https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4338.jpglink.fecobibe1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4275.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4276.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-flatpack-plus-25.jpglink.hastcltopinb1https://s.turbifycdn.com/aah/optacticalgear/link-to-flatpack-plus-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-flatpack-plus-24.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-flatpack-plus-26.jpglink.hastcltopinb11https://s.turbifycdn.com/aah/optacticalgear/link-to-flatpack-plus-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-flatpack-plus-22.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4339.jpglink.ssprhoexgrtc1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4277.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4278.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-gear-retention-tracks-22.jpglink.ssprsmrskmar1https://s.turbifycdn.com/aah/optacticalgear/link-to-gear-retention-tracks-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-gear-retention-tracks-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-glock-mos-plate-15.jpglink.aiacp1r1https://s.turbifycdn.com/aah/optacticalgear/link-to-glock-mos-plate-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-glock-mos-plate-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-helmet-rail-adapter-11.jpglink.suheliled3wh11https://s.turbifycdn.com/aah/optacticalgear/link-to-helmet-rail-adapter-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-helmet-rail-adapter-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4340.jpglink.eainopgunbew1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4091.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4092.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4342.jpglink.noeobinvgwr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4097.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4098.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4344.jpglink.nopvwr11https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4099.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4100.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4341.jpglink.nobnwr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4093.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4094.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4343.jpglink.nopvwr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4095.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4096.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-j-arm-15.jpglink.baorcoonemos1https://s.turbifycdn.com/aah/optacticalgear/link-to-j-arm-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-j-arm-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1019.jpglink.crprjpc20mua1https://s.turbifycdn.com/aah/optacticalgear/newitem1-998.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-999.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1020.jpglink.crprjpc20mub1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1000.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1001.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4345.jpglink.crprjpc20mut1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4101.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4102.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-jpc-2-0-parts-11.jpglink.crprjpc201https://s.turbifycdn.com/aah/optacticalgear/link-to-jpc-2-0-parts-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-jpc-2-0-parts-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4346.jpglink.cotatrroosh1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4103.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4104.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-lightcap-and-scopecap-size-chart-11.jpglink.onehucoli1https://s.turbifycdn.com/aah/optacticalgear/link-to-lightcap-and-scopecap-size-chart-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-lightcap-and-scopecap-size-chart-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-low-profile-shoulder-straps-15.jpglink.twnemimapmoa1https://s.turbifycdn.com/aah/optacticalgear/link-to-low-profile-shoulder-straps-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-low-profile-shoulder-straps-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4347.jpglink.maloasarca201https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4105.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4106.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4348.jpglink.maloarca20ve1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4107.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4108.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4351.jpglink.crprlvsplho1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4113.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4114.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4350.jpglink.crprlvsovcom1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4111.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4112.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4349.jpglink.crprlvstaco1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4109.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4110.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4353.jpglink.vesy8roca40i1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4117.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4118.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4352.jpglink.vesygasmapof1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4115.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4116.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mha-leg-strap-11.jpglink.trnocomohoad1https://s.turbifycdn.com/aah/optacticalgear/link-to-mha-leg-strap-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mha-leg-strap-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4354.jpglink.spsymifichmk11https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4119.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4120.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-universal-retention-kit-17.jpglink.spsymifichmk1https://s.turbifycdn.com/aah/optacticalgear/link-to-universal-retention-kit-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-universal-retention-kit-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mini-map-11.jpglink.twnelowprshs1https://s.turbifycdn.com/aah/optacticalgear/link-to-mini-map-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mini-map-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4355.jpglink.trnocomhaleg1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4121.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4122.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mount-base-15.jpglink.ardeofopbapl1https://s.turbifycdn.com/aah/optacticalgear/link-to-mount-base-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-mount-base-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-nightcap-battery-pouch-13.jpglink.crprni1https://s.turbifycdn.com/aah/optacticalgear/link-to-nightcap-battery-pouch-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-nightcap-battery-pouch-12.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4356.jpglink.l3habinivide1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4123.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4124.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4358.jpglink.crprmotrarse1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4127.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4128.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4359.jpglink.opnfea1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4129.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4130.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1021.jpglink.ardeofopmoba1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1002.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1003.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4360.jpglink.gaxec1proch1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4131.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4132.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-pack-zip-on-panel-maritime-12.jpglink.crprjpc20mas1https://s.turbifycdn.com/aah/optacticalgear/link-to-pack-zip-on-panel-maritime-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-pack-zip-on-panel-maritime-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4361.jpglink.pedetr5mapla1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4133.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4134.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-triple-5-56-mag-placard-aor1-11.jpglink.pedelowprslp1https://s.turbifycdn.com/aah/optacticalgear/link-to-triple-5-56-mag-placard-aor1-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-triple-5-56-mag-placard-aor1-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4362.jpglink.modlitepl350r1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4135.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4136.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4363.jpglink.crprlvpr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4137.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4138.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4364.jpglink.mauwchriggen1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4139.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4140.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4365.jpglink.sukminwhlihe1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4366.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4367.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-sara-sordin-adapters-15.jpglink.untamakit1https://s.turbifycdn.com/aah/optacticalgear/link-to-sara-sordin-adapters-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-sara-sordin-adapters-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4368.jpglink.vesyscliqufl1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4141.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4142.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4369.jpglink.vesysclicu1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4143.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4144.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-sight-mount-plate-15.jpglink.baorcoonemom1https://s.turbifycdn.com/aah/optacticalgear/link-to-sight-mount-plate-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-sight-mount-plate-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-tosight-mount-plates-11.jpglink.baorcoonemoj1https://s.turbifycdn.com/aah/optacticalgear/link-tosight-mount-plates-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-tosight-mount-plates-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4370.jpglink.xgoliascotfr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4145.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4146.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-slickster-components-13.jpglink.fecosl1https://s.turbifycdn.com/aah/optacticalgear/link-to-slickster-components-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-slickster-components-12.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4371.jpglink.edshdeesdsl11https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4147.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4148.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-slr-gb-7-pin-micro-gas-block-19.jpglink.hode5nabar1https://s.turbifycdn.com/aah/optacticalgear/link-to-slr-gb-7-pin-micro-gas-block-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-slr-gb-7-pin-micro-gas-block-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4372.jpglink.som4brup5chf1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4149.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4150.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4373.jpglink.sobrm4up2wyp1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4151.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4152.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4374.jpglink.spsyasbapaco1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4153.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4154.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4375.jpglink.spsyjspo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4155.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4156.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4376.jpglink.ssprmmo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4377.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4378.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4379.jpglink.untahotbumr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4157.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4158.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-37.jpglink.untahotbupir1https://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-38.jpglink.momolisupl1https://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-surefire-ue-tailcap-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4381.jpglink.maapcwimepa1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4161.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4162.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4380.jpglink.vesylawenplc1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4159.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4160.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-swiftclip-rigs-and-vests-19.jpglink.mauwgenivert1https://s.turbifycdn.com/aah/optacticalgear/link-to-swiftclip-rigs-and-vests-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-swiftclip-rigs-and-vests-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4385.jpglink.es5sikytamag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4171.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4172.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4383.jpglink.es33kymagpo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4163.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4164.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4384.jpglink.es5dokytamag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4165.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4166.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4386.jpglink.es11kymagpo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4167.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4168.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4382.jpglink.es5trkymagpo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4169.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4170.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-tactical-tailor-fight-light-malice-clip-short-34.jpglink.es5sikymimag1https://s.turbifycdn.com/aah/optacticalgear/link-to-tactical-tailor-fight-light-malice-clip-short-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-tactical-tailor-fight-light-malice-clip-short-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4387.jpglink.es5dokyshmag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4175.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4176.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1024.jpglink.esdopigapkyp1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1008.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1009.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4388.jpglink.es5trkyshmag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4173.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4174.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1023.jpglink.essipikymagp1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1004.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1005.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4389.jpglink.es5sikyshmag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4177.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4178.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1022.jpglink.esdopikymagp1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1006.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1007.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4390.jpglink.es5trkymimag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4179.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4180.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4426.jpglink.teweepspbahe1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4427.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4428.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem2-305.jpglink.shcoramelin11https://s.turbifycdn.com/aah/optacticalgear/newitem2-287.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem2-288.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-the-shaw-concepts-ram-elastic-inserts-9.jpglink.shcoarcplv31https://s.turbifycdn.com/aah/optacticalgear/link-to-the-shaw-concepts-ram-elastic-inserts-7.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-the-shaw-concepts-ram-elastic-inserts-8.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem2-306.jpglink.spsylbvexkit1https://s.turbifycdn.com/aah/optacticalgear/newitem2-289.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem2-290.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1025.jpglink.eog43manomor1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1010.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1011.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4391.jpglink.eog33manomor1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4181.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4182.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-unity-tactical-fast-omni-mount-22.jpglink.eog45manomor1https://s.turbifycdn.com/aah/optacticalgear/link-to-unity-tactical-fast-omni-mount-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-unity-tactical-fast-omni-mount-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4392.jpglink.agteweexbahe1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4183.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4184.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1026.jpglink.agopmasfheco1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1012.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1013.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-uw-gen-iv-chest-rig-15.jpglink.exmaremedpof1https://s.turbifycdn.com/aah/optacticalgear/link-to-uw-gen-iv-chest-rig-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-uw-gen-iv-chest-rig-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4393.jpglink.hep1leiiiast1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4284.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4285.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-junction-box-crane-connector-r-10.jpglink.wiraxelowpo1https://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-junction-box-crane-connector-r-8.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-junction-box-crane-connector-r-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-raid-xe-low-power-r-11.jpglink.wijuboxcrcor1https://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-raid-xe-low-power-r-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-wilcox-raid-xe-low-power-r-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4394.jpglink.blfogetrkitn11https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4185.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4186.jpghttps://s.turbifycdn.com/aah/optacticalgear/noname2-40.jpgcustom-itemoptacticalgear-pagefootwearLowa Footwear1lozemk2gtxmilozemk2midlozegtxmidlozegtxmidtflozemidtfbo1https://s.turbifycdn.com/aah/optacticalgear/noname2-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/noname2-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-32.jpgcustom-itemoptacticalgear-pagenoname20005512631235149Lowa Zephyr GTX MidLowa Boots111This Zephyr model features open eye-hooks at the top for easier on/off, and to allow additional lacing techniques to be used. - Upper: Split Leather/Fabric
- Lining: GORE-TEX Extended Comfort – Tech Performance
- Insole: ATC
- Midsole: Double Injection DuraPU®
- Outsole: LOWA Cross II
- Stabilizer: Medium
- Weight: 550 g/Single Shoe This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-41.jpgLowa Bootshttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-tf-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-tf-65.jpgcustom-itemoptacticalgear-pagenoname21613105370XXX235Lowa Zephyr GTX Mid TFLowa Boots111• Upper Material Split Grain Leather & Fabric
• Construction Slip Lasted - Injected PU Midsole
• Lacing Hardware Fabric Loops and Closed Hooks
• Monowrap Frame® MONOWRAP® Stability Frame
• Lining GORE-TEX® Vision 3LY
• Insole ATC Footbed
• Midsole Double Injection DuraPU™
• Sole LOWA Cross II
• Stabilizer Soft
• Country of Origin Slovakia
• Weight Per Pair (lb) 2.42
• Resolable No Sizing: True to size, Lowa recommends ordering the same size as your standard street shoe size. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-tf-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-gtx-mid-tf-78.jpgLowa Bootshttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mid-tf-boots-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mid-tf-boots-69.jpgcustom-itemoptacticalgear-pagenoname21613105350731225Lowa Zephyr Mid TF BootsLowa Boots111• Upper Material: Split Grain Leather
• Construction Slip Lasted - Injected PU Midsole
• Lining: Wicking Polyester Synthetic
• Lacing Hardware Fabric Loops & Open Hooks
• Monowrap Frame®: MONOWRAP® Stability Frame
• Midsole: Injected DuraPU™
• Insole ATC Footbed
• Sole: LOWA Cross II
• Stabilizer: Soft
• Country of Origin: Slovakia
• Weight Per Pair (lb) 2.13
• Resolable: No Sizing: True to size, Lowa recommends ordering the same size as your standard street shoe size. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mid-tf-boots-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mid-tf-boots-82.jpgLowa Bootshttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-gtx-mid-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-gtx-mid-34.jpgcustom-itemoptacticalgear-pagenoname2161-3108550265Lowa Zephyr MK2 GTX MidLowa Boots111Features:
• Upper : Split Leather/CORDURA®
• Lining : GORE-TEX Professional
• Insole: Kinetic Z
• Midsole: Double Injection DuraPU®
• Outsole: LOWA® X-TRAC® MILITARY
• Weight: 1.26lbs / Single Shoe
• Country of Origin: Slovakia Sizing: True to size, Lowa recommends ordering the same size as your standard street shoe size. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-gtx-mid-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-gtx-mid-47.jpgLowa Bootshttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-mid-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-mid-17.jpgcustom-itemoptacticalgear-pagenoname2161-3108570731235Lowa Zephyr MK2 MidLowa Boots111Features:
• Upper: Split Leather/CORDURA®
• Lining: Moisture-Wicking Textile
• Insole: Kinetic Z
• Midsole: Double Injection DuraPU®
• Outsole: LOWA® X-TRAC® MILITARY
• Weight: 1.24lbs / Single Shoe
• Country of Origin: Slovakia Sizing: True to size, Lowa recommends ordering the same size as your standard street shoe size. These boots are Coyote in color. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-mid-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/lowa-zephyr-mk2-mid-30.jpgLowa Bootshttps://s.turbifycdn.com/aah/optacticalgear/lrrp-vietnam-44.jpgcustom-itemoptacticalgear-pagegearloadoutsLRRP Team Member Vietnam (6 man team) 1960's-70's16 fragmentation grenades
1 concussion grenade
2 CS grenades
2 claymores
3 strobes/ team
2 signal panels/ team
2 mirrors/ team
3 compasses/ team
3 pen flares/ team
3 smoke grenades/ team
2 penlights/ team
1 SOI/ team
poncho liner
foot powder
socks
FA kit
FA bag/ team
Sling rope and link
2 radios/ team
1 emergency radio/ team
2 batteries/ radio
2 handsets/ radio
1 field expedient antennae/ team
5 days rations
8 days rations in monsoon season
water purification
Camo stick
5 quarts water Source: Inside the LRRPs: Rangers in Vietnam, Michael Lee Lanning, Ballantine Books, 1988 ]]>1https://s.turbifycdn.com/aah/optacticalgear/lrrp-vietnam-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/lrrp-vietnam-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-anything-pouch-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-anything-pouch-17.jpgcustom-itemoptacticalgear-pageoptopmapoXX-LDST1435Luminae Anything PouchLuminae111The Luminae Anything pouch is designed to fit....anything. Using an ingenious retention adjustment method, the Anything Pouch will fit most small items from a compass to a coffee flask. Being able to use the same pouch to hold different caliber magazines or other small items stops you having to swap out pouches depending on what system/equipment you're using. This Pouch will hold most small items and most magazine styles, from 5.56 to 7.62NATO. The pouch is fixed using 2 x rows of Molle Made from Genuine Multicam Elastic and Fabrics the pouch is designed to offer ultimate flexibility to the user. 1https://s.turbifycdn.com/aah/optacticalgear/luminae-anything-pouch-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-anything-pouch-30.jpgLuminaehttps://s.turbifycdn.com/aah/optacticalgear/luminae-dump-pouch-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-dump-pouch-12.jpgcustom-itemoptacticalgear-pagedupoevbaXX-L0093027Luminae Dump Pouch111• Made from 100% Genuine Multicam Materials
• Holds up to 8x 5.56 Magazines
• Rapid Deployment
• Lightweight, Compact and Durable
• Cinchable opening to ensure contents stay secure within the pouch ]]>1https://s.turbifycdn.com/aah/optacticalgear/luminae-dump-pouch-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-dump-pouch-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-garmin-foretrex-gps-mount-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-garmin-foretrex-gps-mount-21.jpgcustom-itemoptacticalgear-pagelandnavigationXX-LDST1029.99Luminae Garmin Foretrex GPS Mount Luminae111Luminae Foretrex GPS Mount MKII is a protective mount for the Garmin foretrex 301/401/601. its design allows you to view and operate your GPS leaving your hands free for other tasks. 1https://s.turbifycdn.com/aah/optacticalgear/luminae-garmin-foretrex-gps-mount-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-garmin-foretrex-gps-mount-33.jpgLuminaehttps://s.turbifycdn.com/aah/optacticalgear/luminae-hanger-pouch-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-hanger-pouch-20.jpgcustom-itemoptacticalgear-pagecobamanpumebXX-L00460Luminae Hanger Pouch111• Large single compartment lined with loop velcro
• Wearable independently as a fanny pack (waist strap included)
• Compatible with all plate carrier styles
• Shock Cord & Cord Lock included for attaching a TQ (TQ not included) ]]>1https://s.turbifycdn.com/aah/optacticalgear/luminae-hanger-pouch-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-hanger-pouch-22.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-otb-pouch-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-otb-pouch-18.jpgcustom-itemoptacticalgear-pagebeltpouchesXXLDST2865Luminae OTB PouchLuminae111Solid colors do not have the elastic slots on the top of the pouch at this time This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/luminae-otb-pouch-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/luminae-otb-pouch-30.jpgLuminaehttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-system-43.jpgcustom-itemoptacticalgear-pageweacM-LOK Accessories1mamracoty2msmamracoty2hamawckwicokitmamracoty1redshdeesdefgardehastmrtrnocogrstletrnocopogrsttrnocogrmruntahotbumrardefistmrardeinmrkrdegrhastfokrdegrtebastmabastmknarcombastsmamhastkitrmamafanfogrrmammvvegrruntadivfgmamporamamqdslmor1ardeqdmomrkrdegrmlqdmomabifor19pir(R)=ITEM WILL NOT BE SHIPPED OUT OF UNITED STATES, NO EXCEPTIONS1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-system-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-system-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/m16-ar-15-shoot-off-muzzle-cover-40.jpgitem.optacticalgear-pageotweclki8A20.5M16 / AR-15 Shoot Off Muzzle CoverOPT111Available in Tan and Black colors. Works on A2, Panther, Yankee Hill flash hiders Does not fit the Cav-comp Keeps dirt and dust out of the barrel. We have these in stock, in quantity, for large scale discounts call us at 1-919-818-3649 or email customer service at optactical@yahoo.com1https://s.turbifycdn.com/aah/optacticalgear/m16-ar-15-shoot-off-muzzle-cover-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/m16-ar-15-shoot-off-muzzle-cover-50.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/m4-ar-buttstocks-58.jpgcustom-itemoptacticalgear-pageweacM4 / AR Buttstocks, and Accessories1lawtafoadgenmadtcastmirmagpulctrmamoeslcastmsunandshcachgesu42brwibulbeunbuforarlbeunbuforar1lbeuncaleresfocodecnfrfocodeesrmaasqdamslathpgstockcuff1https://s.turbifycdn.com/aah/optacticalgear/m4-ar-buttstocks-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/m4-ar-buttstocks-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/ar-lower-receiver-parts-and-upgrades-55.jpgitem.optacticalgear-pageweacM4 / AR Grips and AccessoriesGear]]>1edshdegrgrmamoek2grmamograrrmamoeslgrarrmamoeargrrmamoegrarrmaentrguNO EXCEPTIONS]]>1https://s.turbifycdn.com/aah/optacticalgear/ar-lower-receiver-parts-and-upgrades-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/ar-lower-receiver-parts-and-upgrades-54.jpgGear]]>https://s.turbifycdn.com/aah/optacticalgear/m4-ar-upgrades-44.jpgcustom-itemoptacticalgear-pageweacM4 / AR Lower Reciver Parts, and Triggers1gogeslfitmafhrfcorcmrsoli2trl2srsoblstkitrmaesksearrawetaamsasebaorco1mosarbaorunsasearfocodeesrfocodecnfrfocodetgfrbaorenbocargemabocarmabaasdebadrlawtafoadgengesusessatrralgdequmitrqmaasqdamslatsoa5bukitrgesu42brwibukrdegrm4reexkrdegra5reexknarcocotrguknarcoammaremamoeentrgupmaentrguThese were built specifically for AR type rifles.1https://s.turbifycdn.com/aah/optacticalgear/m4-ar-upgrades-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/m4-ar-upgrades-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/m4-ar-upper-receivers-and-parts-43.jpgcustom-itemoptacticalgear-pageweacM4 / AR Upper Components, Barrels, and Parts1mosushwiunrahodearbocagrhodebocagrrsobc5158caphsobcg5158cahhodepilorarhodebaor5archodesplomrachodesplomrahfocodelowsnasostfouprhodeau2stuprhodemod1uprehodem4uprerso2prsprgrbahode5nabarhodelowprgasslrrigbpinmikrdegrgasblrsoliamchha5araweraamchharaweraamchha1geaichharbaorgen3amchsuso4flhirsuwacltiflhisuwaflhisuadsucltiflhifosonoxmude59hsusfsusomubrrmaenejpocorracotoaruprezevarwelo9in1https://s.turbifycdn.com/aah/optacticalgear/m4-ar-upper-receivers-and-parts-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/m4-ar-upper-receivers-and-parts-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/mack-s-ear-seals-soft-flanged-earplugs-41.jpgitem.optacticalgear-pagehepr263600054.993.99Mack's Ear Seals Soft Flanged EarplugsMack's Ear Plugs111Product Details: Reusable, washable, dual purpose earplugs Seals out noise with a noise reduction rating of 27 decibels (when used as directed) for power tools, loud concerts, shooting, racing events, etc. Seals out water – Swim, shower, bathe, water sports, etc. Detachable cord – Conveniently hang plugs around your neck in environments where noise comes and goes Quickly and easily remove the cord for water activities. Super soft seal rings – Incredibly soft for extreme comfort. Dual durometer design – Two plastics used in the molding process allow for ease of insertion and unmatched comfort. Made in the U.S.A. 1https://s.turbifycdn.com/aah/optacticalgear/mack-s-ear-seals-soft-flanged-earplugs-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/mack-s-ear-seals-soft-flanged-earplugs-50.jpgMack's Ear Plugshttps://s.turbifycdn.com/aah/optacticalgear/mag-pouch-upgrades-36.jpgcustom-itemoptacticalgear-pageoptopmapoMag Pouch Upgrades1es5kyinhastmapoinespikyinssprputa1https://s.turbifycdn.com/aah/optacticalgear/mag-pouch-upgrades-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/mag-pouch-upgrades-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/mag-pod-base-plate-for-gen3-pmag-3-pack-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/mag-pod-base-plate-for-gen3-pmag-3-pack-r-46.jpgcustom-itemoptacticalgear-pagemainco148-8866327.9524.95Mag-Pod Base Plate for GEN3 PMAG (3-Pack) (R)Multitasker111• Compatible with GenM3 PMAG®
• Field expedient monopod for enhanced prone stability
• Ergonomic shape for improved grip during reloading
• SPACEFRAME docking slot for NANO/NANO2 Tool (sold separately)
• 15% Glass fiber reinforced PA6 nylon
• Double injection molded TPU based for improved traction on hard surfaces.
