/optacticalgear/shot-timers-wind-meters-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/shot-timers-wind-meters-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/shotgun-smg-crew-served-mg-pouches-33.jpgcustom-itemoptacticalgear-pageammopouchesShotgun, SMG, Belted Ammo, Pouches1es6roshcaes4roshcahsexpitahsmo2qtutpo1https://s.turbifycdn.com/aah/optacticalgear/shotgun-smg-crew-served-mg-pouches-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/shotgun-smg-crew-served-mg-pouches-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/side-armor-plates-37.jpgcustom-itemoptacticalgear-pagearmorSide Armor Plates1hep1leiiiasthespthstalpl1https://s.turbifycdn.com/aah/optacticalgear/side-armor-plates-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/side-armor-plates-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4t-pro-1x20-mm-r-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4t-pro-1x20-mm-r-16.jpgcustom-itemoptacticalgear-pagerdsreddotsiaSIGSOR4410719.99549.99Sig Sauer ROMEO4T-PRO 1x20 mm (R)Sig Sauer111Features
- Designed, built and tested for hard, professional use
- Engineered lens coatings for elite performance in bright light or NV
- Top mounted activation with NV Override control
- Quad Ballistic Circle Dot
- Durable half-inch hex mount
- 9 Daytime settings, 3 NV settings
- 3 mounting heights come standard in the box
- Includes clear flip-backs, opaque front flip back, and ARD Kill-Flash
- 50,000 hr runtime with CR2032 Battery and MOTAC Specifications
- MAGNIFICATION: 1x
- OBJECTIVE LENS DIAMETER (MM): 20 mm
- ADJUSTMENT INCREMENTS: 0.5 MOA
- TOTAL ELEVATION TRAVEL: 100 MOA
- TOTAL WINDAGE TRAVEL: 100MOA
- OVERALL LENGTH: 67.5 mm
- OVERALL WIDTH: 50 mm
- HEIGHT: 62.5 mm
- WEIGHT: 6.3 oz (with absolute cowitness mount, both clear flip-back lenses, and battery installed)
- RETICLE: Quad Ballistic Circle Red Dot
- CENTER DOT SIZE: 2 MOA
- WATERPROOFING: IPX-8
- BATTERY: (1) CR2032
- RUN TIME: 50000 hrs
- ILLUMINATION SETTINGS: 9 Daytime / 3 NV
- MOUNT TYPE: Half Inch Hex Mount (fits Aimpoint T2 pattern footprint) - Assembled in USA]]>
1https://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4t-pro-1x20-mm-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4t-pro-1x20-mm-r-30.jpgSig Sauer
https://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4xt-pro-1x20-mm-r-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4xt-pro-1x20-mm-r-16.jpgcustom-itemoptacticalgear-pagerdsreddotsiaSIGSOR4401759.99579.99Sig Sauer ROMEO4XT-PRO 1x20 mm (R)Sig Sauer111Specifications
- MAGNIFICATION: 20 mm
- OBJECTIVE LENS DIAMETER (MM): 20 mm
- ADJUSTMENT INCREMENTS: 0.5 MOA
- TOTAL ELEVATION TRAVEL: 100 MOA
- TOTAL WINDAGE TRAVEL: 100 MOA
- OVERALL LENGTH: 77 mm
- OVERALL WIDTH: 63 mm
- HEIGHT: 56 mm
- WEIGHT: 7.4 oz (with absolute cowitness mount, both clear flip-back lenses, and battery installed) WEIGHS 5.1 oz WITH BATTERY - MOUNT ONLY
- RETICLE: Ballistic Circle Dot
- RETICLE COLOR: Red
- CENTER DOT SIZE: 2 MOA
- WATERPROOFING: IPX-8
- BATTERY: (1) AAA
- RUN TIME: 50000 hrs
- ILLUMINATION SETTINGS: 9 Daytime / 3 NV
- MOUNT TYPE: Half Inch Hex Mount (fits Aimpoint T2 pattern footprint) - Assembled in USA ]]>
1https://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4xt-pro-1x20-mm-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4xt-pro-1x20-mm-r-30.jpgSig Sauer
https://s.turbifycdn.com/aah/optacticalgear/single-point-slings-44.jpgitem.optacticalgear-pagetagslingsSingle Point Slings1hastd3slmamsduqdslge215gemusiposemurswesl215gesc2insi11https://s.turbifycdn.com/aah/optacticalgear/single-point-slings-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/single-point-slings-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/sitka-mlx-jacket-mdwi-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/sitka-mlx-jacket-mdwi-38.jpgcustom-itemoptacticalgear-pagejavesw18030077300225Sitka MLX Jacket - MDWi - Polartec AlphaSitka111Ships to USA and APO Addresses Only. No International Shipping. The BLUF: This is an excellent mid or outer layer for active use, with the Polartec Alpha fleece providing great warmth, Aerolite outer layer protecting against wind and light rain/snow, and yet noticeably more breathable versus similar jackets when your body temp rises. An insulated jacket that is worn in a stand-alone manner or as a midlayer in conjunction with a wet weather protective jacket when conducting Special Reconnaissance tasks. Features:
• Wet Weather Jacket Compatible – allowing the jacket to be functionally worn as insulation with a Wet Weather Protective Jacket
• Full Zip Centre Front Closure – enhancing ventilation when mobile and the ease of donning and doffing
• Left Chest Zip Pocket – allowing for the secure carriage of mission essential items
• Lower Torso Hand Zip Pockets – allowing for the convenient and secure carriage of mission essential items Materials:
• Polartec Alpha® 4004 Breathable Insulation
• Brookwood AEROLITE™ H600™ 30d Nylon Ripstop with DWR Weight: 12 oz (Large size) TAA Trade Compliant. Sizing:
• Small: Chest: 36 - 38" / Sleeve: 33"
• Medium: Chest: 39 - 41" / Sleeve: 34"
• Large: Chest: 42 - 45" / Sleeve: 35"
• X-Large: Chest: 46 - 49" / Sleeve: 36"
• XXL: Chest: 50 - 53" / Sleeve: 37"]]>
1https://s.turbifycdn.com/aah/optacticalgear/sitka-mlx-jacket-mdwi-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/sitka-mlx-jacket-mdwi-48.jpgSitka
https://s.turbifycdn.com/aah/optacticalgear/sitka-wwp-jacket-mdw-waterproof-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/sitka-wwp-jacket-mdw-waterproof-47.jpgcustom-itemoptacticalgear-pageinoulal718050251950699Sitka WWP Jacket - MDW - WaterproofSitka111Ships to USA and APO Addresses Only. No International Shipping. A waterproof, breathable and durable jacket shell, that is worn when conducting full spectrum combat operations in a wet weather environement. Features:
• Fixed Adjustable Hood – allowing for the option of a hood when static
• Internal Left Chest Zip Pocket – allowing for the secure carriage of mission essential items
• Upper Torso Zip Pockets – allowing for the secure and convenient carriage of mission essential items
• Upper Arm Zip Pockets – allowing for the convenient carriage of mission essential items
• Underarm Zip Vents – enhancing ventilation when worn with Personal Protective Equipment and/or Load Carriage Equipment.
• Upper Arm Loop (4”x4.5”) – allowing for the application of IR reflective and electronic IFF devices
• Adjustable Hem Closure – allowing jacket to be cinched up when static during cold weather conditions
• Internal ID Label – mitigating confusion when issued as a uniform item
• GORE® GQST Military (Storm Rated)
• Multicam Print SKUs meet NIR Compliance Standards Materials:
• GORE® GTX 3L 40d Nylon Ripstop with DWR Weight: 23.5oz (L) USA Berry Compliant. Sizing:
• Small: Chest: 36 - 38" / Sleeve: 33"
• Medium: Chest: 39 - 41" / Sleeve: 34"
• Large: Chest: 42 - 45" / Sleeve: 35"
• X-Large: Chest: 46 - 49" / Sleeve: 36"
• XXL: Chest: 50 - 53" / Sleeve: 37" ]]>
1https://s.turbifycdn.com/aah/optacticalgear/sitka-wwp-jacket-mdw-waterproof-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/sitka-wwp-jacket-mdw-waterproof-60.jpgSitka
https://s.turbifycdn.com/aah/optacticalgear/size-chart-250.jpglink.saqu4dfo1https://s.turbifycdn.com/aah/optacticalgear/size-chart-214.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-215.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-244.jpglink.datotaboexcu1https://s.turbifycdn.com/aah/optacticalgear/size-chart-212.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-213.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-246.jpglink.safoguar67co1https://s.turbifycdn.com/aah/optacticalgear/size-chart-234.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-235.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-242.jpglink.datotabofucu1https://s.turbifycdn.com/aah/optacticalgear/size-chart-218.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-219.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-239.jpglink.otbbojuarcob1https://s.turbifycdn.com/aah/optacticalgear/size-chart-230.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-231.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4396.jpglink.saxulfomidgt1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4189.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4190.jpglink.crprg3coshm81link.mjsoadtrrush1link.ourefehoco1https://s.turbifycdn.com/aah/optacticalgear/size-chart-248.jpglink.datonoshli1https://s.turbifycdn.com/aah/optacticalgear/size-chart-224.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-225.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-238.jpglink.datotabocu1https://s.turbifycdn.com/aah/optacticalgear/size-chart-220.