• SOLD AS 3-PACK MOE® and PMAG® are registered trademarks of Magpul Industries Corp. No endorsement expressed nor implied. NOTE: Designed ONLY to fit Magpul Gen 3 PMAGs. PMAG not included.]]>1https://s.turbifycdn.com/aah/optacticalgear/mag-pod-base-plate-for-gen3-pmag-3-pack-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mag-pod-base-plate-for-gen3-pmag-3-pack-r-58.jpgMultitaskerhttps://s.turbifycdn.com/aah/optacticalgear/magazines-and-accessories-56.jpgitem.optacticalgear-pageweacMagazines and Accessories1glfamagen533glfamagen415glfamagen517mapm21glgl9xmapm17gl9glgmapm15gl9gl1tatabapadkitttifibapadkiblknarcosrmamaam17sg9sigmapmdarmapm30argenm2crprmasof3mapm30argenm1mapm30argenmcam1maweducomabaplforgepNO EXCEPTIONS]]>1https://s.turbifycdn.com/aah/optacticalgear/magazines-and-accessories-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/magazines-and-accessories-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-amag-17-sg9-sig-p320-m17-r-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-amag-17-sg9-sig-p320-m17-r-19.jpgcustom-itemoptacticalgear-pagemainco49MAG133134.95Magpul AMAG 17 SG9 - SIG P320/M17 (R) Magpul111• Caliber: 9x19mm Parabellum
• Platform: SIG P320™/M17™
• Capacity: 17 rounds
• Materials: Heat-treated, stainless-steel alloy body and spring with polymer floorplate and follower
• Weight: 3.2 oz / 89 g
• Compatibility: The AMAG 17 SG9 is compatible with all full-size, compact, and sub-compact variants of the SIG P320/M17/M18 platform CORROSION-RESISTANT, STAINLESS-STEEL MAGAZINE BODY
High-visibility, controlled-tilt follower
Stainless-steel spring for longevity and durability CAPACITY INDICATORS IN ONE-ROUND INTERVALS STARTING AT FIVE ROUNDS FLARED, EASILY REMOVEABLE FLOORPLATE FOR MAINTENANCE
Paint pen dot matrix panel on the bottom to allow for identification marking This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-amag-17-sg9-sig-p320-m17-r-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-amag-17-sg9-sig-p320-m17-r-31.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-armorer-s-wrench-ar15-m4-r-36.jpgcustom-itemoptacticalgear-pagebrtokimaarwrarr79.9575.95Magpul Armorers Wrench (R)Magpul111Features:
American-made with US steel
Heat-treated steel construction with manganese phosphate finish
USGI barrel nut wrench
Free-float tube barrel nut wrench
1/2" torque wrench/breaker bar interface
Armorer's hammer
Rifle-length/Entry-length receiver extension wrench
USGI castle nut wrench, usable with aftermarket end plates such as the ASAP® and ASAP®-QD
3/4" wrench for most flash hiders/muzzle brakes
USGI torque spec references
Bottle opener Specifications:
Armorer's Wrench – AR15/M4
Weight: 1.1 lb.
Length, maximum: 11.7 in.
Handle Thickness: 0.35 in. ITAR Restricted: International Traffic in Arms Regulations Controlled Product]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-armorer-s-wrench-ar15-m4-r-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-armorer-s-wrench-ar15-m4-r-43.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-asap-qd-ambidextrous-sling-attachment-point-qd-r-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-asap-qd-ambidextrous-sling-attachment-point-qd-r-43.jpgcustom-itemoptacticalgear-pagem4arbuttstocks49MAG52929.9528.45Magpul ASAP QD - Ambidextrous Sling Attachment Point QD (R)Magpul111Features
-Accepts any push-button QD sling swivel as well as the Magpul QDM
-Durable steel construction
-Case hardened and finished with Melonite™ for extreme resistance to wear and corrosion
-Works with both mil-spec and commercial-spec carbine receiver extensions (buffer tubes) NOTE: The ASAP QD is NOT compatible with A1/A2 fixed stocks as well as any other similarly mounted stock such as the Magpul PRS®, UBR®, and MOE® Rifle Stocks. ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-asap-qd-ambidextrous-sling-attachment-point-qd-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-asap-qd-ambidextrous-sling-attachment-point-qd-r-56.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-barricade-stop-m-lok-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-barricade-stop-m-lok-17.jpgcustom-itemoptacticalgear-pagemamsy49MAG129524.95Magpul Barricade Stop - M-LOKMagpul111The Magpul Barricade Stop is a rugged hand stop that allows the shooter to brace their firearm off barricades or field expedient shooting rests to create a stable platform for more accurate shots. The Barricade Stop is constructed of a polymer body that’s fit with a hardened, QPQ-treated steel plate insert. The steel plate is heavily textured for aggressive contact with your shooting rest. It’s also slightly curved for optimized contact on uneven surfaces, giving you the ability to pivot your firearm while maintaining contact and control. Compatible with octagonal M-LOK Handguards. Hybrid polymer and metal construction Textured, QPQ-treated steel face for increased hardness and corrosion resistance Made in the USA. 1https://s.turbifycdn.com/aah/optacticalgear/magpul-barricade-stop-m-lok-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-barricade-stop-m-lok-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-battery-assist-device-bad-r-38.jpgitem.optacticalgear-pagem4arupgrades49MAG98032.9531.3Magpul Battery Assist Device BAD (R)Magpul111Developed from the operational experience of the Magpul® Dynamics team, the B.A.D. Lever™ (Battery Assist Device) is designed to considerably improve the speed and efficiency of the AR15/M16 bolt catch. The B.A.D. Lever™ quickly addresses reloading and malfunction clearance shortcomings of AR15/M16 platforms by extending a paddle to the right side of the weapon, allowing manipulation of the bolt stop from the fire control/ready position with the right-hand trigger finger. Made in USA Features - Fits standard mil-spec forged AR15/M16 lower receivers - Thin, anti-snag profile and textured surface still allows for traditional manipulation of the bolt catch while maintaining unobstructed access to the trigger - Easy attachment to the existing bolt catch paddle via one screw - Machined from durable billet 6061-T6 aluminum with mil-spec finishing - MIL-A-8625F, Type III, Class 2 hard anodizing with manganese phosphate on the screw per MIL-DTL-16232G - Torx® mounting screw with Nyloc® blue patch prevents back out under recoil, Torx® wrench included1https://s.turbifycdn.com/aah/optacticalgear/magpul-battery-assist-device-bad-r-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-battery-assist-device-bad-r-48.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-bipod-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-bipod-for-1913-picatinny-rail-24.jpgcustom-itemoptacticalgear-pagemamsy49MAG941129.95109.45Magpul Bipod (R)Magpul111Innovative, Adjustable, & Easy to Use Deploying and adjusting the Magpul Bipod is quick and easy. Spring-tensioned legs stow neatly forward and snap down and lock into place with one hand. Leg extensions slide and lock securely with the push of a button on any of the seven half-inch spaced locking detents. The legs extend a full four inches, from 6.3” to 10.3”. An industry-exclusive 50° of total tilt and 40° of total pan are controlled by a glove-friendly knurled tool-less bipod locking knob located between the extended legs, allowing easy adjustment between shots. Additionally, the Magpul Bipod has the exclusive ability to lock pan at 0° while maintaining full tilt functionality. Smooth & Unobtrusive From the drawing board, the Magpul Bipod was designed to be barely noticed until needed. Folded, the streamlined housing and legs fit neatly under the barrel and are just under 2.3” deep and 3.3” wide. In addition, anodized surfaces and tight, precision tolerances mitigate squeaks and rattles. Functional Feet The Magpul Bipod has many features that are also useful even when it is in the stowed position. A soft rubber bipod locking knob cap is attached to the locking knob gives users a steady, non-marring forward rest while the bipod is folded. Additionally, its staggered soft rubber feet hold fast on a variety of shooting surfaces and are easily removed with a roll pin punch. Should users choose to change feet, the Magpul Bipod’s legs accept most Atlas pattern bipod replaceable feet, except for the Atlas 5-H style. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-bipod-for-1913-picatinny-rail-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-bipod-for-1913-picatinny-rail-31.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-ctr-carbine-stock-r-50.jpgitem.optacticalgear-pagem4arbuttstocks49MAG31_64.9561.7Magpul CTR Carbine Stock (R)Magpul111-Mounts on mil-spec sized carbine receiver extension tube (not included) from manufacturers such as Colt, Armalite, S&W, LMT, and others (please see the note below)
-Supplemental friction lock minimizes accuracy robbing wobble*
-Sloping cheek weld combines a slim profile with user comfort
-Shielded release latch prevents snagging and accidental operation
-Premium chrome-silicon lock spring provides positive locking and long service life
-Side mounting slots accept optional cheek risers for NON AR15/M4 applications
-Removable 0.30" Rubber Butt-Pad offers an anti-slip surface and increases impact protection
-Compatible with Magpul ASAP®, ASAP® QD and other receiver-mount sling attachments Sling Mounts:
-Rear - Push-button QD swivel sling mount accommodates up to 1.5" swivels (ambidextrous)
-Rear/Bottom - 1.25" sling loops
-Toe - Lanyard hole for custom para-cord rigs SPECIFICATIONS:
-Weight: 8.8 oz.
-Weight, w/receiver extension: 12.8
-Length, max: 6.9 in.
-LOP Adjustment Range: 3.3 in.
-LOP, M4 Collapsed: ~10.7 in.
-LOP, M4 Extended: ~14.0 in. Friction lock performance may vary depending on the host receiver extension's dimensional tolerances. Specifications based on standard-length (flat-back) M4 Carbine receiver extension and may vary depending on tube manufacturer. ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-ctr-carbine-stock-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-ctr-carbine-stock-r-60.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-large-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-large-16.jpgcustom-itemoptacticalgear-pagemadapo49MAG115524.9523.7Magpul DAKA Can - LargeMagpul111Features
•Larger can with new upgrades
•Larger form for expanded storage
•High-density foam lining for more protection
•Crush, dust, chemical, UV and weather resistant
•High-strength injection molded polymer with durable external reinforced rib design
•Protective positive friction lid closure with durable steel hinge pin Technical Specifications
•External height: 6.4 in.
•Internal height: 6.0 in.
•External width: 3.3 in.
•Internal width: 2.7 in.
•External length: 3.0 in.
•Internal length: 2.6 in.
•Internal volume: ~ 44 cu in ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-large-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-large-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-2-0-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-2-0-46.jpgcustom-itemoptacticalgear-pagemadapo49MAG122319.9518.95Magpul DAKA Can 2.0 Magpul111Technical Specifications
•External height: 6.4 in.
•External width: 2.7 in.
•External length: 2.8 in. ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-2-0-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-can-2-0-60.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-essential-wallet-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-essential-wallet-45.jpgcustom-itemoptacticalgear-pagemadapo49MAG75816.9516.1Magpul DAKA Essential WalletMagpul111• Made of reinforced polymer fabric with anti-slip texture
•Permanent, RF welded seams
•Wallet is 4.13” x 2.75” and just 3mm thin
•Holds 3–7 standard Credit/ID/Access cards comfortably
•Slim profile reduces printing in pocket
•Suitable for EDC (everyday carry) and travel
•Rounded corners ease pocket entry and exit
•Extremely durable
•Chemical resistant
•Non-hygroscopic ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-essential-wallet-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-essential-wallet-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-everyday-wallet-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-everyday-wallet-45.jpgcustom-itemoptacticalgear-pagemadapo49MAG76324.9523.7Magpul DAKA Everyday WalletMagpul111• Windowed ID pocket
• Center divider pocket for bills and notes
• 10% larger than the Magpul DAKA Essential Wallet and holds 3-7 cards comfortably
• Slim profile eliminates printing
• Suitable for EDC and travel
• Reinforced polymer fabric with anti-slip texture
• Welded construction creates permanent impenetrable seals
• Chemical resistant / Non-hygroscopic
• Dimensions: 4.2” x 2.84” ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-everyday-wallet-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-everyday-wallet-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-large-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-large-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG124522.9521.8Magpul DAKA Lite Pouch - LargeMagpul111• Zipper Length: 10 inches
• Dimensions: 13 x 9 inches
• Weight: 41 grams]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-large-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-large-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-medium-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-medium-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG124418.9518Magpul DAKA Lite Pouch - MediumMagpul111• Zipper Length: 9 inches
• Dimensions: 12 x 7 inches
• Weight: 30 grams]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-medium-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-medium-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-small-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-small-47.jpgcustom-itemoptacticalgear-pagemadapo49MAG124314.9514.2Magpul DAKA Lite Pouch - SmallMagpul111• Zipper Length: 6 inches
• Dimensions: 9 x 6 inches
• Weight: 20 grams This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-small-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-lite-pouch-small-61.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-large-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-large-45.jpgcustom-itemoptacticalgear-pagemadapo49MAG85827.9526.55Magpul DAKA Pouch - LargeMagpul111FEATURES
-Large Pouch size 9"x13"
-Reinforced polymer fabric with anti-slip texture
-Welded construction creates permanent impenetrable seals
-YKK AquaGuard® water repellant zipper
-550 paracord with heat shrink tubing for enhanced grip, even with gloves
-Paint pen dot matrix debossed into body for identification marking
-Carabiner attachment points This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-large-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-large-59.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-medium-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-medium-45.jpgcustom-itemoptacticalgear-pagemadapo49MAG85722.9521.8Magpul DAKA Pouch - MediumMagpul111FEATURES
-Medium Pouch size 7"x12"
-Reinforced polymer fabric with anti-slip texture
-Welded construction creates permanent impenetrable seals
-YKK AquaGuard® water repellant zipper
-550 paracord with heat shrink tubing for enhanced grip, even with gloves
-Paint pen dot matrix debossed into body for identification marking
-Carabiner attachment points This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-medium-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-medium-59.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-small-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-small-45.jpgcustom-itemoptacticalgear-pagemadapo49MAG85619.9518.95Magpul DAKA Pouch - SmallMagpul111dakavideoFEATURES
-Small Pouch size 6"x9"
-Reinforced polymer fabric with anti-slip texture
-Welded construction creates permanent impenetrable seals
-YKK AquaGuard® water repellant zipper
-550 paracord with heat shrink tubing for enhanced grip, even with gloves
-Paint pen dot matrix debossed into body for identification marking
-Carabiner attachment points Note: this is not a MOLLE/PALS pouch. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-small-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouch-small-59.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouches-20.jpgcustom-itemoptacticalgear-pagegepuutpoMagpul DAKA Pouches1madawawipolamadawawipomemadawawiposmmadacan20madacanlamadaeswamadaevwamadalipolamadalipomemadaliposmmadapolamadapomemadaposmmadatalamadataoutmadautormadavopomadawipolamadawipomemadawiposm1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouches-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-pouches-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-take-out-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-take-out-36.jpgcustom-itemoptacticalgear-pagemadapo49MAG116129.9528.45Magpul DAKA TakeoutMagpul111REINFORCED POLYMER FABRIC
• Made of reinforced polymer-infused fabric with anti-slip texture for secure handling
• Strong RF welded construction that creates permanent, impenetrable seals
• Chemical resistant and non-hygroscopic MULTI-FUNCTION QUICK RELEASE BUCKLES
• Buckles provide a secure connection wherever you hang the Takeout and also act as a carrying handle
• FDE Magpul DAKA Takeout end view with buckled straps that can also act as carry handles 550 PARACORD & HEAT SHRINK TUBING FOR ENHANCED GRIP ON AQUAGUARD ZIPPER
• Rugged but easy to open and close zipper Tech Specs:
• Zipper length: 11.5 in.
• External height: 6.25 in.
• External width: 4.0 in.
• External length: 7.75 in.
• Internal volume: 3.5L EXPORT NOTICE: This is an item controlled for export by the Export Administration Regulations (EAR) under the Commerce Control List (CCL). These controls take the form of export regulations and license requirements. As part of the express consideration provided for receipt of Magpul's goods, technical data and/or services, you, our customer, acknowledge that the export, re-export or other transfer, directly or indirectly, of the goods, technical data and/or services provided by Magpul in violation of U.S. law is prohibited. Customers acquiring controlled goods, technical data and/or services from Magpul shall be responsible for obtaining any necessary U.S. or other government authorization required to ensure compliance with applicable export laws.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-take-out-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-take-out-46.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-takeout-large-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-takeout-large-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG119744.9542.7Magpul DAKA Takeout - LargeMagpul111litotafeviREINFORCED POLYMER FABRIC
• Made of reinforced polymer-infused fabric with anti-slip texture for secure handling
• Strong RF welded construction that creates permanent, impenetrable seals
• Chemical resistant and non-hygroscopic MULTI-FUNCTION QUICK RELEASE BUCKLES
• Buckles provide a secure connection wherever you hang the Takeout, Large and also act as a carrying handle 550 PARACORD & HEAT SHRINK TUBING FOR ENHANCED GRIP ON AQUAGUARD ZIPPER
• Rugged but easy to open and close zipper Specs:
• Zipper length: 18.5 in.
• External height: 9.0 in.
• External width: 6.5 in.
• External length: 12.0 in.
• Internal volume: 8.88 L EXPORT NOTICE: This is an item controlled for export by the Export Administration Regulations (EAR) under the Commerce Control List (CCL). These controls take the form of export regulations and license requirements. As part of the express consideration provided for receipt of Magpul's goods, technical data and/or services, you, our customer, acknowledge that the export, re-export or other transfer, directly or indirectly, of the goods, technical data and/or services provided by Magpul in violation of U.S. law is prohibited. Customers acquiring controlled goods, technical data and/or services from Magpul shall be responsible for obtaining any necessary U.S. or other government authorization required to ensure compliance with applicable export laws.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-takeout-large-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-takeout-large-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-utility-organizer-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-utility-organizer-58.jpgcustom-itemoptacticalgear-pagemadapo49MAG124029.9528.45Magpul DAKA Utility OrganizerMagpul111Technical Specifications
•Overall size of 4.5” x 7.5” x 1.75”
•Includes one zippered mesh pocket (6.75" x 3.75"), two vertical pockets (min. 4" x 3.75"), and three elastic pass-throughs (1" x 1.25")
•Useful as a tool kit, first aid kit, admin pouch, travel kit, or electronics case
•Polymer-infused material with welded construction creates permanent, impenetrable seals 
•Carabiner attachment point
•Chemical-resistant and non-hygroscopic
•YKK AQUAGUARDWATER-REPELLANT ZIPPER
•550 paracord with heat shrink tubing for enhanced grip, even with gloves]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-utility-organizer-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-utility-organizer-72.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-volume-pouch-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-volume-pouch-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG110129.9528.45Magpul DAKA Volume PouchMagpul111lidavopoviREINFORCED POLYMER FABRIC WITH ANTI-SLIP TEXTURE
• Our unique material protects your stuff from exposure, moisture, and from getting lost
• Chemical resistant and non-hygroscopic
• Paint pen dot matrix debossed into body for identification marking WELDED CONSTRUCTION AND YKK AQUAGUARD® ZIPPER
• Impenetrable seals on all sides and a water repellent zipper ensure secure, environment-proof storage
• Large carabiner attachment point 550 PARACORD & HEAT SHRINK TUBING FOR ENHANCED GRIP
• Rugged but easy to open and close zipper Tech Specs:
• Carabiner Attachment: Standard screw gate / wire gate Carabiner
• Zipper length: 7.5"
• External height: 10.5"
• External width: 8.5"
• Internal volume: 3L ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-volume-pouch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-volume-pouch-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-large-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-large-18.jpgcustom-itemoptacticalgear-pagepacocobawaba49MAG133934.95Magpul DAKA Waterproof Window Pouch - Large Magpul111• RUGGED, 100% WATERPROOF YKK ZIPPER THAT'S EASY-TO-OPEN AND CLOSE
• STRONG RF WELDED CONSTRUCTION THAT CREATES PERMANENT, IMPENETRABLE SEALS
• Overall dimensions: 9 x 13 in.
• External height: 9.0 in.
• Internal height: 8.75 in.
• External width: 13.0 in.
• Internal width:12.75 in.
• Internal volume: 3.18L ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-large-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-large-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/newitem1-964.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-963.jpgcustom-itemoptacticalgear-pagepacocobawaba49MAG133829.95Magpul DAKA Waterproof Window Pouch - MediumMagpul111• RUGGED, 100% WATERPROOF YKK ZIPPER THAT'S EASY-TO-OPEN AND CLOSE
• STRONG RF WELDED CONSTRUCTION THAT CREATES PERMANENT, IMPENETRABLE SEALS
• Overall dimensions: 7 x 12 in.
• External height: 7.0 in.
• Internal height: 6.75 in.
• External width: 12.0 in.
• Internal width: 11.75 in.
• Internal volume: 1.45L ]]>1https://s.turbifycdn.com/aah/optacticalgear/newitem1-1014.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem1-1015.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-small-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-small-18.jpgcustom-itemoptacticalgear-pagepacocobawaba49MAG133724.95Magpul DAKA Waterproof Window Pouch - SmallMagpul111• RUGGED, 100% WATERPROOF YKK ZIPPER THAT'S EASY-TO-OPEN AND CLOSE
• STRONG RF WELDED CONSTRUCTION THAT CREATES PERMANENT, IMPENETRABLE SEALS
• Overall dimensions: 6 x 9 in.
• External height: 6.0 in.
• Internal height: 5.75 in.
• External width: 9.0 in.
• Internal width: 8.75 in.
• Internal volume: 45L ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-small-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-waterproof-window-pouch-small-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-large-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-large-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG99630.9529.4Magpul DAKA Window Pouch - LargeMagpul111• Reinforced polymer fabric with anti-slip texture
• Window for easy organization
• RF welded construction that creates permanent, impenetrable seals
• YKK AquaGuard® water repellant zipper
• 550 paracord with heat shrink tubing for enhanced grip, even with gloves
• Chemical resistant and non-hygroscopic
• Paint pen dot matrix debossed into body for identification marking
• Carabiner attachment points Specs:
• 9” X 13”
• Zipper opening: 10"]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-large-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-large-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-medium-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-medium-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG99525.9524.95Magpul DAKA Window Pouch - MediumMagpul111• Reinforced polymer fabric with anti-slip texture
• Window for easy organization
• RF welded construction that creates permanent, impenetrable seals
• YKK AquaGuard® water repellant zipper
• 550 paracord with heat shrink tubing for enhanced grip, even with gloves
• Chemical resistant and non-hygroscopic
• Paint pen dot matrix debossed into body for identification marking
• Carabiner attachment points Specs:
• Overall: 7” X 12”
• Zipper opening: 8.5”]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-medium-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-medium-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-small-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-small-44.jpgcustom-itemoptacticalgear-pagemadapo49MAG99421.9520.85Magpul DAKA Window Pouch - SmallMagpul111• Reinforced polymer fabric with anti-slip texture
• Window for easy organization
• RF welded construction that creates permanent, impenetrable seals
• YKK AquaGuard® water repellant zipper
• 550 paracord with heat shrink tubing for enhanced grip, even with gloves
• Chemical resistant and non-hygroscopic
• Paint pen dot matrix debossed into body for identification marking
• Carabiner attachment points Specs:
• Overall: 6” X 9”
• Zipper opening: 5.75"]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-small-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-daka-window-pouch-small-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-dt-carbine-stock-mil-spec-r-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-dt-carbine-stock-mil-spec-r-17.jpgcustom-itemoptacticalgear-pagem4arbuttstocks49MAG137764.9561.7Magpul DT Carbine Stock Mil-Spec (R)Magpul111• Platform: AR10, AR15, M4, M16, M110, SR25
• Compatibility: Mil-Spec sized carbine receiver extension tube (not included) from manufacturers such as Colt, LMT, Ruger, S&W, SIG, and others*
• LOP, M4 Collapsed: ~10.6 in.
• LOP, M4 Extended: ~13.9 in.
• LOP Adjustment Range: 3.3 in.
• Length, max: 7.0 in.
• Height, max: 5.3 in.
• Weight: 9.7 oz.
• Weight, w/ receiver extension: ~13.7 oz.
• Width, max: 1.6 in. *Specifications based on standard-length (flat-back) M4 Carbine receiver extension and may vary depending on tube manufacturer. NOTE: There are two basic sizes of M4 Carbine receiver extensions (buffer tubes): Mil-Spec and Commercial-Spec. The DT Carbine Stock will only fit with the common Mil-Spec tube.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-dt-carbine-stock-mil-spec-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-dt-carbine-stock-mil-spec-r-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-trigger-guard-r-33.jpgitem.optacticalgear-pagem4arupgrades49MAG01522.9521.8Magpul Enhanced Aluminum Trigger Guard (R)Magpul111The Enhanced Trigger Guard is an aluminum drop in replacement for the M16/AR15 weapons platform. It features a shallow “V” shape for better use of gloves in tactical shooting or cold weather operations. The Enhanced Trigger Guard is non-folding, has rounded edges, and fills the annoying “gap” at the rear of the standard trigger guard.1https://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-trigger-guard-r-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-trigger-guard-r-40.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-ejection-port-cover-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-ejection-port-cover-r-44.jpgcustom-itemoptacticalgear-pagem4arupreandp49MAG120614.9514.2Magpul Enhanced Ejection Port Cover (R)Magpul111The Enhanced Ejection Port Cover is a drop-in upgrade designed to provide an improved installation process, physical strength, and corrosion resistance over the standard USGI ejection port cover. Traditional stamped-steel ejection ports are malleable, prone to corrosion, and require tools to install. The Enhanced Ejection Port Cover snaps into place easily without having to remove your hand guard or barrel nut, wind any loose springs, or adjust small e-clips. Constructed of impact-resistant injection molded polymer, it is corrosion resistant and will not bend or deform from impacts. Compatible with USGI-pattern AR15 upper receivers that accept USGI ejection port covers Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-ejection-port-cover-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-enhanced-ejection-port-cover-r-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-esk-selector-ar-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-esk-selector-ar-17.jpgcustom-itemoptacticalgear-pagem4arupgrades49MAG125449.95Magpul ESK Selector - ARMagpul111Designed for Mil-Spec AR-pattern lower receivers. Not compatible with select fire receivers. Three user-configurable levers for ambidextrous use Reversible steel axle allows for 60 or 90-degree selector throw Constructed of high-strength polymer and corrosion-resistant steel Easy drop-in installation Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-esk-selector-ar-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-esk-selector-ar-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-blue-mirror-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-blue-mirror-43.jpgcustom-itemoptacticalgear-pagemagpuleyewear49MAG11470012020149139Magpul Explorer - Black Frame - Polarized Bronze Lens - Blue MirrorMagpul111thprcanexyou14RUGGED AND RELIABLE
- Casual style includes a more relaxed wrap & flexibility at the temples for all-day wear
- Outstanding impact resistance, even at low temperatures
- Chemical and stress-crack resistant
- UV resistant SIMPLE LOOK, ADVANCED PROTECTION
- Though not rated to Z87.1 due to the wrap and shape of the Explorer, the lens and frames were engineered to the same ballistic impact protection standards as our other eyewear
- Lenses provide high velocity impact protection
- Frames are constructed of TR90NZZ, combining lightweight construction with dependable ballistic protection PREMIUM FEATURES BUILT IN
- Oleophobic treatment of lenses provides liquid & other chemical protection + scratch resistance
- Anti-reflective coating on inside of lenses minimizes distracting reflections
- Coated stainless steel pins provide simple but dependable hinge functionality COMFORTABLE AND COMPATIBLE WITH YOU AND YOUR GEAR
- Padded low profile temples integrate smoothly under helmets, communication headsets and over the ear hearing protection while providing comfort with rubber nose and temple pads
- Rubber nose and temple pads are overmolded to the frame for durability
- Frames and lenses suited for medium-sized faces ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-blue-mirror-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-blue-mirror-56.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-gold-mirror-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-gold-mirror-43.jpgcustom-itemoptacticalgear-pagemagpuleyewear49MAG11470012030139129Magpul Explorer - Black Frame - Polarized Bronze Lens - Gold MirrorMagpul111thprcanexyou15RUGGED AND RELIABLE
- Casual style includes a more relaxed wrap & flexibility at the temples for all-day wear
- Outstanding impact resistance, even at low temperatures
- Chemical and stress-crack resistant
- UV resistant SIMPLE LOOK, ADVANCED PROTECTION
- Though not rated to Z87.1 due to the wrap and shape of the Explorer, the lens and frames were engineered to the same ballistic impact protection standards as our other eyewear
- Lenses provide high velocity impact protection
- Frames are constructed of TR90NZZ, combining lightweight construction with dependable ballistic protection PREMIUM FEATURES BUILT IN
- Oleophobic treatment of lenses provides liquid & other chemical protection + scratch resistance
- Anti-reflective coating on inside of lenses minimizes distracting reflections
- Coated stainless steel pins provide simple but dependable hinge functionality COMFORTABLE AND COMPATIBLE WITH YOU AND YOUR GEAR
- Padded low profile temples integrate smoothly under helmets, communication headsets and over the ear hearing protection while providing comfort with rubber nose and temple pads
- Rubber nose and temple pads are overmolded to the frame for durability
- Frames and lenses suited for medium-sized faces ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-gold-mirror-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-bronze-lens-gold-mirror-56.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-gray-lens-silver-mirror-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-gray-lens-silver-mirror-43.jpgcustom-itemoptacticalgear-pagemagpuleyewear49MAG11470011110139129Magpul Explorer - Black Frame - Polarized Gray Lens - Silver MirrorMagpul111thprcanexyou13RUGGED AND RELIABLE
- Casual style includes a more relaxed wrap & flexibility at the temples for all-day wear
- Outstanding impact resistance, even at low temperatures
- Chemical and stress-crack resistant
- UV resistant SIMPLE LOOK, ADVANCED PROTECTION
- Though not rated to Z87.1 due to the wrap and shape of the Explorer, the lens and frames were engineered to the same ballistic impact protection standards as our other eyewear
- Lenses provide high velocity impact protection
- Frames are constructed of TR90NZZ, combining lightweight construction with dependable ballistic protection PREMIUM FEATURES BUILT IN
- Oleophobic treatment of lenses provides liquid & other chemical protection + scratch resistance
- Anti-reflective coating on inside of lenses minimizes distracting reflections
- Coated stainless steel pins provide simple but dependable hinge functionality COMFORTABLE AND COMPATIBLE WITH YOU AND YOUR GEAR
- Padded low profile temples integrate smoothly under helmets, communication headsets and over the ear hearing protection while providing comfort with rubber nose and temple pads
- Rubber nose and temple pads are overmolded to the frame for durability
- Frames and lenses suited for medium-sized faces ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-gray-lens-silver-mirror-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-explorer-black-frame-polarized-gray-lens-silver-mirror-56.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-eyewear-36.jpgcustom-itemoptacticalgear-pagesugo1maexblfrpogrmaexblfrpobr1maexblfrpobrmarafdefrpogmarablfrpobr1https://s.turbifycdn.com/aah/optacticalgear/magpul-eyewear-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-eyewear-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-gl-enhanced-magazine-well-for-glock-19-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-gl-enhanced-magazine-well-for-glock-19-r-46.jpgcustom-itemoptacticalgear-pagestweliandmo49MAG9X024.9523.7Magpul GL Enhanced Magazine Well for Glock 19 (R)Magpul111Reduced capacity 10 rd factory Glock magazines have several dimensional differences which may interfere with any magazine well, including the Magpul GL Enhanced Magazine Well.. Some combinations of certain pistol production lots may have slight interference with older (greater than 10 years old) generations of Glock factory magazines, and some aftermarket base plates may not fit. FEATURES:
• Fits G19, G23, G32, G38
• Gen 3 and 4 Models available
• Large ramp area for easier reloading
• External dimensions ensure minimal printing when carrying concealed
• Reinforced polymer construction
• Compatible with Magpul, and most OEM or aftermarket magazine floor plates
• Compatible with most common after-market magazine extensions
• Easy installation
• Not compatible with factory Glock reduced capacity 10 rd magazines Made in U.S.A.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-gl-enhanced-magazine-well-for-glock-19-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-gl-enhanced-magazine-well-for-glock-19-r-60.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-hand-stop-kit-r-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-hand-stop-kit-r-41.jpgcustom-itemoptacticalgear-pagemamsy49MAG60824.9523.75Magpul M-LOK Hand Stop Kit (R)Magpul111FEATURES
-Light weight, low-profile M-LOK slot index point for improved weapon control
-Forward stop to prevent the shooter’s hand from reaching the hot front sight assembly or muzzle
-Aggressive TSP Texture for enhanced weapons control ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-hand-stop-kit-r-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-hand-stop-kit-r-55.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-qd-sling-mount-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-qd-sling-mount-r-53.jpgcustom-itemoptacticalgear-pageramoslat49MAG60619.9518.95Magpul M-LOK QD Sling Mount (R)Magpul111-Mounts to all M-LOK compatible hand guards and forends
-Accepts any push-button QD swivel as well as the Magpul QDM
-Machined from Mil-Spec annodized aluminum for durability and light weight
-Beveled edges reduce snagging
-Anti-rotation design prevents swivels from spinning SPECIFICATIONS
-Weight: 0.5 oz.
-Length, Max: 1.3 in..
-Width, Max: 0.6 in.
-Height, From Surface of Hand Guard: 0.4 in. ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-qd-sling-mount-r-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-qd-sling-mount-r-67.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-1-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-1-r-44.jpgcustom-itemoptacticalgear-pagemamsy49MAG60216.9516.1Magpul M-LOK Rail Cover - Type 1 (R)Magpul111Includes two Covers per package. Features:
• 9.5” in length
• Compatible with all M-LOK systems
• Enhanced gripping surface
• Includes two Covers per package
• Low profile and light weight Made in U.S.A.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-1-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-1-r-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-covers-type-2-half-slot-24.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-covers-type-2-half-slot-22.jpgcustom-itemoptacticalgear-pagemamsy49MAG136515.95Magpul M-LOK Rail Covers - Type 2 Half Slot Magpul1111https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-covers-type-2-half-slot-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-covers-type-2-half-slot-35.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-afg-angled-fore-grip-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-afg-angled-fore-grip-r-44.jpgcustom-itemoptacticalgear-pagemamsy49MAG59826.9525.6Magpul M-LOK™ AFG® - Angled Fore Grip (R)Magpul111The Magpul M-LOK AFG (Angled Fore Grip) is the result of research and refinements done to the original AFG and AFG-2. By integrating the direct-attach M-LOK mounting system with minimalist construction we were able to produce a high strength grip that only weighs 1.2 ounces, including hardware. Allowing for a wider range of mounting location options, the M-LOK AFG is ¾" shorter than the AFG-2 while maintaining a similar gripping surface area. Even though the M-LOK AFG is more compact than its predecessors it continues to take into account natural body mechanics to provide a comfortable and stable user interface that reduces fatigue and allows for more precise weapon control. By positioning the shooter's hand high on the centerline of the bore, unlike conventional vertical fore grips, the M-LOK AFG helps mitigate recoil and control the weapon to facilitate faster, more accurate follow-up shots. All hardware necessary for attachment directly to M-LOK Slots on either aluminum or polymer hand guards and forends is included. Made in U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-afg-angled-fore-grip-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-afg-angled-fore-grip-r-58.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-mvg-vertical-grip-r-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-mvg-vertical-grip-r-45.jpgcustom-itemoptacticalgear-pagemamsy49MAG59722.9521.8Magpul M-LOK™ MVG® Vertical Grip (R)Magpul111The M-LOK MVG is a light weight, inexpensive vertical foregrip that attaches directly to M-LOK compatible hand guards and forends with no additional Picatinny rails required. Made from the same high quality polymer as other Magpul products, the M-LOK MVG uses the new Magpul TSP texture for positive control in all environments. With rounded contours and a shorter length, it has been optimized for use with the "thumb break method" of shooting and can also be used as a traditional vertical foregrip. All hardware necessary for attachment directly to M-LOK Slots on either aluminum or polymer hand guards and forends is included. Made in U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-mvg-vertical-grip-r-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-mvg-vertical-grip-r-59.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-polymer-rails-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-polymer-rails-35.jpgcustom-itemoptacticalgear-pagemamsy49MAG59X10.9510.4Magpul M-LOK™ Polymer Rails (R)Magpul111Designed for use with all M-LOK compatible Hand Guards and Forends, M-LOK Polymer Rail Sections provide a cost effective method of attaching various 1913 Picatinny spec rail-mounted accessories such as lights, vertical grips, etc. Injection molded from a proprietary reinforced composite for enhanced strength and durability while remaining lightweight, Rail Sections also feature beveled ends to reduce snagging and eliminate sharp corners and edges. All hardware necessary for attachment directly to M-LOK Slots on either aluminum or polymer hand guards and forends is included. 3 Slots, max overall length of 1.6 in. 5 Slots, max overall length of 2.5 in. 7 Slots, max overall length of 3.3 in. 9 Slots, max overall length of 4.1 in. 11 Slots, max overall length of 4.9 in. Made in U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-polymer-rails-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-polymer-rails-45.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-2-m-lok-slot-system-r-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-2-m-lok-slot-system-r-47.jpgcustom-itemoptacticalgear-pagemamsy49MAG60312.9512.3Magpul M-LOK™ Rail Cover Type 2 M-LOK Slot System (R)Magpul111M-LOK Type 2 Rail Covers are low-profile, two-piece covers that install directly onto most M-LOK aluminum hand guards (non polymer). These M-LOK Covers are non-orientation specific which allow the user to mount them in any direction desired without affecting function, feature beveled contours to minimize potential snagging, utilizes our TSP texture for additional grip, and protrudes only slightly more than 1/8" from the mounting surface to maintain a low-profile. The center locking tab is pre-scored to allow the user to snap off sections and mix and match colors for a customized look. Includes six panels, each covering one M-LOK slot. Made in U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-2-m-lok-slot-system-r-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-m-lok-rail-cover-type-2-m-lok-slot-system-r-61.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-3-rear-sight-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-3-rear-sight-16.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG116759.9556.95Magpul MBUS 3 Rear Sight (R)Magpul111Features
• The MBUS 3 Rear Sight sits at standard AR-height when deployed and includes a windage adjustable, rapid-select aperture system.
• Ambidextrous push-button deployment and rapid-select rear aperture system
• 0.55” high when folded and 1.38” wide at widest point
• Standard AR-height when deployed
• Polymer construction, smaller size provides light weight and resists operational abuse
• Clamps to most MIL-STD-1913 PICATINNY RAILS
• Made in the USA. Technical Specifications
• Position: Rear
• Height above rail, stowed: ~0.55 in.
• Platform: AR10, AR15, M4, M16, M110, SR25
• Weight, w/ hardware: 1 ounce
• Other Specs: Center of aperture to top of rail: 1.41 in.
WINDAGE ADJUSTMENT
~0.5 MOA (0.606”/100m) per click with a 14.5" sight radius
~0.4 MOA (0.439”/100 m) per click with a 20" sight radius]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-3-rear-sight-25.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-3-rear-sight-26.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-front-r-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-front-r-60.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG27594.9590.2Magpul MBUS Pro - Back-Up Sight – Front (R)Magpul111• All steel construction
• Case hardened and finished with a ferritic nitrocarburizing process for extreme resistance to wear and corrosion
• Mounts on any MIL-STD-1913 Picatinny/STANAG 4694 rail including receiver-height gas blocks
• Elevation adjustment knob – no tools required
• Positive detents in both the up and down positions as well as on the elevation knob
• Standard AR sight height when deployed Specifications
• MBUS Pro – Front
• Weight, w/ hardware: 1.51 oz.
• Height above rail, stowed: ~0.43" max
• Length, stowed: 1.6" Color: black Front Sight only. Rear Sight sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-front-r-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-front-r-74.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-rear-r-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-rear-r-60.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG276114.95109.2Magpul MBUS Pro - Back-Up Sight – Rear (R)Magpul111• All steel construction
• Case hardened and finished with a ferritic nitrocarburizing process for extreme resistance to wear and corrosion
• Mounts on any MIL-STD-1913 Picatinny/STANAG 4694 rail
• Windage adjustable with low-profile knob – no tools required
• Positive detents in both the up and down positions
• Standard AR sight height when deployed Specifications:
• MBUS Pro – Rear
• Weight, w/ hardware: 1.80 oz.