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-221.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-241.jpglink.saxafogtxlow1https://s.turbifycdn.com/aah/optacticalgear/size-chart-222.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-223.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-245.jpglink.crprmoribe201https://s.turbifycdn.com/aah/optacticalgear/size-chart-232.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-233.jpglink.ourefojaco1link.oureheiijaco1https://s.turbifycdn.com/aah/optacticalgear/size-chart-249.jpglink.datotaovexcu1https://s.turbifycdn.com/aah/optacticalgear/size-chart-216.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-217.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-240.jpglink.saurjuulbo1https://s.turbifycdn.com/aah/optacticalgear/size-chart-236.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-237.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-243.jpglink.datotamilicu1https://s.turbifycdn.com/aah/optacticalgear/size-chart-226.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-227.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-247.jpglink.datotamicrli11https://s.turbifycdn.com/aah/optacticalgear/size-chart-228.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-229.jpglink.crprg3copam81https://s.turbifycdn.com/aah/optacticalgear/sizing-46.jpgitem.optacticalgear-pagewoelclitSizing Military Uniforms and Hats1Sizing for military uniforms explained: Military type uniforms have two sizes, one is the standard sizing (small, medium, large...), and the other is the length (short, regular and long). OPT offers uniforms in sizes small to extra large, and lengths of regular and long. TOPS: Sizes (based on chest): -Small: 33" - 37"
-Medium: 37" - 41"
-Large: 41" - 45"
-XLarge: 45" - 49" Lengths (based on height): -Regular: 67" - 71"
-Long: 71" - 75"
Regular works for most anyone over 64" BOTTOMS: Sizes (based on waist): -Small: 27" - 31"
-Medium: 31" - 35"
-Large: 35" - 39"
-XLarge: 39" - 43" Length (based on inseam): -Regular: 29.5" - 32.5"
-Long: 32.5" - 35.5" HATS Hats are sized based on the circumference of the head at the line above the ears where the hat rests. Size 6 7/8 = 21 1/2 inches
Size 7 (S) = 21 7/8 inches
Size 7 1/8 = 22 1/4 inches
Size 7 1/4 (M) = 22 5/8 inches
Size 7 3/8 = 23 inches
Size 7 1/2 (L) = 23 1/2 inches
Size 7 5/8 = 24 inches
Size 7 3/4 (XL) = 24 3/8 inches ]]>
1https://s.turbifycdn.com/aah/optacticalgear/sizing-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/sizing-45.jpg
link.crprg3copa1link.crprlvsbavep1https://s.turbifycdn.com/aah/optacticalgear/sizing-chart-16.jpglink.datotamicrli1https://s.turbifycdn.com/aah/optacticalgear/sizing-chart-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/sizing-chart-15.jpglink.crprg3fipa1https://s.turbifycdn.com/aah/optacticalgear/ballistic-date-sheet-12.jpglink.crpraiheta3h1https://s.turbifycdn.com/aah/optacticalgear/ballistic-date-sheet-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/ballistic-date-sheet-11.jpglink.crprg3cosh1link.pigfudetafde1link.pigfudetafal1https://s.turbifycdn.com/aah/optacticalgear/sizing-guide-41.jpglink.dato14soli1https://s.turbifycdn.com/aah/optacticalgear/sizing-guide-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/sizing-guide-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/sizing-guide-42.jpglink.datohimicrcu1https://s.turbifycdn.com/aah/optacticalgear/sizing-guide-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/sizing-guide-38.jpglink.betrjuru1link.bemitrmicobo1link.tareqrfsedeb1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4397.jpglink.qamestedsiri1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4191.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4192.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4399.jpglink.qameclsiri1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4195.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4196.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4398.jpglink.qawolasiri1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4193.