• Height above rail, stowed, at mid-point: ~0.37"
• Length, stowed: 2.1"
• Aperture height over rail: 1.41"
• Small aperture dia.: 0.07"
• Large aperture dia.: 0.19" Color: black Rear Sight only. Front Sight sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-rear-r-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-back-up-sight-rear-r-74.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-front-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-front-r-42.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG52599.9594.95Magpul MBUS Pro Offset Sight - Front (R)Magpul111-All steel construction
-Case hardened and finished with Melonite QPQ™ for extreme resistance to wear and corrosion
-Mounts on any MIL-STD-1913 Picatinny/STANAG 4694 rail including receiver-height gas blocks
-Elevation adjustment knob – no tools required
-Positive detents in both the up and down positions as well as on the elevation knob
-Standard AR height over bore when deployed, 45 deg. offset right-hand side
-Weight, w/ hardware: 1.8 oz.
-Height above rail at clamp: ~0.18"
-Length, stowed: 1.9" ELEVATION ADJUSTMENT ~1 MOA (1.131"/100m) per click with a 14.5" sight radius ~0.7 MOA (0.820"/100m) per click with a 20" sight radius Color: black ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-front-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-front-r-56.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-rear-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-rear-r-42.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG526119.95113.95Magpul MBUS Pro Offset Sight - Rear (R)Magpul111-All steel construction
-Case hardened and finished with Melonite QPQ™ for extreme resistance to wear and corrosion
-Mounts on any MIL-STD-1913 Picatinny/STANAG 4694 rail
-Windage adjustable with low-profile knob – no tools required
-Positive detents in both the up and down positions
-Standard AR height over bore when deployed, 45 deg. offset right-hand side SPECIFICATIONS: MBUS Pro Offset – Rear
-Weight, w/ hardware: 2.0 oz.
-Height above rail at clamp: ~0.18"
-Length, stowed: 2.0"
-Small aperture dia.: 0.07"
-Large aperture dia.: 0.19" WINDAGE ADJUSTMENT:
~0.5 MOA (0.566"/100m) per click with a 14.5" sight radius
~0.4 MOA (0.410"/100m) per click with a 20" sight radius This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-rear-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-pro-offset-sight-rear-r-56.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-front-r-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-front-r-51.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG24739.9537.95Magpul MBUS® Sight Front (R)Magpul111FEATURES
-Impact resistant polymer construction provides light weight and resists operational abuse
-Spring-loaded flip up sight easily activated from either side or by pressing the top
-Detent and spring pressure keeps sight erect but allows for unobstructed folding under impact, etc.
-Clamps to most any MIL-STD-1913 Picatinny/STANAG 4694 railed hand guard* and provides the same height-over-bore as standard A2 irons
-Protective wings shield the spring-locking A2 front sight post
-Elevation adjustment tool included, but most aftermarket A2 front sight adjustment tools may be used as well SPECIFICATIONS
-Weight, w/ hardware: 1.2 oz.
-Height above rail, stowed: ~0.51 in.
-Length, stowed: 2.6 in.
-Length, deployed: 1.5 in. ELEVATION ADJUSTMENT
- ~1.6 MOA (1.886"/100m) per click with a 14.5" sight radius
- ~1.2 MOA (1.367"/100m) per click with a 20" sight radius *NOTE:
Cannot be mounted to a railed gas block due to excess heat issues. Front MBUS must be mounted to a railed fore end on the same plane as the receiver rail. Because of this the sight is also not compatible with MOE Hand Guards. ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-front-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-front-r-65.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-rear-r-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-rear-r-51.jpgcustom-itemoptacticalgear-pagebaupirsib49MAG24857.9549.95Magpul MBUS® Sight Rear (R)Magpul111FEATURES
-Impact resistant polymer construction provides light weight and resists operational abuse
-Spring-loaded flip up sight easily activated from either side or by pressing the top
-Detent and spring pressure keeps sight erect but allows for unobstructed folding under impact, etc.
-Clamps to MIL-STD-1913 Picatinny/STANAG 4694 receiver rail and provides the same height-over-bore as standard A2 irons
-Protective wings shield the dual, same plane flip apertures
-Sight can still be folded with either large or small aperture in position
-Detent knob easily and positively adjusts windage SPECIFICATIONS
-Weight, w/ hardware: 1.3 oz.
-Height above rail, stowed: ~0.51 in.
-Center of aperture to top of rail: 1.42 in.
-Length, stowed: 2.6 in.
-Length, deployed: 1.5 in. WINDAGE ADJUSTMENT
- ~0.7 MOA (0.754"/100m) per click with a 14.5" sight radius
- ~0.5 MOA (0.547"/100m) per click with a 20" sight radius ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-rear-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-mbus-sight-rear-r-65.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-grip-ar15-m16-r-40.jpgitem.optacticalgear-pagem4accessories49MAG41624.9523.7Magpul MOE + Grip AR15/M16 (R)Magpul111The MOE+ Grip combines reinforced polymer body construction with comfortable, wrap-around rubber overmolding for maximum weapon control in adverse environments. With a similar shape to a 'medium' sized MIAD, this AR15/M16 drop-in design features a hard-polymer bottom edge to reduce the possibility of equipment snags or grip damage. The MOE+ Grip accepts optional storage cores for gear stowage and includes a basic grip cap. All mounting hardware included. NOTE: This grip will function properly with 7.62 NATO AR10/SR25 style of rifles but, depending on the make of the rifle, may or may not leave a gap between the 'beaver tail' and the receiver. This gap is purely aesthetic and will not affect function. Made in U.S.A. 1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-grip-ar15-m16-r-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-grip-ar15-m16-r-50.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-ar15-m16-grip-r-43.jpgitem.optacticalgear-pagem4accessories49MAG41519.9518.95Magpul MOE AR15/M16 Grip (R)Magpul111The Magpul Original Equipment Grip (MOE) is a cost-effective drop-in replacement for the standard pistol grip on AR15/M16 rifles. Designed with improved ergonomics and an anti-slip texture, the MOE Grip accepts standard Magpul MIAD storage cores, and is compatible with the Magpul Enhanced Aluminum Trigger Guard. Will not work with AR10® / SR25 style rifles without modification. MOE Grip includes a basic core plug and installation hardware. Features: • Hand-filling beavertail and positive anti-slip texture • One-piece construction sized the same as a MIAD grip with the A1 style (F1) front-strap and medium (B2) back-strap • Basic storage core cap is replaceable with standard MIAD cores Specifications • Weight: .182 pounds Colors: Flat Dark Earth, Olive, Black1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-ar15-m16-grip-r-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-ar15-m16-grip-r-53.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-enhanced-trigger-guard-polymer-ar15-m4-r-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-enhanced-trigger-guard-polymer-ar15-m4-r-17.jpgcustom-itemoptacticalgear-pagem4arupgrades49MAG11869.959.45Magpul MOE Enhanced Trigger Guard Polymer - AR15/M4 (R)Magpul111The MOE (Magpul Original Equipment) Enhanced Trigger Guard is a polymer drop-in replacement for the AR15 / M4 weapons platform. This upgraded trigger guard is easily installed without the use of specialized tools, using three set screws to secure it to the lower receiver. This eliminates the need to install a roll pin with a hammer and punch and greatly reduces the chance of any damage to the receiver due to improper installation or out-of-spec receivers. The MOE Enhanced Trigger Guard has an ergonomic and enlarged design to accommodate use with gloves or when shooting in cold environments and fills the annoying "gap" at the rear of the standard trigger guard. Also works well with most 7.62x51 AR platforms, but some custom fitting may be required. All mounting hardware included. Made in the U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-enhanced-trigger-guard-polymer-ar15-m4-r-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-enhanced-trigger-guard-polymer-ar15-m4-r-31.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-grip-ar15-m4-r-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-grip-ar15-m4-r-17.jpgcustom-itemoptacticalgear-pagem4accessories49MAG52220.9519.9Magpul MOE K2 Grip AR15/M4 (R)Magpul111Technical Specifications
• Platform: AR10, AR15, M4, M16, M110, SR25
• Grip Angle: 17 degrees
• Height, receiver to bottom: 4.1 in.
• Thickness, max: 1.2 in.
• Weight, w/ hardware: 2.9 oz.
• Other Specs: *NOTE: This grip will function properly with 7.62 NATO AR10/SR25 style of rifles but, depending on the make of the rifle, may or may not leave a gap between the backstrap's 'beaver tail' and the receiver. This gap is purely aesthetic and will not affect function.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-grip-ar15-m4-r-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-grip-ar15-m4-r-31.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-xl-grip-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-xl-grip-46.jpgcustom-itemoptacticalgear-pagem4accessories49MAG116523.9522.75Magpul MOE K2-XL GripMagpul111Technical Specifications
•Approximately 25% larger than MOE-K2 Grip
•More vertical angle provides optimal hand position for modern shooting techniques
•Design supports proper trigger finger placement
•Not compatible with current grip cores Made in the U.S.A.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-xl-grip-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-k2-xl-grip-60.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-rvg-rail-vertical-grip-r-39.jpgitem.optacticalgear-pagepiraandgesmr49MAG41224.9523.7Magpul MOE RVG Rail Vertical Grip (R)Magpul111Designed for use with milspec 1913 Picatinny rail hand guards, the RVG is a basic, light weight, cost-effective vertical fore grip. Shape is ergonomically designed for use as a traditional vertical grip. It has also been optimized for use with the "thumb break method" of shooting as taught by Magpul DynamicsSM. Includes a custom fitted universal mounting rail and all mounting hardware. Made in U.S.A. Colors: Flat Dark Earth, Olive, Black1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-rvg-rail-vertical-grip-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-rvg-rail-vertical-grip-r-49.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-carbine-stock-mil-spec-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-carbine-stock-mil-spec-r-46.jpgcustom-itemoptacticalgear-pagem4arbuttstocks49MAG34764.9561.7Magpul MOE SL Carbine Stock Mil-Spec (R)Magpul111FEATURES
-Mounts on mil-spec sized carbine receiver extension tube (not included) from manufacturers such as Colt, LMT, Ruger, S&W, SIG, and others
-Sloping cheek weld combines a slim profile with user comfort
-Dual-side release latch provides easy adjustment while remaining anti-snag
-Premium chrome-silicon lock spring provides positive locking and long service life
-Internal anti-rattle feature minimizes wobble on receiver extension tube
-Rubber butt-pad offers an anti-slip surface and increases impact protection
-Rollover on the toe allows for easier shoulder transitions and better fit when using body armor
-Compatible with Magpul ASAP®, ASAP® QD, and other receiver-mount sling attachments -Sling Mounts:
-Rear – Integral push-button QD swivel sling mount accommodates up to 1.5" swivels (ambidextrous)
-Rear/Bottom - 1.25" sling loop Made in U.S.A. NOTE: This stock is meant for Mil-Spec receiver extensions/buffer tubes only. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-carbine-stock-mil-spec-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-carbine-stock-mil-spec-r-60.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-grip-ar15-m4-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-grip-ar15-m4-r-42.jpgcustom-itemoptacticalgear-pagem4accessories49MAG53920.9519.9Magpul MOE SL Grip AR15/M4 (R)Magpul111FEATURES
-Replacement for AR15/M4 pistol-grip*
-More vertical grip angle than standard A2 grips
-Beavertail backstrap for enhanced ergonomics
-Slimmer thickness for a slightly smaller feel
-Aggressive TSP texture (Trapezoidal Surface Projections) for positive weapon control in all environments SPECIFICATIONS
-MOE SL Grip
-Weight, w/hardware: 2.8 oz.
-Height, receiver to bottom: 4.0 in.
-Thickness, max: 1.1 in. *NOTE: This grip will function properly with 7.62 NATO AR10/SR25 style of rifles but, depending on the make of the rifle, may or may not leave a gap between the backstrap's 'beaver tail' and the receiver. This gap is purely aesthetic and will not affect function. ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-grip-ar15-m4-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-moe-sl-grip-ar15-m4-r-56.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-ms4-dual-qd-sling-gen2-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-ms4-dual-qd-sling-gen2-45.jpgcustom-itemoptacticalgear-pagesiposl49MAG51869.9566.95Magpul MS4 Dual QD Sling GEN2Magpul111Features
-Heavy-duty push-button QD sling swivels for both one and two-point attachment
-Durable, precision-cast steel QD D-Ring allows for quick transition from one to two-point mode and is finished with Melonite for extreme resistance to wear and corrosion
-Custom 1.25 inch wide nylon webbing material is strong and wear resistant while remaining anti-chaff for user comfort
-Low-profile adjustment Slider for adding or removing sling tension in two-point mode with a single-hand
-Colored webbing has Near Infrared (NIR) treatment to reduce IR signature Sling Mounting -REAR/FRONT - Compatible with buttstocks, end plates, receivers, and hand guards that have a QD socket as well as the Magpul ASAP®-QD, RSA®-QD, MSA™-QD, and shotgun Forward Sling Mounts This Item is Excluded from Limited Sale Coupon Codes ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-ms4-dual-qd-sling-gen2-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-ms4-dual-qd-sling-gen2-59.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-15-gl9-glock-19-magazine-r-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-15-gl9-glock-19-magazine-r-49.jpgcustom-itemoptacticalgear-pagemainco49MAG55014.9514.2Magpul PMAG 15 GL9 - GLOCK 19 Magazine (R)Magpul111-Compatible with all compact and sub-compact 9mm Glock handguns
-Durable, lightweight, and extremely stiff polymer construction
-High visibility controlled-tilt follower
-Long life stainless steel spring for corrosion resistance
-Flared, easily removable floor plate
-Dot matrix panel for magazine marking and identification
-Full magazine indicator windows on both sides of body
-Drops free loaded or unloaded Color: black This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-15-gl9-glock-19-magazine-r-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-15-gl9-glock-19-magazine-r-61.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-17-gl9-glock-g17-r-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-17-gl9-glock-g17-r-58.jpgcustom-itemoptacticalgear-pagemainco49MAG54614.9514.2Magpul PMAG 17 GL9 – GLOCK G17 (R)Magpul111This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-17-gl9-glock-g17-r-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-17-gl9-glock-g17-r-70.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-21-gl9-glock-9x19mm-parabellum-r-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-21-gl9-glock-9x19mm-parabellum-r-36.jpgcustom-itemoptacticalgear-pagemainco49MAG66119.9518.95Magpul PMAG 21 GL9 – GLOCK 9x19mm (R)Magpul111FEATURES
-Compatible with all full-size, compact, and sub-compact 9mm double-stack Glock handguns
-Durable, lightweight, and extremely stiff polymer construction
-High visibility controlled-tilt follower
-Long life stainless steel spring for corrosion resistance
-Flared, easily removable floor plate
-Dot matrix panel for magazine marking and identification
-Magazine indicator windows on both sides of body at 10, 15, and 21 rounds remaining
-Drops free loaded or unloaded This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-21-gl9-glock-9x19mm-parabellum-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-21-gl9-glock-9x19mm-parabellum-r-45.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m2-moe-5-56x45mm-nato-r-43.jpgcustom-itemoptacticalgear-pagemainco49MAG57112.9512.3Magpul PMAG 30 AR/M4 GEN M2 MOE 5.56x45mm NATO (R)Magpul111FEATURES
-Impact and crush resistant polymer construction
-Constant-curve internal geometry for smooth feeding
-Anti-tilt, self-lubricating follower for increased reliability
-USGI-spec stainless steel spring for corrosion resistance and field compatibility
-Textured gripping surface and flared floorplate for positive magazine handling and easy disassembly This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m2-moe-5-56x45mm-nato-r-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m2-moe-5-56x45mm-nato-r-51.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-r-67.jpgcustom-itemoptacticalgear-pagemainco49MAG55714.9514.2Magpul PMAG 30 AR/M4 GEN M3 (R)Magpul111• Next-generation impact and crush resistant polymer construction
• Modified dimensions allow for wider compatibility with non Colt-spec platforms
• Constant-curve internal geometry for smooth feeding
• Anti-tilt, self-lubricating follower for increased reliability
• Long life USGI-spec stainless steel spring
• Over-travel insertion stop on the spine
• Ribbed gripping surface and new aggressive front and rear texture for positive magazine handling
• Paint pen dot matrix panels on the bottom of the body to allow for identification marking
• Flared floorplate aids magazine handling and disassembly yet is slim enough for use with many double and triple pouches
• Pop-off Impact/Dust Cover to minimize debris intrusion and for additional protection in storage and transit Made in the USA. NOTE - Sand color is a very light shade of tan. It is designed so the user can dye or spray paint the magazine to a desired color/pattern. This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-r-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-r-75.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-window-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-window-r-62.jpgcustom-itemoptacticalgear-pagemainco4955617.9517.05Magpul PMAG 30 AR/M4 GEN M3 - WINDOW (R)Magpul111• Next-generation impact and crush resistant polymer construction
• Modified dimensions allow for wider compatibility with non Colt-spec 'STANAG 4179' platforms
• Constant-curve internal geometry for smooth feeding
• Anti-tilt, self-lubricating follower for increased reliability
• Long life USGI-spec stainless steel spring, black-oxide coated (MIL-DTL-13924D)
• Anti-glare translucent MagLevel windows on both sides of the body along with a painted indicator on the spring allows for easy determination of rounds remaining from 1 to 30
• Over-travel insertion stop on the spine
• Ribbed gripping surface and new aggressive front and rear texture for positive magazine handling
• Paint pen dot matrix panels on the bottom of the body to allow for identification marking
• Flared floorplate aids magazine handling and disassembly yet is slim enough for use with many double and triple pouches
• Pop-off Impact/Dust Cover to minimize debris intrusion and for ammunition protection in storage and transit This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-window-r-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-30-ar-m4-gen-m3-window-r-74.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-d-60-ar-m4-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-d-60-ar-m4-45.jpgcustom-itemoptacticalgear-pagemainco49MAG576134.95128.2Magpul PMAG D-60 AR/M4 (R)Magpul111This item can only ship to USA addresses (CONUS). No sales in the USA to the following States: CA, MA, NY, NJ, MD, CO, CT, D.C., HI and IL. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-d-60-ar-m4-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-pmag-d-60-ar-m4-54.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-black-frame-polarized-bronze-lens-gold-mirror-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-black-frame-polarized-bronze-lens-gold-mirror-34.jpgcustom-itemoptacticalgear-pagemagpuleyewear49MAG11450011110125115Magpul Radius - Black Frame - Polarized Gray Lens - Silver Mirror - Ballistic RatedMagpul111thprcanexyou19RUGGED AND RELIABLE
- Designed to combine rugged strength and flexibility with maximum overall coverage
- Outstanding impact resistance, even at low temperatures
- Chemical and stress-crack resistant
- UV resistant SUPERIOR PROTECTION
- The lens and frame combination of the Radius is ballistic rated to Z87+ and MIL-PRF 32432 standards
- Lenses meet high velocity impact protection and safety ratings
- Frames are constructed of TR90NZZ, combining lightweight construction and extreme ballistic protection PREMIUM FEATURES BUILT-IN
- Oleophobic treatment of lenses provides liquid & other chemical protection + scratch resistance.
- Anti-reflective coating on inside of lenses minimizes distracting reflections
- Coated stainless steel pins provide simple but dependable hinge functionality COMFORTABLE AND COMPATIBLE WITH YOU AND YOUR GEAR
- Padded low profile temples integrate smoothly under helmets, communication headsets and over the ear hearing protection while providing comfort with rubber nose and temple pads
- Rubber nose and temple pads are overmolded to the frame for durability
- Fits medium to large faces]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-radius-black-frame-polarized-bronze-lens-gold-mirror-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-black-frame-polarized-bronze-lens-gold-mirror-44.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-fde-frame-polarized-gray-lens-silver-mirror-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-fde-frame-polarized-gray-lens-silver-mirror-34.jpgcustom-itemoptacticalgear-pagemagpuleyewear49MAG11452451110125115Magpul Radius - FDE Frame - Polarized Gray Lens - Silver Mirror - Ballistic RatedMagpul111thprcanexyou20RUGGED AND RELIABLE
- Designed to combine rugged strength and flexibility with maximum overall coverage
- Outstanding impact resistance, even at low temperatures
- Chemical and stress-crack resistant
- UV resistant SUPERIOR PROTECTION
- The lens and frame combination of the Radius is ballistic rated to Z87+ and MIL-PRF 32432 standards
- Lenses meet high velocity impact protection and safety ratings
- Frames are constructed of TR90NZZ, combining lightweight construction and extreme ballistic protection PREMIUM FEATURES BUILT-IN
- Oleophobic treatment of lenses provides liquid & other chemical protection + scratch resistance.
- Anti-reflective coating on inside of lenses minimizes distracting reflections
- Coated stainless steel pins provide simple but dependable hinge functionality COMFORTABLE AND COMPATIBLE WITH YOU AND YOUR GEAR
- Padded low profile temples integrate smoothly under helmets, communication headsets and over the ear hearing protection while providing comfort with rubber nose and temple pads
- Rubber nose and temple pads are overmolded to the frame for durability
- Fits medium to large faces]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-radius-fde-frame-polarized-gray-lens-silver-mirror-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-radius-fde-frame-polarized-gray-lens-silver-mirror-44.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-rail-sling-attachment-r-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-rail-sling-attachment-r-51.jpgitem.optacticalgear-pageramoslat49MAG50229.9528.45Magpul RSA - Rail Sling Attachment (R)Magpul111The RSA provides a forward sling attachment point for the Magpul MS2 or MS3 and other clip-in systems. Made from precision cast black manganese phosphatized steel, the RSA attaches to any MIL-STD-1913 Picatinny/STANAG 4694 rail. The RSA has been proven to withstand stress tests of over 300 pounds yet weighs a mere 1.26 ounces. Made in U.S.A. Features •All cast steel construction •Mil-spec black manganese phosphate finish •Works on any standard 1913 Picatinny-spec rail1https://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-rail-sling-attachment-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-rail-sling-attachment-r-65.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-qd-rail-sling-attachment-qd-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-qd-rail-sling-attachment-qd-17.jpgcustom-itemoptacticalgear-pageramoslat49MAG33729.9528.45Magpul RSA QD - Rail Sling Attachment QDMagpul111Details
• Compatible with 1913 rails
• Low Profile, Unobtrusive Design - The RSA's design is optimized for comfortable two-point sling use while maintaining easy push-button access
• Secure Attachment Point - Provides a forward sling attachment point for the MS4 and other QD swing swivel systems Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-qd-rail-sling-attachment-qd-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-rsa-qd-rail-sling-attachment-qd-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-tejas-gun-belt-el-original-1-5-inch-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-tejas-gun-belt-el-original-1-5-inch-47.jpgcustom-itemoptacticalgear-pageriggersbelts49MAG73394.9590.2Magpul Tejas El Original Hybrid Gun Belt 2.0Magpul111Made in the USA. FEATURES:
• Top grade bullhide leather exterior layer and supportive but flexible reinforced polymer interior
• Gun belt rigidity with dress belt comfort offers stretch and sag free performance
• Removable chrome plated buckle with branded "tool-free" fasteners
• Standard 1.5" wide and 0.25" thick to fit most belt loops and holsters
• Eight holes with 3/4" spacing for a wide yet precise adjustment range BELT SIZING:
DO NOT order your waist size or pants size! Lay an existing belt out flat and from where the leather folds at the point where the buckle is attached, measure to the hole that you typically use. Please remember when ordering to take into account any holster or accessory that may be worn. For in-between measurements use the next size up as our belts will not stretch over time. We size our belts from the fold in the leather to the #5 adjustment hole. CARE AND MAINTENANCE:
While the inner polymer layer of our belt is largely maintenance free, the outer layer will need to be cared for like any other quality leather item.
• Do not roll up your belt unnecessarily tight when not in use
• When putting your belt on, avoid bending it back over the buckle more than 90 degrees when tightening as this may strain the leather and weaken the stitching
• While our belts will not stretch due to the reinforced polymer inner layer, avoid using leather softeners such as Neatsfoot or Mink oil
• If necessary, a quality paste-style leather preservative may be used to maintain the leather surface
• If the surface is ever scratched down to the natural beige leather the appropriate shade of shoe polish will help restore the color ]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-tejas-gun-belt-el-original-1-5-inch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-tejas-gun-belt-el-original-1-5-inch-57.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-wck-wire-control-kit-m-lok-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-wck-wire-control-kit-m-lok-17.jpgcustom-itemoptacticalgear-pagemamsy49MAG129619.95Magpul WCK - Wire Control Kit - M-LOKMagpul111The Magpul WCK (Wire Control Kit) provides a fast, secure, and clean way to manage light and laser wires to create a more streamlined forend on your rifle. The WCK ships with six easy-to-install M-LOK-compatible assemblies. Each assembly is a half-slot size to allow for precise positioning and can route cables straight through, at 90 degrees, or at 180 degrees to accommodate different variations. This kit can be reconfigured as your setup changes, removing the need to reapply tape or zip ties. The WCK is compatible with metal M-LOK handguards and may not fit all polymer handguards. The WCK can route standard gauge cables. Designed and intended for light/laser cable management Half-slot size allows for precise positioning Can be reconfigured multiple times Six (6) assemblies per package Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/magpul-wck-wire-control-kit-m-lok-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-wck-wire-control-kit-m-lok-30.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-modular-rail-covers-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-modular-rail-covers-61.jpgitem.optacticalgear-pagepiraandgesmr49MAG41011.9511.35Magpul XTM Enhanced Rail PanelsMagpul111 The XTM Enhanced Rail Panels are low-profile, two-piece covers that attach anywhere on a 1913 Picatinny rail without having to remove previously mounted accessories. Replacing the original XTM Panels, The Enhanced XTM Panels feature an aggressive anti-slip texture and dual-side routing clips for retention of light/laser cables. The design and reinforced material construction ensure the panels will remain in place under all operating conditions, but allows for easy removal using the tips of two rounds when necessary. Each set comes with four (4) two-piece panels which will cover ONE side of a carbine rail. Made in U.S.A.1https://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-modular-rail-covers-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-modular-rail-covers-71.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-hand-stop-kit-1913-picatinny-r-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-hand-stop-kit-1913-picatinny-r-47.jpgcustom-itemoptacticalgear-pagepiraandgesmr49MAG51119.9518.95Magpul XTM Hand Stop Kit 1913 Picatinny (R)Magpul111This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-hand-stop-kit-1913-picatinny-r-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/magpul-xtm-hand-stop-kit-1913-picatinny-r-61.jpgMagpulhttps://s.turbifycdn.com/aah/optacticalgear/marco-demo-video-11.jpglink.blfogetebepo1https://s.turbifycdn.com/aah/optacticalgear/marco-demo-video-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/marco-demo-video-10.jpglink.blfogemamali1https://s.turbifycdn.com/aah/optacticalgear/mayflower-velocity-systems-chest-rigs-30.jpgcustom-itemoptacticalgear-pagevestsMayflower / Velocity Systems Chest Rigs1mauwchriggenmapuuwgenvipmauwgenvspfrma5hychrigexmaremedpofmauwgenivert1https://s.turbifycdn.com/aah/optacticalgear/mayflower-velocity-systems-chest-rigs-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-velocity-systems-chest-rigs-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-groin-protector-carrier-with-level-iiia-soft-armor-r-46.jpgitem.optacticalgear-pagedysoar50VS-DP-MF180173Mayflower / Velocity Systems LE Groin Protector with Level IIIA Soft Armor (R)Mayflower111• Fits: Mayflower Low Profile Armor and Assault Carriers (LPAC and LPAAC)
• Attachment: Quick Release Buckles
• Size Carrier: One Size
• All materials and workmanship are 100% made in the USA Dyneema Ballistic Specifications:
• NIJ Certified: Type/Level III-A
• Ballistic Material: 100% Dyneema
• Ballistic Panel Thinness: 0.22 inches
• Weight: 0.99 lbs./sq.ft
• Fragmentation: Meets/Exceeds USSOCOM & IOTV requirements Made in the USA. O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. There are no returns or exchanges on body armor items This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-groin-protector-carrier-with-level-iiia-soft-armor-r-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-groin-protector-carrier-with-level-iiia-soft-armor-r-53.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-24-hour-assault-pack-fixed-shoulder-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-24-hour-assault-pack-fixed-shoulder-44.jpgcustom-itemoptacticalgear-pageassaultpacks50MF-APF143134Mayflower 24 Hour Assault Pack - Fixed ShoulderMayflower111This model also includes adjustable shock cord on the front face (Not Pictured) for compression and to stow an outer garment for easy accessibility. Features:
• Lightweight and slim for CQB environments
• 24 hour dismounted operations
• Standalone assault pack with fixed shoulder straps
• Sleeve and hanger for 2L (50oz.) hydration bladder (not included); small hose pass thru slot at the top of the pack
• Small cell phone / sensitive items pocket
• PALS webbing on exterior sides for adding additional pouches
• All buckles are ITW-Nexus IR
• Dimensions: L16”x W9”x D5”
• Volume: Approximately 10 Liters Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-24-hour-assault-pack-fixed-shoulder-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-24-hour-assault-pack-fixed-shoulder-60.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-48-hour-assault-pack-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-48-hour-assault-pack-44.jpgcustom-itemoptacticalgear-pageassaultpacks50MF-49FS184159Mayflower 48 Hour Assault PackMayflower111• 3 storage pockets
• Breathable Mesh with padding along the backside of the pack
• Padded shoulder straps with soft tweave stretch material on the inner face for added comfort
• Removable sternum strap
• Internal water bladder pocket
• Internal zipper pocket for small accessories
• Open top bottle pocket on the right side includes a bungee cord with adjustable loop to slip over the top of water bottles for extra security with quick access
• 3 rows of PALS webbing on left side
• Small section of velcro loop for patches or IFF
• Side tension straps to compress unused space in the pack
• Dimensions: L18”x W11”x D6”
• 100% Made in the USA]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-48-hour-assault-pack-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-48-hour-assault-pack-60.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-5-56-hybrid-chest-rig-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-5-56-hybrid-chest-rig-41.jpgcustom-itemoptacticalgear-pagemavesychri50MF-CR7187172Mayflower 5.56 Hybrid Chest RigMayflower111• Low profile, light weight general purpose chest rig
• Carries four 5.56mm magazines (6.8mm or similar sized)
• Three general purpose pouches
• Three rows of PALS webbing on sides of chest rig
• Built in map pocket with a VELCRO® Brand closure
• Loops to route antennas, wires and hydration bladder tubing
• Four one inch ITW-Nexus side release buckles
• Designed to mount to front of Low-Profile Armor Carrier
• Comes with the new gen adjustable-height Standard H-Harness with vertical loops for PTT's (Pictured is the old gen)
• 100% Made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-5-56-hybrid-chest-rig-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-5-56-hybrid-chest-rig-55.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-apc-with-mesh-padding-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-apc-with-mesh-padding-57.jpgcustom-itemoptacticalgear-pagemarcasplcaaa50MF-PC276239.99Mayflower APC with Mesh PaddingMayflower111litoswplandr1Custom Patterns in Multicam Arid, Multicam Tropic, and M81 Woodland available in limited quantities! The Mayflower / Velocity Systems Assault Plate Carrier (APC) is designed to provide the wearer with a high degree of mobility while providing ample surface area for mounting mission essential pouches. The upper front of the APC contains an integral admin pouch with internal elastic loops to retain pens, pencils, chemlites or similar items. There is an additional pocket in front of the admin pouch to hold quick access documents like maps/index cards. The front lower half of the APC has a kangaroo pouch sized to hold up to three M4 sized magazines. A triple M4 pouch insert is available separately to fit this integrated pouch. This vest is also SwiftClip compatible to quickly attach chest rigs and placards. New slimline should pads are made from stretchable Tweave material that allows for slings, hydration tubing and communications wiring to fit through the pad easily. Slim design for greater range of motion and less chafing along neck line. Foam padding for comfort on the underside of pad. The APC features removable SwiftClip® Buckles on the front panel and velcro loop on the 3 rows of MOLLE along the bottom half of the front panel of the carrier to allow the individual to mount various chest rigs and placards directly to the carrier. This configuration allows the individual to use the same loadout with or without armor or have multiple chest rigs configured for different mission requirements. Cummerbund Features:
• Integrated PALS webbing
• Inner side of cummerbund features elastic pockets on each side to hold M4 mags, radios, tourniquets, etc.
• Cummerbund is made to Soft armor inserts, and can also fit thin 6x6 inch side plates in a separate pocket (may require an additional retainer strap to secure the top of a hard plate). Use same size Velocity Systems soft armor cummerbund insert as the size of the cummerbund.
• Adjustable for different waist sizes and features elastic ends for some stretch to allow easy breathing. Plate Sizing:
The APC is available in two sizes; Small/Medium and Large/XLarge. The plate pockets are sized to accommodate stand alone or in-conjunction SAPI or Swimmer cut plates. The S/M APC will fit small and medium SAPI, or Shooter/Swimmer Cut 10”x12” sized plates. The L/XL APC will fit large and extra-large SAPI plates. Cummerbund Sizing:
Cummerbund has a wide range of adjustment, when in doubt go with the larger cummerbund size, as your armor will increase the diameter of the carrier once inserted. Most users who wear a Medium SAPI plate will need the Medium Cummerbund.
• Small Cummerbund: 5 Columns of MOLLE per side (Normally Small SAPI Plate Users)
• Medium Cummerbund: 6 Columns of MOLLE per side (Normally Medium or Large SAPI Plate Users)
• Large Cummerbund: 8 Columns of MOLLE per side (Normally Large or XL SAPI Plate Users) Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-apc-with-mesh-padding-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-apc-with-mesh-padding-70.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assault-back-panel-type-1-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assault-back-panel-type-1-69.jpgitem.optacticalgear-pageassaultpacks50VS-MF-BP-XX182176Mayflower Assault Back Panel Type 1 MOD 2 - Helium WhisperMayflower111The Assault Back Panel Type 1 Mod 2 HW features Blue Force Gear's Helium Whisper ultra-light weight backing for greater weight savings and a slimmer profile. Designed to carry the minimum amount of kit for a short duration dismounted mission. The main body has been redesigned to carry a greater variety of 50-70 oz water bladders; the upper zippered pouch is designed to hold the SOCOM issued NVG protective insert, the bottom pouch is designed as a re-moveable medical pouch. The re-moveable medical pouch features internal elastic retainers, a flat Velcro external pouch and elastic on the bottom to hold a tourniquet. Small velcro loop square is sewn on the pouch for adding a Red Cross patch. The attachment is via the PALS compatible Helium Whisper system. All workmanship is 100% made in the USA. Fabric: 500D Cordura, Helium Whisper backing material.1https://s.turbifycdn.com/aah/optacticalgear/mayflower-assault-back-panel-type-1-80.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assault-back-panel-type-1-81.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assaulter-arm-board-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assaulter-arm-board-54.jpgitem.optacticalgear-pagewrdoho50VS-AAB-MF4037.99Mayflower Assaulter Arm BoardMayflower111The Assaulter Arm Board is designed to have schematics, target photos or comms procedures readily available. The Assaulter Arm Board provides three viewable surfaces; a flap which is viewable on both sides and the base. All materials and workmanship are 100% made in the USA. Material: 500D Cordura1https://s.turbifycdn.com/aah/optacticalgear/mayflower-assaulter-arm-board-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-assaulter-arm-board-68.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-cummerbund-pals-22.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-cummerbund-pals-with-6-x-6-plate-pocket-37.jpgitem.optacticalgear-pagecaac150VS-CBN384Mayflower Cummerbund - MOLLE VersionMayflower111Sizing: Based on Chest Measurement (measure from under your arm pits), if you are in between sizes or need more space, go up to the larger size.
-Small (32”-44”): 5 columns of MOLLE per side
-Medium (40”-50”): 6 columns of MOLLE per side
-Large (44”-54”): 8 columns of MOLLE per side
-X-Large (50”-60”): 10 columns of MOLLE per side There is a wide amount of adjustment on the cummerbunds. All materials and workmanship are 100% made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-cummerbund-pals-with-6-x-6-plate-pocket-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-cummerbund-pals-with-6-x-6-plate-pocket-45.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-hodge-defense-universal-case-96.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-hodge-defense-universal-case-95.jpgcustom-itemoptacticalgear-pageblah50MF-HGC249219.95Mayflower Hodge Defense Universal Case V2Mayflower111What is the difference between V1 and V2?
With the growing popularity of LPVOs among end users, OPT had Mayflower add a middle strap to the bag, due to billowing created by the larger optics. Universal Case Options:
• Universal Case Only: Just the rifle case
• Universal Case and Hodge Bolt Carrier Group - Chrome Carrier Key Model Package Deal: Get 10% off both items when bundled together! (you save over $40 when bundled) Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-hodge-defense-universal-case-104.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-hodge-defense-universal-case-105.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-armor-carrier-89.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-armor-carrier-88.jpgitem.optacticalgear-pagemaveclqaco50 VS-CMF-LPAC268232Mayflower Low Profile Armor Carrier with Divider CummerbundMayflower111litolpsoar1Now includes the Low-Profile Elastic Cummerbund with Dividers (2 Divider Pockets per side)! The Mayflower Low-Profile Armor Carrier (LPAC) is designed to provide the wearer with a high degree of mobility while providing an acceptable amount of soft armor coverage, or both soft and hard armor coverage. The hard armor plates are contained in pockets attached to the outside of the soft armor carrier allowing the soft armor to mold to the wearers body for long duration mission comfort. The back side of the front panel features elastic retainers for routing wires. The Low-Profile Armor Carrier features webbing for use with Removable ITW-Nexus SwiftClip Buckles on the front of the vest to allow the individual to mount various Chest Rigs and Placards directly to the carrier. This configuration allows the individual to use the same loadout with or without armor or have multiple chest rigs configured for different mission requirements. The vest also includes a front kangaroo pouch that accepts our magazine inserts. The LPAC comes with a Low-Profile Elastic Cummerbund and features removable buckles to attach a groin/lap panel (sold separately). All materials and workmanship are 100% made in the USA. Features:
• Features 3D spacer mesh padding along the inner face of the plate pockets for comfort and ventilation
• Compatible with SwiftClip Chest Rigs and Placards (SwiftClips on the front are removable)
• Low-Profile Elastic Cummerbund with Dividers for quick don/doff and secure fit while moving/fighting, also ensures no interference with duty belt access. Cummerbund features 2 x Divider Pockets per side to fit M4 sized mags, radios, medical and other similar sized items. Can be replaced with the Mayflower MOLLE Cummerbund (sold separately) for load and armor carriage
• Integrated Drag Handle
• MOLLE webbing along the lower rear portion of the carrier for attaching IFAK/Medical Kit and other mission essentials
• Stretchable shoulder pads made from soft Tweave material offer greater range of motion and less chafing along the neck line. Foam padding for comfort on the underside of the pad, with the ability to run wiring and tubes through the pad itself
• Material: 500D Cordura This vest is designed to fit proprietary soft armor inserts (see link below). Some other brands of soft armor may fit depending on size. Approximate dimensions of front and back panels:
Medium:
• Front Panel: Height Lowest part of the V portion of the neck = 14”, Height Tallest part of the V portion = 15.5”
• Front Panel Thinnest Width = 11", Widest Width = 22”
• Back Panel: Height = 16"
• Back Panel: Thinnest Width = 12", Widest Width =” x 22.5” Large:
• Front Panel: Height Lowest part of the V portion of the neck = 14.5”, Height Tallest part of the V portion = 16”
• Front Panel Thinnest Width = 11", Widest Width = 24.5”
• Back Panel: Height = 17"
• Back Panel: Thinnest Width = 12.5", Widest Width = 24.5” XL:
• Front Panel: Height Lowest part of the V portion of the neck = 15”, Height Tallest part of the V portion = 17”,
• Front Panel Thinnest Width = 11.5", Widest Width = 26.5”
• Back Panel: Height = 18"
• Back Panel: Thinnest Width = 13", Widest Width =” x 26” ]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-armor-carrier-99.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-armor-carrier-100.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-assault-armor-carrier-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-assault-armor-carrier-69.jpgitem.optacticalgear-pagemaveclqaco50 VS-CMF-LPAAC335285Mayflower Low-Profile Assault Armor Carrier with Mesh PaddingMayflower111litolpsoarThis vest now includes 3D spacer mesh padding along the inner face of the front and back panels for comfort and ventilation! The Low-Profile Assault Armor Carrier (LPAAC) is designed to provide the wearer with a high degree of mobility while providing an acceptable amount of armor coverage. The hard armor plates are contained in pockets attached to the outside of the soft armor carrier allowing the soft armor to mold to the wearers body for long duration mission comfort. The front panel wings contain 3 rows x 3 columns of MOLLE webbing on the front side to secure radio pouches and other close to the body gear, and small elastic retainers on the back side to route wiring. The cummerbund is adjustable to allow for climatic changes and also for girth adjustments for the wearing of side armor plates. The cummerbund has integral pockets for 6" x 6" hard armor side plates and inner features elastic pockets on each side to hold M4 mags, radios, tourniquets and other similar sized gear. The LPAAC features removable SwiftClip® Buckles and velcro loop on the front of the vest to allow the individual to mount various chest rigs and placards directly to the carrier. This configuration allows the individual to use the same loadout with or without armor or have multiple chest rigs configured for different mission requirements. All materials and workmanship are 100% made in the USA. Also features removable buckles to attach a groin/lap panel (sold separately). Material: 500D Cordura Soft Tweave Stretch Padded Shoulder Sleeves now included. This vest is designed to fit proprietary soft armor inserts (see link below). Some other brands of soft armor may fit depending on size. Approximate dimensions of front and back panels:
Medium:
• Front Panel: Height Lowest part of the V portion of the neck = 14”, Height Tallest part of the V portion = 15.5”
• Front Panel Thinnest Width = 11", Widest Width = 22”
• Back Panel: Height = 16"
• Back Panel: Thinnest Width = 12", Widest Width =” x 22.5” Large:
• Front Panel: Height Lowest part of the V portion of the neck = 14.5”, Height Tallest part of the V portion = 16”
• Front Panel Thinnest Width = 11", Widest Width = 24.5”
• Back Panel: Height = 17"
• Back Panel: Thinnest Width = 12.5", Widest Width = 24.5” XL:
• Front Panel: Height Lowest part of the V portion of the neck = 15”, Height Tallest part of the V portion = 17”,
• Front Panel Thinnest Width = 11.5", Widest Width = 26.5”
• Back Panel: Height = 18"
• Back Panel: Thinnest Width = 13", Widest Width =” x 26” ]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-assault-armor-carrier-80.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-profile-assault-armor-carrier-81.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-vis-blowout-kit-helium-whisper-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-vis-blowout-kit-28.jpgcustom-itemoptacticalgear-pageinmedpoipo50MF-LVBOK103Mayflower Low-Vis Blowout Kit - Helium WhisperMayflower111Accessories shown not included. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-low-vis-blowout-kit-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-low-vis-blowout-kit-36.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-iv-ert-placard-80.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-iv-ert-placard-79.jpgcustom-itemoptacticalgear-pagemavesychri50UWGENIV-ERT203157Mayflower Modified Gen IV PlacardMayflower111litoswriandvCustom Patterns in Multicam Arid, Multicam Tropic, and M81 Woodland available in limited quantities! Multicam Arid, Multicam Tropic, and M81 Woodland options feature standard flap closures on the center double pistol pouches. Developed specifically for a Federal Law Enforcement Emergency Response Team, this placard is an upgraded and shortened version of the UW GEN IV Chest Rig designed work as a SwiftClip placard. This placard can directly attach to the front of any SwiftClip compatible armor carriers from Mayflower, Velocity Systems, and other companies. Features and Upgrades:
• Quad M4 Placard for holding 4 x 5.56 NATO Magazines
• Velcro-opening Admin Pocket behind the rifle magazines, large opening across the entire width and length of the placard
• 2 x Pistol Magazine pouches in the middle with flip-down flaps, which can secure open on the front of the pouches (Multicam Arid, Multicam Tropic, and M81 Woodland options feature standard flap closures on the center double pistol pouches)
• 2 x Small General Purpose Pouches for GPS units, full-size flashbangs, batteries, and other similar sized ancillaries
• 2 x Pistol/Flashlight/Multi-Tool pouches along the edges of the placard
• Elastic Retainers: 1 on each side and 2 on the bottom of the placard for securing tourniquets, antennas, etc.