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4194.jpghttps://s.turbifycdn.com/aah/optacticalgear/sleeping-48.jpgitem.optacticalgear-pagefigemiSleeping Gear / Ponchos / Poncho Liners1hipegemosehpg812stsavesybasnjubag1https://s.turbifycdn.com/aah/optacticalgear/sleeping-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/sleeping-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/slings-33.jpgitem.optacticalgear-pageindexSling1twopointslingssiposlblfogevisawsramoslatslacwere1https://s.turbifycdn.com/aah/optacticalgear/slings-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/slings-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/sling-accessories-59.jpgitem.optacticalgear-pagetagslingsSling Accessories1spsyslreba4pblfogeulalgdefoslswhedupubuslswitwmashhookblfogeslslNote: many of these items are specifically designed to couple with slings made by the same manufacturers, most systems are NOT cross-compatible.1https://s.turbifycdn.com/aah/optacticalgear/sling-accessories-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/sling-accessories-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/slip2000-ewl-30-4-oz-bottle-30.jpgcustom-itemoptacticalgear-pageotweclki746035123.7219.99SLiP2000 EWL 30 - 4 oz. BottleSLiP2000111Lubrication Slip 2000 Lubricants use a unique formulation to penetrate into the smallest, tightest areas that oils do not go. This provides a long lasting protective coating that reduces friction and almost stops metal to metal wear. Slip 2000 gun lubricants form a barrier that will then protect all parts and will allow them to work smoother and last longer. Cleaning Slip 2000 lubricants penetrate powder residue, carbon, copper, lead, and plastic wad fouling. This allows it break contaminants free and flush away trapped dirt, grit and grime. What is left behind is a barrier that has bonded with the metal and will continue to lubricate and protect against corrosion. This barrier does not attract dust and will keep new firing residue from bonding to the metal. After your first complete cleaning with Slip 2000 you will see an amazing difference in the time and ease with which your next cleaning will take place. Preservation Slip 2000 lubricants provide a long lasting barrier on all metal parts and does not attract dirt or other abrasive contaminants. This barrier will displace moisture and prevent rusting. Our proprietary formulation was created to lubricate, clean, protect, and outlast any other product on the market today! We have done this without adding any oils, petroleum distillates or harmful PTFE type ingredients. Slip 2000 lubricants are developed with health, safety and the environment in mind. Our lubricants are formulated for multiple uses and extreme high performance requirements in all conditions. They will outperform all other lubricants in severe weather conditions, high humidity, rain, sleet, and snow working from -130 deg. F to +1250 deg F We recommend that you apply our lubricant to all metal parts and surfaces, not just the wear points. When applying our lubricant try to think of it as a metal treatment that will keep carbon and other buildup from sticking to the metal. Even when wiped away with a cloth, the lubrication and preservation properties will remain. Slip 2000 lubricants bond with the metal on contact, leaving a lubricating barrier that prevents carbon, residue, and other buildup from sticking. If you are unsure of how to lubricate your specific firearm, please follow the manufacturer's guidelines. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/slip2000-ewl-30-4-oz-bottle-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/slip2000-ewl-30-4-oz-bottle-40.jpgSLiP2000https://s.turbifycdn.com/aah/optacticalgear/slip2000-exteme-weapons-lubricant-ewl-1-oz-bottle-44.jpgcustom-itemoptacticalgear-pageotweclki746031711.219.49SLiP2000 Exteme Weapons Lubricant (EWL) - 1 oz. BottleSLiP2000111Description EWL was designed for use on chain guns and machine guns like the MP5 and the 249SAW. It contains a proprietary Anti wear agent that reduces friction and wear by 90-95%. SLiP2000 EWL is formulated to provide maximum performance in larger guns that may have issues with friction and heat while providing all the benefits of our regular lubricant. SLiP2000 EWL is a specially formulated synthetic liquid lubricant. Formulated with out the use of mineral oil or petroleum distillates SLiP2000 EWL has extremely high penetrating and (EP) antiwear properties. It also combines three essential functions in a single product. Specifically; Cleaning, Lubrication, and Preservation of handheld