• 3 x Webbing Loops along each side of the placard that can be used to secure the sides via the SwiftClip Kit (not necessary for most carriers, provides added security).
• 500D Cordura material. Back side of placard is completely velcro hook material. Placard only, all magazines and other items pictured not included. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-iv-ert-placard-90.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-iv-ert-placard-91.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-patch-48.jpgitem.optacticalgear-pagegrpa50VSPatchMF65Mayflower PatchMayflower1111https://s.turbifycdn.com/aah/optacticalgear/mayflower-patch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-patch-57.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-quad-5-56-placard-93.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-quad-5-56-placard-91.jpgcustom-itemoptacticalgear-pagemaveclqaco50MF-Q556Plac-XX95Mayflower Quad 5.56 PlacardMayflower111Custom Patterns in Multicam Arid, Multicam Tropic, and M81 Woodland available in limited quantities! The Quad 5.56 Placard is meant to be a smaller, lighter alternative to a full chest rig, and allows the end user to quickly change weapon systems without changing the rest of his/her operational equipment (radio, PTT, med etc). The Quad 5.56 Placard holds four 5.56 magazines with an adjustable shock cord retention system. The front of the placard also has three general purpose pouches, and a loop panel on the center pouch flap for ID Patches. The placard has upward facing male buckles to clip into a SwiftClip system on the chest of the APC or LPAC/LPAAC, Velocity Systems Lightweight Place Carrier or other carriers with SwiftClip systems. The back face of the placard has hook to mate with loop on the front chest flap of the carrier. All materials and workmanship are 100% made in the USA. NOTE: Your carrier must have Swift Clip/QASM attachment points on the front panel and Velcro Loop on the front flap portion in order to secure the placard in place effectively. For Maylflower/Velocity Systems Carriers, you may need to move Swift Clips on front panel down one column of webbing for best fit. Magazines and patch not included. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-quad-5-56-placard-102.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-quad-5-56-placard-103.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-r-c-assault-plate-carrier-apc-and-accessories-79.jpgcustom-itemoptacticalgear-pageplatecarriers1maapcwimepamaveclqacomacupawi6x6p1https://s.turbifycdn.com/aah/optacticalgear/mayflower-r-c-assault-plate-carrier-apc-and-accessories-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-r-c-assault-plate-carrier-apc-and-accessories-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-small-general-purpose-pouch-helium-whisper-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-small-general-purpose-pouch-36.jpgitem.optacticalgear-pagegepuutpo50VSSGPMF3028Mayflower Small General Purpose Pouch - Helium WhisperMayflower111The Small General Purpose Pouch is designed to hold a variety of small rectangular and irregular shaped items; GPS, firing systems, signal kits, cell phone, cameras etc. All materials and workmanship are 100% made in the USA. Now featuring Blue Force Gear Helium Whisper backing and MOLLE straps for ultra-light weight and slim design. Approximate Dimensions: 5 x 3.25 x 1.5 inches1https://s.turbifycdn.com/aah/optacticalgear/mayflower-small-general-purpose-pouch-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-small-general-purpose-pouch-43.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-swift-clip-kit-35.jpgitem.optacticalgear-pagehastd3rianda50VS-Swift2219.99Mayflower SwiftClip® KitMayflower1111https://s.turbifycdn.com/aah/optacticalgear/mayflower-swift-clip-kit-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-swift-clip-kit-42.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-tourniquet-retainer-40.jpgitem.optacticalgear-pagetourniquets50VSCATMF7Mayflower Tourniquet RetainerMayflower111This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-tourniquet-retainer-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-tourniquet-retainer-49.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-triple-5-56-mag-insert-for-apc-40.jpgitem.optacticalgear-pagekapoin50VS-5.56Insert-MF-CB35Mayflower Triple 5.56 Mag Insert for APCMayflower111This item is compatible with S&S Precision Pull Tabs. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-triple-5-56-mag-insert-for-apc-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-triple-5-56-mag-insert-for-apc-49.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-chest-rig-gen-iv-117.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-chest-rig-gen-iv-115.jpgitem.optacticalgear-pagemavesychri50VSCRMF1209199Mayflower UW Chest Rig Gen IVMayflower111litoremedpofCustom Patterns in Multicam Arid, Multicam Tropic, and M81 Woodland available in limited quantities! The UW Vest Gen IV is a low-profile mission focused vest built to be ambidextrous and designed to carry the following: 4 ea 5.56mm magazines, 2 pistol magazines, up to 2 small radios (PRC-152/MBITR) as well as two GP pockets. Additionally, the H style harness features loops to route antennas, comms wires and hydration bladder tubing. Elastic is provided for cable management and antenna relocation. All buckles are ITW-Nexus IR and all materials and workmanship are 100% made in the USA. The difference between the Gen III and the Gen IV is the total detachability of the harness on the Gen IV so the vest can integrate with Mayflowers body armor carriers. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-chest-rig-gen-iv-129.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-chest-rig-gen-iv-130.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-v-split-front-chest-rig-90.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-v-split-front-chest-rig-88.jpgcustom-itemoptacticalgear-pagemavesychri50MF-CR9-XX287Mayflower UW GEN V Split Front Chest RigMayflower1112 x Double 5.56 inserts
2 x Double 7.62x51 inserts
2 x Double 7.62x39 inserts
1 x Zipper pocket top insert
1 x IFAK insert Magazines and medical bandages not included. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-v-split-front-chest-rig-101.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-uw-gen-v-split-front-chest-rig-102.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mayflower-pusher-uw-gen-vi-pusher-chest-rig-91.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-pusher-uw-gen-vi-pusher-chest-rig-90.jpgcustom-itemoptacticalgear-pagemavesychri50MF-UW-GenVI240Mayflower UW Gen VI "Pusher" Chest RigMayflower111Custom Patterns in Multicam Arid, Multicam Tropic, and M81 Woodland available in limited quantities! The Pusher Chest Rig (UW GEN VI) was designed as a no frills load carriage solution for individuals that had a very specific load out to carry but also had to be able to quickly switch weapon platforms. The Pusher was designed to carry the following: issue radio (PRC-152, PRC-148, Motorola, or others), four rifle magazines (M4, 7.62x51 or 7.62x39 utilizing different inserts), pistol magazine, med kit or SAT Antenna and a multitude of smaller items in the front four pouches. The body features an internal map pocket. The shoulder straps are 3" wide to provide longer term comfort during extended mountain patrolling and are adjustable for height on the front of the straps. All buckles are ITW-Nexus and all materials and workmanship are 100% made in the USA. Shoulder Strap height is adjusted by removing the detachable female-end Swift Clip buckles and re-attaching to the webbing at desired height. Chest Rig includes:
2 x Double 5.56 inserts
2 x Double 7.62x51 inserts
2 x Double 7.62x39 inserts
1 x Quad-fold IFAK insert
1 x GP Zipper Pocket top insert Material: 500D Cordura body, Hypalon shoulder straps.
NOTE - Multicam-Tropic colors feature 500D Cordura Shoulder Straps. Magazines, radios, patches and medical bandages not included. Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-pusher-uw-gen-vi-pusher-chest-rig-100.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-pusher-uw-gen-vi-pusher-chest-rig-101.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-hot-tamale-less-lethal-coin-purse-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-hot-tamale-less-lethal-coin-purse-41.jpgcustom-itemoptacticalgear-pageknandsh11410-HT-XX36.95Mean Gene Leather Hot Tamale V1 Coin PurseMean Gene Leather111The legality of owning, carrying or using this product depends on state and local laws and ordinances. Each consumer should be familiar with the state and local laws in the consumer’s jurisdiction before purchasing, carrying or using this product. Note - Brown color option is shown in the smaller inset picture labeled as "Brown" (lighter color).]]>1https://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-hot-tamale-less-lethal-coin-purse-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-hot-tamale-less-lethal-coin-purse-51.jpgMean Gene Leatherhttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-shooters-belt-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-shooters-belt-55.jpgcustom-itemoptacticalgear-pageriggersbelts1142150BX89.9580.95Mean Gene Leather Shooters Belt - Double StitchedMean Gene Leather111-1.5 width
-Double Stitched for Strength, stitching color matches belt color. **Sizing is determined by size of pants you wear. We take in consideration of added lengths to assure proper fit. For best results in sizing, determine your pants waist size from a new pair of blue jeans as they are more accurate. Waistbands of worn pants tend to stretch.** Hand made in the USA by the man himself.]]>1https://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-shooters-belt-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-shooters-belt-65.jpgMean Gene Leatherhttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-victory-aegis-belt-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-victory-aegis-belt-68.jpgcustom-itemoptacticalgear-pageriggersbelts1143150XX125115Mean Gene Leather Victory Aegis Belt - Gen 2 Buckle - Double StitchedMean Gene Leather111New Gen 2 Polymer Buckles are now being used. All metal Gen 1 buckles are not manufactured anymore. Gen 2 buckles are much lighter in weight and do not jingle while dawning. Also more Airport friendly. The MGL “Victory Aegis” Belt utilizes the Ares Gear LLC. Aegis Buckle. These belts are constructed with a dual layer of top grain leather. Giving a desirably stable belt to support holsters-either OWB or IWB- yet comfortable to the feel. Its combination of the two layers of 7/8oz and 8/9oz leather delivers just over a 1/4” thickness. The Victory Aegis belt is reinforced between the two layers to add strength and reduce the amount of stretching as time passes. Each layer is laminated together with industrial strength adhesives, as well as sewn together with #277 bonded threads. Chicago screws to secure the Aegis buckle. The MGL Victory Aegis belt is handmade using US leather. The outer layer is dyed while the inner layer has a clear finish. Finally, the edges are burnished, edge dyed and the belt is then rubbed down by hand with Ray Holes Saddle Butter. Available only in 1.5″ width. **Sizing is determined by size of pants you wear. We take in consideration of added lengths to assure proper fit. For best results in sizing, determine your pants waist size from a new pair of blue jeans as they are more accurate. Waistbands of worn pants tend to stretch.** Features:
• Stitching: Double Stitch
• Thread Color: Matches belt color
• Reinforced between leather layers for sturdy gun belt level stiffness
• New Gen 2 Polymer Buckle for reduced weight and noise Hand made in the USA by the man himself.]]>1https://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-victory-aegis-belt-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/mean-gene-leather-victory-aegis-belt-78.jpgMean Gene Leatherhttps://s.turbifycdn.com/aah/optacticalgear/mechanix-fastfit-gloves-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-fastfit-gloves-62.jpgcustom-itemoptacticalgear-pagegloves44MFF19.9917.49Mechanix FastFit GlovesMechanix Wear111FEATURES 1. Form-fitting TrekDry® material with MultiCam® camouflage helps keep hands cool and comfortable. 2. Elastic cuff provides a secure fit with easy on/off flexibility. 3. Reinforced thumb and index finger provide added durability. 4. Durable synthetic palm. 5. Anatomically designed two-piece palm eliminates material bunching. 6. Nylon cord loop provides convenient glove storage. 7. Machine washable. ]]>1https://s.turbifycdn.com/aah/optacticalgear/mechanix-fastfit-gloves-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-fastfit-gloves-76.jpgMechanix Wearhttps://s.turbifycdn.com/aah/optacticalgear/mechanix-original-glove-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-original-glove-66.jpgitem.optacticalgear-pagegloves44MG31.9926.99Mechanix Original GloveMechanix Wear111Designed and manufactured to take on the toughest tasks you can throw at it, our Original Glove provides a winning combination of versatility and performance. The Clarino Synthetic Leather palm and fingertips extends the life of the glove while the Thermal Plastic Rubber hook and loop cuff closure and two-way stretch Spandex top provides a perfect fit. Imported Sizing: Small = 8 Medium = 9 Large = 10 XLarge = 11 2XLarge = 12 Large picture is Multicam color, small picture is Camo color.1https://s.turbifycdn.com/aah/optacticalgear/mechanix-original-glove-79.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-original-glove-80.jpgMechanix Wearhttps://s.turbifycdn.com/aah/optacticalgear/mechanix-specialty-0-5mm-tactical-gloves-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-specialty-0-5mm-tactical-gloves-44.jpgcustom-itemoptacticalgear-pagegloves44MSD-72-XXX3529.99Mechanix Specialty 0.5mm Tactical GlovesMechanix Wear111• Low-profile Thermoplastic Rubber (TPR) closure provides a secure fit to the wrist.
• Lightweight TrekDry® conforms to the back of the hand to reduce heat build-up and perspiration.
• Anatomical stitch darts conform to the natural curvature of the hand to create a precision fit.
• Expandable flex joints improve trigger finger mobility.
• High-dexterity 0.5mm AX-Suede™ provides precision feel and high dexterity.
• Nylon carrier loops.
• Machine washable. ]]>1https://s.turbifycdn.com/aah/optacticalgear/mechanix-specialty-0-5mm-tactical-gloves-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mechanix-specialty-0-5mm-tactical-gloves-58.jpgMechanix Wearhttps://s.turbifycdn.com/aah/optacticalgear/medical-29.jpgitem.optacticalgear-pageindexMedical / Survival1medicalpatchestourniquetsbandagesinmedpoipomedicalpackssukiandtobe7horetonarquli1https://s.turbifycdn.com/aah/optacticalgear/medical-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/medical-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/medical-packs-50.jpgitem.optacticalgear-pagemesuhyMedical Packs1spsydebagtam9asmebaGreat for all things medical, but also great for those who need their gear very well organized and retained during movement, such as EOD, Geologists, Photographers, Electronic Surveillance Teams, etc...]]>1https://s.turbifycdn.com/aah/optacticalgear/medical-packs-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/medical-packs-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/medical-patches-50.jpgcustom-itemoptacticalgear-pagepaemMedical Patches1bloodtypetapesredcrosspatchspviirmecrparedcrredcrreha4papa1https://s.turbifycdn.com/aah/optacticalgear/medical-patches-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/medical-patches-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-4-x-8-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-4-x-8-48.jpgcustom-itemoptacticalgear-pagecaac1XXCP60Microbat Systems Candy 4 x 8Microbat Systems111Velcro Hook Attachment. This is NOT a MOLLE Pouch. The Candy Pouch is the first product ever designed by Microbat Systems, being the bigger brother of the Candy Micro. The Candies dimensions are 4"x8" with a 2"x7" Loop Velcro strip on the frontside. With similar features to the Candy Micro, the Candy gives the user a larger space to work with, allowing for higher capacity storage. It is ideal for storage of batteries, chem-lights, disposable strobes, critical medical supplies and navigational information/ tools. The Candy is intended for use on the front or back of chest rigs and plate carriers, however it can also be used for compartmentalization and interior storage for packs, etc. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-4-x-8-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-4-x-8-61.jpgMicrobat Systemshttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-micro-4-x-4-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-micro-4-x-4-48.jpgcustom-itemoptacticalgear-pagecaac1XXCPM40Microbat Systems Candy Micro 4 x 4Microbat Systems111Velcro Hook Attachment. This is NOT a MOLLE Pouch. The Candy Micro is a Velcro backed 4"x4" pouch with a 4"x2" Loop Velcro strip on the frontside for identifier patches. The Candy Micro has nearly unlimited uses, Micro's can fill roles of exterior organization of critical items on Chest Rigs and Plate Carriers, compartmentalization inside backpacks or supplemental storage on the upper sleeves of combat shirts. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-micro-4-x-4-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-micro-4-x-4-61.jpgMicrobat Systemshttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-mid-4-x-6-36.jpgcustom-itemoptacticalgear-pagecaac1XXCPMM50Microbat Systems Candy Mid 4 x 6Microbat Systems111Velcro Hook Attachment. This is NOT a MOLLE Pouch. The Candy Mid is the Middle Size Candy, Intermediately Between the Candy and Candy Micro. The Mid's dimensions are 4"x6" with a 2"x6" Loop Velcro strip on the frontside. With similar features to the Candy Micro and Candy, the Candy Mid gives the End User an Admin Compatible Pouch for Most Plate Carriers, It's ideal for storage of batteries, chem-lights, disposable strobes, critical medical supplies and navigational information/ tools. The CandyMid is intended for use on the front or back of chest rigs and plate carriers, however it can also be used for compartmentalization and interior storage. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-mid-4-x-6-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-candy-mid-4-x-6-45.jpgMicrobat Systemshttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-chameleon-wrap-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-chameleon-wrap-48.jpgcustom-itemoptacticalgear-pageshvescbaXXCW40Microbat Systems Chameleon WrapMicrobat Systems111 Designed to Quickly and Efficiently Change the Figure and Pattern of the End Users Weapon System, Chameleon Wrap uses High Strength Elastic Bungee Loops and Hooks to Quickly Attach to Any Part of the Front and Rear end of the Weapon. If Multiple Chameleon Wraps Are bought they can be Changed to a Mix of Color ways to Best Fit the End Users Environment. Length: approximately 5 feet Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/microbat-systems-chameleon-wrap-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-chameleon-wrap-62.jpgMicrobat Systemshttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-vampire-flathead-counterweight-31.jpgcustom-itemoptacticalgear-pageheacandweXXVFC60Microbat Systems Vampire Flathead CounterweightMicrobat Systems111This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/microbat-systems-vampire-flathead-counterweight-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/microbat-systems-vampire-flathead-counterweight-40.jpgMicrobat Systemshttps://s.turbifycdn.com/aah/optacticalgear/military-morons-write-up-11.jpglink.crpraiheta3h1https://s.turbifycdn.com/aah/optacticalgear/military-morons-write-up-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/military-morons-write-up-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-g-i-3-pack-t-shirts-for-issued-uniforms-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-g-i-3-pack-t-shirts-46.jpgitem.optacticalgear-pagetshirts46M280/319.9917.99MJ SOFFE Adult G.I. 3-Pack T-Shirts for Issued UniformsMJ SOFFE111The preferred T-Shirt of the military in tropical environments. Tan/OCP goes with New Scorpion Pattern ACUs, Sand goes with UCP ACUs, Olive for USMC. •Adult size •50% Cotton, 50% Polyester jersey •Lightweight 4 ounce fabric •Crewneck •Sold as a pack of 3 shirts Made in the USA1https://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-g-i-3-pack-t-shirts-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-g-i-3-pack-t-shirts-53.jpgMJ SOFFEhttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-tricot-running-shorts-ranger-panties-39.jpgitem.optacticalgear-pageshorts46M02014.9912.99MJ SOFFE Adult Tricot Running Shorts (Ranger Panties)MJ SOFFE111sizechartCommonly referred to as "Silkies" or "Ranger Panties" •Adult size •100% lightweight nylon tricot •Running short •Liner brief •Inside key pocket •2 - 2¼ inch inseam on all sizes •Covered elastic waistband •Colors: Black, Olive, Navy, Tan/OCP1https://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-tricot-running-shorts-ranger-panties-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-adult-tricot-running-shorts-ranger-panties-49.jpgMJ SOFFEhttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-performance-shorts-33.jpgcustom-itemoptacticalgear-pageshorts46031M19.9917.99MJ SOFFE Infantry ShortsMJ SOFFE111• 100% poly Sorbtek shell
• 100% poly liner brief
• Moisture management technology
• Dries 4 times faster than cotton
• 4 way stretch fabric
• 4" inseam
• Inside ID pocket]]>1https://s.turbifycdn.com/aah/optacticalgear/mj-soffe-performance-shorts-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/mj-soffe-performance-shorts-40.jpgMJ SOFFEhttps://s.turbifycdn.com/aah/optacticalgear/keeppower-18350-1200mah-protected-button-top-2-pack-36.jpgcustom-itemoptacticalgear-pagebach135183502PK20Modlite 18350 1200mAh Protected Button Top - 2 PackModlite111Specifications:
- Typical Capacity: 1200 mAh
- Nominal Voltage: 3.6V
- Discharge End Voltage: 2.5V
- Protection Circuit (Against over charge, over discharge, over current and short-circuit.) Dimensions:
- (L) 38.1 mm x (D)18.6 mm Warnings:
- Do not overdischarge/overcharge
- Recharge drained batteries ASAP
- Do not short circuit
- Do not dispose of in fire
- Do not expose to extreme heat or water
- Please be familiar with handling lithium-ion batteries before purchase. Please note: Due to the nature of this consumable product, no returns are allowed unless the product is defective upon receipt. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/keeppower-18350-1200mah-protected-button-top-2-pack-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/keeppower-18350-1200mah-protected-button-top-2-pack-43.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-18350-body-package-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-18350-body-package-34.jpgcustom-itemoptacticalgear-page15offmodlite13518350BDY72Modlite 18350 BodyModlite111This light body is ONLY compatible with the Surefire® Scout Light M600DF KE2-DF head. It is approximately 1.25 inches shorter and about 1.5oz lighter than a M600DF body with battery. This allows for additional rail space especially on SBR and pistol builds. The Modlite 18350 light body is compatible with Surefire® z68, Modlite TCC tailcaps along with Surefire® UE and DS00 tail caps. It will also fit in any aftermarket Scout mount, as it retains the mounting holes and square lug interface on the underside of the light body. Modlite recommends Arisaka Defense mounts which can be found at OPT. CAUTION: This light body accepts 18350 cells only. Lithium CR123 cells are NOT supported and if used will cause the CR123 cells to heat up and possibly explode or catch fire. If you need a charger please take a look at our Li-Ion chargers sold separately. Run time is about 35 minutes with the KE2-DF head and a freshly charged battery. 18350 Body Only. 18350 Rechargeable Battery Sold Separately. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-18350-body-package-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-18350-body-package-44.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/keeppower-18650-3500mah-protected-cell-2-pack-41.jpgcustom-itemoptacticalgear-pagebach13518650PC2PK35Modlite 18650 3500mAh Protected Cell - 2 PackModlite111Specifications:
- Nominal Capacity: 3500 mAh
- Nominal Voltage: 3.6V
- Discharge End Voltage: 2.5V
- Max. Continuous Discharging Current: 10A Dimensions:
- 69.10 mm (L) x 18.60 mm (D) Protection Circuit (Over charge, over discharge, over current, and short-circuit) Warnings:
- Do not overdischarge/overcharge
- Recharge drained batteries ASAP
- Do not short circuit
- Do not dispose of in fire
- Do not expose to extreme heat or water
- Please be familiar with handling lithium-ion batteries before purchase. Please note: Due to the nature of this is a consumable product, no returns are allowed unless the product is defective upon receipt. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/keeppower-18650-3500mah-protected-cell-2-pack-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/keeppower-18650-3500mah-protected-cell-2-pack-48.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-18650-body-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-18650-body-42.jpgcustom-itemoptacticalgear-page15offmodlite13518350BODY74Modlite 18650 BodyModlite111Lithium CR123 cells are not supported with this product unless used with our OKW Dual Fuel Head. If CR123s are used with a standard Modlite head, it will cause the cells to heat up and possibly explode or catch fire. We recommend our Modlite Protected Cells.
Weight (W/O Battery): .9 oz
Width/Diameter: 1" (no head)
Length (no tailcap): 2 1/8 " (no head)
Length + Clicky Tailcap: 4 " 18650 Body Only. 18650 Rechargeable Battery Sold Separately. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-18650-body-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-18650-body-56.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-okw-18650-light-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-okw-18650-light-65.jpgcustom-itemoptacticalgear-page15offmodlite135HHOKW18650309Modlite Handheld Multi-Mode OKW-18650 LightModlite111• Multi-Mode
• Dual Fuel 18650 or x2 CR123
• 680 Lumens
• 69,000 Candela
• Includes Thyrm LPC
• Made in the USA
• Lifetime guarantee
• Drivers are fully potted and tested.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance Dimensions:
• Length: 5 3/8" / 136.5mm
• Body Diameter: .990" / 25.1mm
• Head Diameter: 1 3/16" / 30mm CAUTION: Lithium CR123 cells are NOT supported and if used will cause the cells to heat up and possibly explode or catch fire. We recommend the KeepPower 18650 high drain cells available from OPT. Run time is about 75 minutes with the supplied 18650 cells. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-okw-18650-light-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-okw-18650-light-79.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-plhv2-18650-light-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-plhv2-18650-light-60.jpgcustom-itemoptacticalgear-page15offmodlite135PLHv2-HANDHELD309Modlite Handheld Multi-Mode PLHv2-18650 LightModlite111• Multi-Mode
• Dual Fuel 18650 or x2 CR123
• 1350 Lumens
• 54,000 Candela
• Includes Thyrm LPC
• Cool White 5700K emitter tint
• Made and assembled in the USA
• Drivers are fully potted and tested to withstand select fire SCAR 17 recoil.
• Lifetime guarantee
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dimensions:
• Length w/ Clicky tailcap: 5 1/2" / 140mm
• Head Diameter: 1 3/16" / 30.16mm Lithium CR123 cells are not supported and if used will cause the cells to heat up and possibly explode or catch fire. We recommend the KeepPower 18650 high drain cells which can be found here. Runtime is about 75 minutes with the supplied 18650 cells. Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-plhv2-18650-light-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-handheld-plhv2-18650-light-74.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/15-off-modlite-42.jpgcustom-itemoptacticalgear-pagelightslasersModlite Lights and Parts1modlitepl350rmopllipar1moplliparmopllihemooklipamomookliparmookwlihemomolisuplmomolilaplmomolidulemomoligumohapllimohaoklimo18bopamo18boonehucolionehucosh1https://s.turbifycdn.com/aah/optacticalgear/15-off-modlite-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/15-off-modlite-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-dual-lead-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-dual-lead-48.jpgcustom-itemoptacticalgear-page15offmodlite135MBL2149Modlite ModButton Lite - Dual LeadModlite111NO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. ModButton Lite is a smaller, lighter-weight cousin to the original ModButton. The switch features the same momentary only activation as the original ModButton. It also features the same high power cable and switch from ModButton but in a slightly smaller package without the integrated mount. The switch is made from injection-molded plastic and fully potted to provide an extra degree of protection in harsh environments and ensures a durable long-lasting switch. The Dual Lead variant is our same Modbutton Lite, but has both a Surefire®/Modlite and Crane Laser lead. This Modbutton Lite activates both leads simultaneously, allowing for an excellent vis override functionality of both white light and visible laser. There is no way to select a single lead for activation. For that, we recommend the Unity TAPS SNYC. Available here. ModButton Lite utilizes a patented Unity Tactical design which supports power delivery needed by the next generation of high output weapon lights like Modlite. A Unity-built Surefire® compatible cable lead allows ModButton Lite to be backwardly compatible with all Surefire®, Arisaka, and Modlite Scout bodies as well as Surefire UE and DS00 tail caps. If constant on is a requirement we recommend using a SF DS00 tail cap which can be found here. One problem that exists today is older legacy switches are not able to pass the current needed to run current and future generation lights. These older switch designs do not allow Modlite light heads to run at full power. Typically these switches reduce output by 15-20%. ModButton Lite utilizes an updated plug design as well as improved electronics that allow the ModButton Lite to output at full power so all the lumens and candela can be put to good use. The package includes the switch picatinny mounting rails and mounting hardware only, no tail cap is supplied. We recommend the Surefire UE or DS00 tailcap. Note on cable length options: For almost all use cases the 4.5in variant is what you want to buy. Unless you have a special setup the 4.5 in cable is going to be plenty even running a laser. Made in the USA Specs:
• Weight: 1.8oz
• Dimensions: 1.0 × 3.8 × 5.7 in
• Mounting Side: Left or Right
• Color: Black or Tan NO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-dual-lead-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-dual-lead-62.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-laser-plug-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-laser-plug-46.jpgcustom-itemoptacticalgear-page15offmodlite13585000896512878Modlite ModButton Lite - Laser PlugModlite111NO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. Note on cable length options: For almost all use cases the 4.5 inch variant is what you want to buy. Unless you have a special setup the 4.5 inch cable is going to be plenty even running a laser. ModButton Lite is a smaller lighter weight cousin to the original ModButton. The switch features the same momentary only activation as the original ModButton. It also features the same high power cable and switch from ModButton but in a slightly smaller package without the integrated mount. The switch is made from injection molded plastic and fully potted to provide extra degree of protection in harsh environments ensures a durable long lasting switch. The plug is compatible with PEQ15, DBAL, BE Meyers® MAWL™ and Wilcox® RAIDx™ lasers. The package includes the switch PIC mounting rail and mounting hardware only. Note on cable length options: For almost all use cases the 4.5 inch variant is what you want to buy. Unless you have a special setup the 4.5 inch cable is going to be plenty even running a laser. Specs:
• Weight: 1.8 oz
• Dimensions: 1.0 × 3.8 × 5.7 in
• Mounting Side: Left or Right Made in the USA. NO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-laser-plug-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-laser-plug-60.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-surefire-modlite-plug-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-surefire-modlite-plug-44.jpgcustom-itemoptacticalgear-page15offmodlite13585000896578Modlite ModButton Lite - Surefire/Modlite PlugModlite111litosuuetaNO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. Note on cable length options: For almost all use cases the 4.5 inch variant is what you want to buy. Unless you have a special setup the 4.5 inch cable is going to be plenty even running a laser. ModButton Lite is a smaller lighter weight cousin to the original ModButton. The switch features the same momentary only activation as the original ModButton. It also features the same high power cable and switch from ModButton but in a slightly smaller package without the integrated mount. The switch is made from injection molded plastic and fully potted to provide extra degree of protection in harsh environments and ensures a durable long lasting switch. ModButton Lite utilizes a patented Unity Tactical design which supports power delivery needed by the next generation of high output weapon lights like Modlite. A Unity built Surefire® compatible cable lead allows ModButton Lite to be backwardly compatible with all Surefire®, Arisaka and Modlite Scout bodies as well as Surefire UE and DS00 tail caps. One problem that exists today is older legacy switches are not able to pass the current needed to run current and future generation lights. These older switch designs do not allow Modlite light heads to run at full power. Typically these switches reduce output by 15-20%. ModButton Lite utilizes an updated plug design as well as improved electronics that allow the ModButton Lite to output at full power so all the lumens and candela can be put to good use. The package includes the switch PIC mounting rails and mounting hardware only, no tail cap is supplied. We recommend the Surefire UE or DS00 tailcap. Note on cable length options: For almost all use cases the 4.5 inch variant is what you want to buy. Unless you have a special setup the 4.5 inch cable is going to be plenty even running a laser. Specs:
• Weight: 1.8oz
• Dimensions: 1.0 × 3.8 × 5.7 in
• Mounting Side: Left or Right Made in the USA. NO RETURNS on opened packaged Modbutton Lites. This is due to small parts and screws in the packaging. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-surefire-modlite-plug-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-surefire-modlite-plug-58.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-guards-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-guards-46.jpgcustom-itemoptacticalgear-page15offmodlite135MBLGRD1815Modlite Modbutton Lite GuardsModlite111Lite Guard ONLY. ModButton Lite Pressure Pad Sold Separately. This product is a direct replacement for the included picatinny rail clamps of the Modbutton Lite. The guards have raised sides and reduce the flat surface area of the button to ensure activation of the switch only occurs when absolutely intended. For those taking advantage of the ability to stack two Modbutton Lites together for white light and laser use, this is a great way to increase tactile feedback and to prevent white light activation when not intended. The package contains both sides of the guard set. Installation utilizes the screws and nuts that come with Modbutton Lite. Made in the USA Lite Guard ONLY. ModButton Lite Pressure Pad Sold Separately. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-guards-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modbutton-lite-guards-60.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-light-head-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-light-head-58.jpgcustom-itemoptacticalgear-page15offmodlite135OKWLH209Modlite OKW Light Head - Dual FuelModlite111Features:
- Hand assembled in and tested in the USA.
- Lifetime guarantee
- Approximately 680 out the front lumens and candela is approximately 69,000. This light is an excellent choice for anyone needing maximum throw.
- 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
- Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dual Fuel Marked Heads: Can be powered by a 18350, 18650 or x2 CR123. Using a single CR123 Battery may cause the cells to heat up and possibly explode or catch fire. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-okw-light-head-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-light-head-68.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-modlite-okw-18350-light-package-r-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modlite-okw-18350-light-package-r-55.jpgcustom-itemoptacticalgear-page15offmodlite135OKW-18350289Modlite OKW-18350 Light PackageModlite111• Compatible with Surefire Scout Mounts.
• Lifetime guarantee
• Approximately 680 out the front lumens and candela is approximately 69,000. It is an excellent overall light head good for indoor or outdoor use
• Drivers are fully potted and tested to withstand select fire SCAR 17 recoil
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance
• Includes 1 x KeepPower 1200mAh 18350 battery
• Includes XTAR MC2 charger Dimensions:
• Length w/ Clicky tailcap: 4.25" / 108mm
• Head Diameter: 1 3/16" / 30.16mm Made in the USA. CAUTION: Lithium CR123 cells are NOT supported and if used will cause the cells to heat up and possibly explode or catch fire. We recommend the KeepPower 18350 high drain cells available from OPT. Run time is about 35 minutes with the supplied 13650 cells. Types:
• Complete Light: includes Light with Clicky Tailcap (momentary and constant on), Recharger, 1 x 18350 KeepPower Rechargeable Battery
• Light with No Tailcap: includes Light without Tailcap ready for use with with Tape Switches and Caps, Recharger, 1 x KeepPower 18350 Rechargeable Battery Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-modlite-okw-18350-light-package-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-modlite-okw-18350-light-package-r-65.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-18650-light-package-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-18650-light-package-57.jpgcustom-itemoptacticalgear-page15offmodlite135OKW18650289Modlite OKW-18650 Light Package - Dual FuelModlite111• Compatible with Surefire Scout Mounts.
• Lifetime guarantee
• Approximately 680 out the front lumens and candela is approximately 69,000. It is an excellent overall light head good for indoor or outdoor use.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dual Fuel Marked Heads: Dual Fuel 18350/18650 or x2 CR123 (18650 body only). Using a single CR123 Battery may cause the cells to heat up and possibly explode or catch fire. Types:
• Complete Light: includes: Light with Clicky Tailcap (momentary and constant on), Recharger, 1 x 18650 KeepPower Rechargeable Battery
• Light with No Tailcap: includes: Light without Tailcap ready for use with with Tape Switches and Caps, Recharger, 1 x KeepPower 18650 Rechargeable Battery Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-okw-18650-light-package-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-okw-18650-light-package-67.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-pl350-r-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-pl350-r-50.jpgcustom-itemoptacticalgear-page15offmodlite135PL350319Modlite PL350 - All ModelsModlite111litoqustandhThe switch bar is now a solid injection-molded piece updated from the previous two- piece design. This one-piece design offers a significant upgrade to the durability of your light switch. Other internal changes to the switch components make for an improved tactile feel. Features:
• Modular design is compatible with all slim Modlite heads, which lets the end user customize the light output to their specific needs.
• The PL350 is designed to be compatible with current and future Modlite heads, ensuring long life and future upgrade paths.
• At launch the PL350 is well supported in the holster industry as well. Will fit Safariland 6000 series Duty Holsters designed to fit the X300 Ultra Weapon Light. See link below for more info different holsters compatibility.
• Lithium CR123 cells are not supported and if used will cause the cells to heat up and possibly explode or catch fire. We recommend our Modlite Protected Cells. Available Models: With or Without XTAR Charger Included PLHv2:
• 5700 Kelvin color temperature
• 1350 Lumens
• 54,000 Candela
• This model is the best all around, with both spill and long throw. If you are unsure which model to buy, we recommend this version. OKW:
• 5800 Kelvin color temperature
• 680 Lumens
• 69,000 Candela
• This model is designed for rural and outdoor use, where maximum throw is required. This head can still be used in close quarters but will have a brighter hot spot. Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-pl350-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-pl350-r-60.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-light-head-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-light-head-46.jpgcustom-itemoptacticalgear-page15offmodlite135PLHV2-HEAD209Modlite PLHv2 Light Head - Dual FuelModlite111• Cool White 5700K emitter tint
• Made and assembled in the USA
• Drivers are fully potted and tested to withstand select fire SCAR 17 recoil.
• Lifetime guarantee
• Approximately 1350 out the front lumens and candela is approximately 54,000. It is an excellent overall light head good for indoor or outdoor use.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dimensions:
• Length w/ Clicky tailcap: 5 1/2" / 140mm
• Head Diameter: 1 3/16" / 30.16mm
• Weight: 2.26oz Made in the USA. Dual Fuel Marked Heads: Can be powered by a 18350, 18650 or x2 CR123. Using a single CR123 Battery may cause the cells to heat up and possibly explode or catch fire. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-light-head-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-light-head-56.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18350-light-package-r-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18350-light-package-r-55.jpgcustom-itemoptacticalgear-page15offmodlite135PLH-18350v2289Modlite PLHv2-18350 Light PackageModlite111• Cool White 5700K emitter tint
• Compatible with Surefire Scout Mounts.
• Drivers are fully potted and tested to withstand select fire SCAR 17 recoil.
• Lifetime guarantee
• Approximately 1350 out the front lumens and candela is approximately 54,000. It is an excellent overall light head good for indoor or outdoor use.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dimensions:
• Length w/ Clicky tailcap: 5 1/2" / 140mm
• Head Diameter: 1 3/16" / 30.16mm Lithium CR123 cells are not supported and if used will cause the cells to heat up and possibly explode or catch fire. We recommend the KeepPower 18350 high drain cells which can be found here. Runtime is about 35 minutes with the supplied 18350 cells. Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18350-light-package-r-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18350-light-package-r-65.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18650-light-package-r-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18650-light-package-r-52.jpgcustom-itemoptacticalgear-page15offmodlite135PLHv2-18650289Modlite PLHv2-18650 Light Package - Dual FuelModlite111• Cool White 5700K emitter tint
• Compatible with Surefire Scout Mounts.
• Drivers are fully potted and tested to withstand select fire SCAR 17 recoil.
• Lifetime guarantee
• Approximately 1350 out the front lumens and candela is approximately 54,000. It is an excellent overall light head good for indoor or outdoor use.
• 6061 Series Alum bezel with Mil-Spec Hard Anodizing.