weapons, and weapons systems of both large and small caliber. This product will not separate, become sticky or dry out and leave any tacky residue behind. It will not attract and hold firing residue, dust or dirt particles like petroleum products. Lubrication SLiP2000 EWL has incorporated advanced technology additives to enhance film strength and antiwar properties. Penetrating the pores and bonding its self to the surface of the metal through physical absorption reducing surface tension thereby reducing friction between moving parts and minimizing wear and the build-up of wear related debris. SLiP2000 EWL will not dry out; attract dust or dirt particles like petroleum products. Even when surface is wiped dry to the touch SLiP2000 EWL is still present and lubricating the metal parts from within the pores of the weapon. This product does not require a liquid carrier to be present for protection. SLiP2000 EWL does not evaporate off because there are no carriers needed for continued protection. Cleaning SLiP2000 EWL provides additional protection through additives that in addition to the ability to penetrate between metal surfaces, it will also aid in the effective removal of built up dirt, lead, copper, carbon, corrosion particles and firing residues that can buildup and become abrasive to both recoil and gas operated mechanisms. Preservation After cleaning, a micro thin film of our enhanced preservative immediately bonds itself and forms a barrier film on the surface that displaces water and provides a corrosion resistant barrier against rust and dirt. It is designed to give protection against hydrogen sulfide (H2S), mild mineral acids, carbon dioxide (CO2), saltwater and brackish environments, musky water, chlorine and similar adverse environments and has passed the Salt Spray Corrosion (ASTM B-117) 150 Hour test. Additionally a barrier of protection is formed to protect against all other fouling of lead, carbon, copper and plastic wad. Applications SLiP2000 EWL is formulated to meet the complete requirements of cleaning, lubricating, and preserving both small and large caliber weapons in virtually all climate conditions. Apply to weapons metal surface liberally on first application. Allow to penetrate surface on first application approximately 5 to 10 min. Wipe excess lubricant from surface to leave a dry surface to the touch. This will also help when it comes to dirt not sticking to a dry weapon. As weapons are used and heat up the SLiP2000 will penetrate even deeper into the pores of the metal. On second cleaning these pores will fill in with additional Lubricant and a new protective barrier will be formed making the second cleaning much easier and faster. Specifications SLiP2000 EWL meets most and exceeds requirements of MIL SPEC: MIL-PRF-63460D (6) Kinematics Viscosity (ASTM D445) -59 degrees F...Pass Falex Load Carrying Capacity (ASTM D3233) +4500 lbs...Pass Corrosion Test (ASTM-B-117) 150 Hr...Pass Rust Resistance (ASTM D-665) Test A...Pass Test B...Pass Modified Test C...Pass]]>1https://s.turbifycdn.com/aah/optacticalgear/slip2000-exteme-weapons-lubricant-ewl-1-oz-bottle-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/slip2000-exteme-weapons-lubricant-ewl-1-oz-bottle-54.jpgSLiP2000https://s.turbifycdn.com/aah/optacticalgear/slip2000-extreme-tactical-cleaning-system-4oz-3-pack-available-soon-23.jpgcustom-itemoptacticalgear-pageotweclki746038742.0534.99SLiP2000 Extreme TACTICAL Cleaning System 4oz. 3 PackSLiP20001111 - 4oz. 725 Gun Cleaner
1 - 4oz. Carbon Killer Bore Cleaner Non-Toxic, Non-Hazardous synthetic cleaning solutions in one convenient bundle.]]>
1https://s.turbifycdn.com/aah/optacticalgear/slip2000-extreme-tactical-cleaning-system-4oz-3-pack-available-soon-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/slip2000-extreme-tactical-cleaning-system-4oz-3-pack-available-soon-30.jpgSLiP2000
https://s.turbifycdn.com/aah/optacticalgear/slip2000-extreme-weapons-lubricant-ewl-4-oz-bottle-38.jpgitem.optacticalgear-pageotweclki746032020.1316.99SLiP2000 Extreme Weapons Lubricant (EWL) - 4 oz. BottleSLiP2000111Description EWL was designed for use on chain guns and machine guns like the MP5 and the 249SAW. It contains a proprietary Anti wear agent that reduces friction and wear by 90-95%. SLiP2000� EWL is formulated to provide maximum performance in larger guns th