• Ultra clear BOROFLOAT® lens allows 98-99% light transmittance. Dimensions:
• Length w/ Clicky tailcap: 5 1/2" / 140mm
• Head Diameter: 1 3/16" / 30.16mm Dual Fuel Marked Heads: Dual Fuel 18350/18650 or x2 CR123 (18650 body only). Using a single CR123 Battery may cause the cells to heat up and possibly explode or catch fire. Made in the USA. Types:
• Complete Light: includes: Light with Clicky Tailcap (momentary and constant on), Recharger, 1 x 18650 KeepPower Rechargeable Battery
• Light with No Tailcap: includes: Light without Tailcap ready for use with with Tape Switches and Caps, Recharger, 1 x KeepPower 18650 Rechargeable Battery This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18650-light-package-r-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/modlite-plhv2-18650-light-package-r-62.jpgModlitehttps://s.turbifycdn.com/aah/optacticalgear/modtac-suppressor-shield-with-universal-rail-attach-coupler-u-rac-r-26.jpghttps://s.turbifycdn.com/aah/optacticalgear/modtac-suppressor-shield-with-universal-rail-attach-coupler-u-rac-r-24.jpgcustom-itemoptacticalgear-pagem4arupreandpXX-18B-004409Modtac Suppressor Shield with Universal Rail Attach Coupler (U-RAC) (R)Modtac111- The Suppressor Shield with Universal Rail Attached Coupler, was designed to be compatible with all AR-style platforms that have a top Picatinny rail on the end of the free floating handguard. The Heights over bore that Modtac uses, are industry standards, to ensure proper fitment:
- AR-15: 1.215”
- AR-10: 1.345”
- HK-416: 1.460”
- SIG MCX/MPX: 2.037 All Suppressor Shields will now include an installed end cap. The Pic-Rail Grabber is machined to be compatible with as many commercial and military rails as possible. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/modtac-suppressor-shield-with-universal-rail-attach-coupler-u-rac-r-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/modtac-suppressor-shield-with-universal-rail-attach-coupler-u-rac-r-37.jpgModtachttps://s.turbifycdn.com/aah/optacticalgear/molle-pals-webbing-belts-76.jpgitem.optacticalgear-pagebeltsMOLLE/PALS Webbing Belts / Unity Clutch Belt1fecobibeblfogechbegbgrasbesyv3raodmkiiibeeainopgunbeweainbeforopgblintrbemovehsmigrbepacrprmoribe20vesyoputbeohslaslpabeslhssupabehsslpabeatsmopawarbeatswarbeinbetwnebeskuntaclbeuntaclinkit1https://s.turbifycdn.com/aah/optacticalgear/molle-pals-webbing-belts-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/molle-pals-webbing-belts-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stew-pro-pak-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stew-pro-pak-12.jpgcustom-itemoptacticalgear-pagemohome5015711.99Mountain House Beef Stew Pro-Pak111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" A blend of tender diced beef, hearty gravy, carrots, peas, and potatoes are sure to give you that warm, fuzzy feeling of satisfaction. Ideal for warming up in the backcountry. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stew-pro-pak-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stew-pro-pak-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stroganoff-pro-pak-new-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stroganoff-pro-pak-new-57.jpgcustom-itemoptacticalgear-pagemohomemohobestprne10.99Mountain House Beef Stroganoff Pro-Pak NewMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Tender pieces of beef, tasty onions and mushrooms blended in a savory cream sauce over a bed of egg noodles. Packed with 27g of protein. With a dish this satisfying, you'll never guess that it's freeze-dried. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stroganoff-pro-pak-new-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-beef-stroganoff-pro-pak-new-72.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-biscuits-and-gravy-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-biscuits-and-gravy-43.jpgcustom-itemoptacticalgear-pagemohome12500554537.99Mountain House Biscuits and GravyMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House Biscuits and Gravy are a filling and delicious breakfast that you can enjoy anywhere, any time. Simply add hot water and you'll be ready to dig into a taste of home even if you're thousands of miles away. Made with real buttermilk biscuits, sausage patties and gravy, Mountain House Biscuits and Gravy are guaranteed to give you the fuel you need to tackle the day ahead. You won't even have to worry about packing a bowl or a plate - just add water to the Pouch and you're good to go. Homecooked, comforting flavor, wherever you are — that's what you can expect with Mountain House Biscuits and Gravy. Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-biscuits-and-gravy-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-biscuits-and-gravy-58.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-breakfast-skillet-pro-pak-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-breakfast-skillet-pro-pak-51.jpgcustom-itemoptacticalgear-pagemohome125005045110.99Mountain House Breakfast Skillet Pro-Pak NewMountain House Meals111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Gluten Free Filling hash browns, savory sausage, tasty veggies and scrambled eggs all team up to make the legendary Mountain House Breakfast Skillet. Bursting with flavor and 25g of protein, it's no wonder this is one of our most popular breakfast items for fueling explorers everywhere. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-breakfast-skillet-pro-pak-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-breakfast-skillet-pro-pak-63.jpgMountain House Mealshttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-buffalo-style-mac-and-cheese-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-buffalo-style-mac-and-cheese-43.jpgcustom-itemoptacticalgear-pagemohome125005510110.49Mountain House Buffalo Style Mac and CheeseMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Here's comfort food to the next level. This meal combines Mountain House's signature creamy Mac & Cheese with chicken and a spicy buffalo sauce and it doesn't hold back. Enjoy while camping, tailgating, or at home. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-buffalo-style-mac-and-cheese-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-buffalo-style-mac-and-cheese-58.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-dumplings-pro-pak-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-dumplings-pro-pak-12.jpgcustom-itemoptacticalgear-pagemohome5016511.99111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Developed to fuel you while you're bagging your next peak, we put a delicious twist on this Southern Comfort favorite. Layered with chicken, veggies, and velvety dumplings in a mouthwatering white gravy, this is the meal you've been waiting for. This freeze-dried meal contains 32g of protein and 580 calories. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-dumplings-pro-pak-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-dumplings-pro-pak-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-rice-pro-pak-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-rice-pro-pak-34.jpgcustom-itemoptacticalgear-pagemohome125005011510.99Mountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Gluten Free No matter the adventure, you need carbs and protein to keep you energized - and that's exactly what you'll get with Mountain House Chicken & Rice. Made with tender cooked chicken, zesty pimientos, hearty rice, packed with 43g of protein, this best-selling favorite has fueled explorers through power outages, snow storms, and backpacking excursions. Just add hot water and you'll be ready to enjoy a delicious, satisfying meal in minutes. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-rice-pro-pak-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-rice-pro-pak-46.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-fajita-pro-pak-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-fajita-pro-pak-12.jpgcustom-itemoptacticalgear-pagemohome5017511.99Mountain House Chicken Fajita Pro-Pak111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Wish you could take your favorite Tex-Mex cuisine with you on your next excursion? Now you can! Made with real pieces of tender, cooked chicken with just the right amount of spice. Rice, black beans, bell peppers, corn, onions, and seasonings blend together to make this meal all the more satisfying. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-fajita-pro-pak-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chicken-fajita-pro-pak-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chili-mac-with-beef-pro-pak-new-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chili-mac-with-beef-pro-pak-new-57.jpgcustom-itemoptacticalgear-pagemohomemohochmacwib110.99Mountain House Chili Mac with Beef Pro-Pak NewMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Whether you're trekking the Sierra Nevado or completing a success mission, our Mountain House Chili Mac is an insanely delicious meal that's guaranteed to fill you right up at the end of a long day. Made with pillowy macaroni noodles, savory precooked beef and yummy kidney beans in a tasty chili sauce, and packed with 30g of protein. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-chili-mac-with-beef-pro-pak-new-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-chili-mac-with-beef-pro-pak-new-72.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-classic-spaghetti-with-meat-sauce-pro-pak-new-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-classic-spaghetti-with-meat-sauce-pro-pak-new-63.jpgcustom-itemoptacticalgear-pagemohomemohoclspwime10.99Mountain House Classic Spaghetti with Meat Sauce Pro-Pak NewMountain House Meals111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" What better way to end a long day in the backcountry than with a hearty Italian meal? This meal gives you that wholesome, comforting flavor of Italian cooking in hardly any time at all. Tender spaghetti noodles, hearty chunks of beef, rich marinara sauce - what's there not to love? Plus, it's packed with 26g of protein to keep you fueled and ready for more. Expiration on this item is 5 years from date of manufacture. According to Mountain House, actual shelf life is 30 years. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-classic-spaghetti-with-meat-sauce-pro-pak-new-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-classic-spaghetti-with-meat-sauce-pro-pak-new-75.jpgMountain House Mealshttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-fettuccine-alfredo-with-chicken-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-fettuccine-alfredo-with-chicken-43.jpgcustom-itemoptacticalgear-pagemohome1250051789.99Mountain House Fettuccine Alfredo with ChickenMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Ready in 9 Minutes Looking for a home-cooked meal without the long prep or cleanup? Look no further than our Fettuccine Alfredo with Chicken. Our convenient just-add-water prep in the pouch means that you have more time to do what you love, without the hassles of cooking and cleanup. The pouch is durable and lightweight making it easy to pack and carry. Enjoy tender pasta in a delicious butter and parmesan sauce with hearty chunks of chicken any time, anywhere. Perfect for camping trips, backpacking, or just any time you want a tasty quick meal. Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-fettuccine-alfredo-with-chicken-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-fettuccine-alfredo-with-chicken-58.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-30.jpgcustom-itemoptacticalgear-pagemohome12500554505.99Mountain House Granola with Milk and BlueberriesMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain Gouse freeze-dried granola makes the perfect breakfast, snack or even dessert when you're craving something slightly sweet. Made with real blueberries, crunchy oats and powdered milk, Mountain House's Blueberry Granola has fueled everyone from United States Special Forces to explorers on Antarctic expeditions and everywhere in between. Simply add hot or cold water to eat as a cereal, or skip the prep altogether and enjoy it by itself. Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-40.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-military-meal-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-military-meal-43.jpgcustom-itemoptacticalgear-pagemohomemohogrwimian3.49Mountain House Granola with Milk and Blueberries - Military MealMountain House1111https://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-military-meal-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-granola-with-milk-and-blueberries-military-meal-56.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-homestyle-chicken-noodle-casserole-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-homestyle-chicken-noodle-casserole-45.jpgcustom-itemoptacticalgear-pagemohome125005016111.99Mountain House Homestyle Chicken Noodle Casserole - Pro-PakMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Savory chicken, mushrooms, celery, and green peppers - this meal hits the mark (and taste) when it comes to providing the fuel you need to get things done in the backcountry. Packed with 42g of protein and 640 calories, no better time than now to set a new PR. Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-homestyle-chicken-noodle-casserole-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-homestyle-chicken-noodle-casserole-57.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-meals-68.jpgcustom-itemoptacticalgear-pagehysyMountain House Meals1mohochriprmohobestprnemohochmacwib1mohoscegwiba2mohomestadrimohohochnocamohobrskpr1mohoclspwimemohochduprmohobestprmohochfaprmoholrpmemohogrwimianmohobiandgrmohogrwimian1mohovaicecrs1mohobustmacamohofealwichmohochanddumohochfabomohoclspwime11https://s.turbifycdn.com/aah/optacticalgear/mountain-house-meals-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-meals-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-mexican-style-adobo-rice-and-chicken-35.jpgcustom-itemoptacticalgear-pagemohome125005017111.99Mountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Rice, chicken, pinto beans, and veggies simmered in a delicious adobo sauce with a hint of lime to bring it to the next level. Packed with 33g of protein and 580 calories, roam the backcountry and reward yourself with south-of-the-border flavor. Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-mexican-style-adobo-rice-and-chicken-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-mexican-style-adobo-rice-and-chicken-43.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-scrambled-eggs-with-bacon-pro-pak-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-scrambled-eggs-with-bacon-pro-pak-55.jpgcustom-itemoptacticalgear-pagemohome125005045710.99Mountain House Scrambled Eggs with Bacon Pro-Pak NewMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Mountain House's new Pro-Pak meals. Increased protein, healthier contents than before. Ready in 10 minutes, just add boiling water. "Made to the exacting standards of the US Armed Forces for Long-Range Cold-Weather Patrols" Gluten Free Take all the prep work out of breakfast with our freeze-dried scrambled eggs and bacon. Just add hot water and you'll be ready to dig in to this classic hot breakfast anywhere under any circumstances. Loaded with 27g of protein to fuel your day. Expiration on this item is 5 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-scrambled-eggs-with-bacon-pro-pak-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-scrambled-eggs-with-bacon-pro-pak-67.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/moutain-house-lrp-meal-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/moutain-house-lrp-meal-49.jpgcustom-itemoptacticalgear-pagemohome1250067150913Mountain House Special Forces LRP MealsMountain House111If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. We put a bug in Mountain House's ear about this a while back, and apparently the tribe has spoken loud enough... These meals are much like MH Pro-Paks, with higher protein content and are easier to pack in a food bag or ruck for your mission, hike, adventure etc... These are actual LRP Entrees Mountain House makes for the United States Special Forces and Military Cold Weather Meals. Perfect for outdoor adventures or as food for your bug-out-bag. Expiration on this item is 3 years from date of manufacture guaranteed. According to Mountain House, actual shelf life is up to 30 years if stored properly. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/moutain-house-lrp-meal-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/moutain-house-lrp-meal-61.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-vanilla-ice-cream-sandwich-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-vanilla-ice-cream-sandwich-62.jpgcustom-itemoptacticalgear-pagemohome125535243.99Mountain House Vanilla Ice Cream SandwichMountain House111Freeze Dried Ice Cream Sandwiches - For Adventurers and Space! Great for Camping and Hiking Mountain House's Freeze-Dried Ice Cream Sandwich allows you to enjoy real ice cream without needing a freezer. Sound too good to be true? We can assure you it's no joke - our ice cream sandwich features delicious, creamy freeze-dried vanilla ice cream sandwiched between two chocolate cookes for a delicious treat that can be enjoyed anywhere. And best of all? It's ready to eat straight from the pouch - no water or waiting required! Is This a Real Space Ice Cream Sandwich? Yes, this is the same famous ice cream you've heard about! But did you know that this space ice cream never actually went to outer space? It's sad but true. The likely story is that while space freeze-dried ice cream was really made and tested for space, it was ultimately deemed too crumbly to eat in the spaceship. Whether you're traveling to outer space or taking the kids on their very first camping trip, the legendary Mountain House Freeze-Dried Ice Cream Sandwich will satisfy your sweet tooth. Treat yourself to a sweet morsel on your next adventure on this planet or on another - we promise you won't be disappointed! Expiration on this item is 30 years from date of manufacture NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mountain-house-vanilla-ice-cream-sandwich-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/mountain-house-vanilla-ice-cream-sandwich-75.jpgMountain Househttps://s.turbifycdn.com/aah/optacticalgear/mrds-mini-red-dot-sights-and-mounts-45.jpgcustom-itemoptacticalgear-pageopticsMRDS Mini Red Dot Sights, and Mounts1aiacp1raiglmosacmoptrrmrhdresirtrrmr3moaadrho50reddotmoledeproholosunhs507creoefmireddotardeofopmobaardeofopbapl1https://s.turbifycdn.com/aah/optacticalgear/mrds-mini-red-dot-sights-and-mounts-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/mrds-mini-red-dot-sights-and-mounts-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-cheese-spread-30.jpgcustom-itemoptacticalgear-pagehysyMRECHS1.891.75MRE Cheese SpreadOPT111120 calories
12gr Fat (7gr saturated fat)
30mg Cholesterol
430mg Sodium (Bacon, Jalapeño)
390mg Sodium (Cheddar)
0gr Carbohydrates
4gr Protein This is MRE cheese, it is no way health food, it's not gluten free, vegan, Halal, or Kosher. NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mre-cheese-spread-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-cheese-spread-40.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/mre-crackers-7.jpgcustom-itemoptacticalgear-pagehysymrecrackers2.291.99MRE Crackers1111 Serving per packet:
- 170 calories
- 5gr Fat (2.5gr saturated fat)
- 0mg Cholesterol
- 125mg Sodium
- 27gr Carbohydrates
- 1gr Dietary Fiber
- 0gr Sugars
- 4gr Protein These are MRE crackers, they are in no way health food, not gluten free, vegan, Halal, or Kosher. ]]>1https://s.turbifycdn.com/aah/optacticalgear/mre-crackers-8.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-crackers-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-giant-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-giant-12.jpgcustom-itemoptacticalgear-pagexmretoeatme95MREGC12999MRE Giant - Case of 12 Meals111UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. If ordering multiple boxes, additional shipping fees may apply. This is to due to item's size. NO RETURNS ON FOOD ITEMS US MILITARY GRADE: XMREs are packed fresh, battle tested and follow standards set by the U.S. Army Natick Soldier RD&E Center. Each case contains 12 rations with 12 menu options. Each meal provides 1,000 –1,300 calories of high quality nourishment. EMERGENCY & LAW ENFORCEMENT: XMREs provide maximum nourishment to first responders & public servants for sustained energy. This great tasting kit is fully cooked right out of the pouch for civilians and NGOs in emergency & natural disaster contexts. PORTABLE BALANCED NUTRITION: These delicious menus are nutrient diverse and can be heated in the pouch by the flameless heater. No water or refrigeration needed! When taste and nutrition matter, don’t settle for dehydrated dried meals, choose XMRE! LONG SHELF LIFE: Each survival food meal kit is lightweight, self contained and pre-packaged with utensils in our specially designed portable tamper and water proof pouch. Guaranteed 3 year extended shelf life with proper storage. TRUSTED BY EXPERTS: Made in the USA. XMREs exceed the highest military standards and critical requirements of government institutions, global humanitarian relief organizations, emergency preparedness, survivalists, outdoorsmen and first responders. Product Dimensions: 15.5 x 11 x 9.5 inches;
Weight: 16 lb UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. If ordering multiple boxes, additional shipping fees may apply. This is to due to item's size. NO RETURNS ON FOOD ITEMS This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mre-giant-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-giant-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-peanut-butter-30.jpgcustom-itemoptacticalgear-pagehysyMREPB1.891.75MRE Peanut ButterOPT1111 Serving per packet
150 Calories
12gr Fat (3gr saturated fat)
0mg Cholesterol
105mg Sodium
9gr Carbohydrates
2gr Dietary Fiber
5gr Protein PEANUT BUTTER:
1 Serving per packet
160 Calories
13gr Fat (2.5gr saturated fat)
0mg Cholesterol
135mg Sodium
6gr Carbohydrates
2gr Dietary Fiber
7gr Protein CHUNKY PEANUT BUTTER:
1 Serving per packet
160 Calories
13gr Fat (2.5gr saturated fat)
0mg Cholesterol
135mg Sodium
8gr Carbohydrates
2gr Dietary Fiber
7gr Protein This is MRE Peanut Butter, it is no way health food, it's not gluten free, vegan, Halal, or Kosher. Contains PEANUTS, Milk, Soy NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/mre-peanut-butter-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/mre-peanut-butter-40.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/msm-bottle-corset-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-bottle-corset-60.jpgcustom-itemoptacticalgear-pagewabopo54POUCH0001035MSM Bottle CorsetMil-Spec Monkey111Since we sell different bottle types we thought a versatile pouch would be appropriate. The MSM Bottle Corset design concept is to be a bottle holder that is very size flexible and built military tough. It can hold 32oz bottles such as the Nalgene while being adjustable down to small 12oz bottles. Being highly customizable, how the cords are routed allows the user to suit ease vs security needs; the bottom flap even allows for additional height adjustment. When not in use, the pouch can be stored flat and alternatively can hold other gear such as rifle magazines. The default cord routing has less power near the bottom to assist in one hand operation, but the user is encouraged to experiment adjusting both the cord routes and jump strap. Made by Tactical Tailor, Malice clips are included!1https://s.turbifycdn.com/aah/optacticalgear/msm-bottle-corset-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-bottle-corset-73.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-dlux-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-dlux-53.jpgitem.optacticalgear-pagebaseballhats54228MSM CG-Hat DLUXMil-Spec Monkey111Multicam color is made from softshell material and is highly water repellant]]>1https://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-dlux-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-dlux-67.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-raw-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-raw-66.jpgitem.optacticalgear-pagebaseballhats54124MSM CG-Hat RAWMil-Spec Monkey111 Due to a good response from MSM's DLUX hat, we now offer the RAW variant which is the same great quality, just without the integrated ear-pro. -FlexFit hat -top rivet removed -front panel is approx 4" x 3" -rear is 3" x 3" with a 5.5" x 1" strip at the bottom for name tapes -2" x 2" diamond up top for IR patches -edges sewn down for super smooth no snag functionality -bottom back has a lanyard attach point 2 Sizes: S/M 6 3/4” - 7 1/4” L/XL 7 1/8” - 7 5/8”1https://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-raw-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-cg-hat-raw-79.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-shear-pouch-plus-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-shear-pouch-plus-50.jpgcustom-itemoptacticalgear-pageinmedpoipo54pouch0001314MSM Shear Pouch Plus LaminateMil-Spec Monkey111A Malice clip is included for mounting, however NO shears, tourniquets, or other gear are included. Approx 2" x 6.5" (including strap) Made by Tactical Tailor. NO shears or tourniquets are included. Made in the USA by Tactical Tailor.]]>1https://s.turbifycdn.com/aah/optacticalgear/msm-shear-pouch-plus-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-shear-pouch-plus-60.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-small-patch-panel-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-small-patch-panel-66.jpgitem.optacticalgear-pageadminpouches54SPP24MSM Small Patch Panel Laminate - MOLLE FrontMil-Spec Monkey111(Patches and other gear however are not included)]]>1https://s.turbifycdn.com/aah/optacticalgear/msm-small-patch-panel-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-small-patch-panel-76.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-tac-organizer-pouch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-tac-organizer-pouch-64.jpgcustom-itemoptacticalgear-pageadminpouches54pouch-000120-XX35MSM Tac-Organizer PouchMil-Spec Monkey111 Based on the Stealth Admin pouch, we wanted to go with a slightly slimmed down and simplified version. The zippers go down further for wider access to the main compartment, yet stop soon enough so goods do not spill out. Interior has 3 billowed pockets on the frontal side and 2 billowed pockets on top of a sleeve pocket on the back interior side. The 3 pocket side fits multitool sized items great while the 2 pocket size can hold larger items like bandages and tourniquets. Instead of another compartment, the exterior has a sleeve stash pocket with security strap for shears or holding in papers. Security strap can be tucked into pocket when not needed or just cut off if never desired. To make up for the missing webbing on the sides, elastic pen holders have been added. 2 Color matched long Malice Clips included. Made by Tactical Tailor. Approximate Dimensions: 7" x 6.5" x 2+" (filled)1https://s.turbifycdn.com/aah/optacticalgear/msm-tac-organizer-pouch-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-tac-organizer-pouch-77.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-holster-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-holster-57.jpgcustom-itemoptacticalgear-pagecocavebaho54POUCH0001514MSM Wrap HolsterMil-Spec Monkey111WARNING:
Due to the highly customizable nature of this design care must be given to the setup when using with a pistol to make sure no extra overlaping material will get in the way of the trigger during draw or reholstering. USE AT YOUR OWN RISK! Like many holsters, long term use may scuff items inserted into this pouch.]]>1https://s.turbifycdn.com/aah/optacticalgear/msm-wrap-holster-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-holster-70.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-multi-pouch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-multi-pouch-64.jpgcustom-itemoptacticalgear-pagecocavebaho5400014-black-4in11MSM Wrap Multi PouchMil-Spec Monkey111One pouch per item.]]>1https://s.turbifycdn.com/aah/optacticalgear/msm-wrap-multi-pouch-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/msm-wrap-multi-pouch-77.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-claymore-bag-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-claymore-bag-36.jpgcustom-itemoptacticalgear-pagecobamanpumeb113MSWCLAY52.548.3MSW Claymore BagTactical Tailor111• Woodland BDU Camo: M81 Pattern
• Ranger Green
• Multicam]]>1https://s.turbifycdn.com/aah/optacticalgear/milsim-west-claymore-bag-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-claymore-bag-46.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-baofeng-radio-pouch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-baofeng-radio-pouch-48.jpgcustom-itemoptacticalgear-pageradiopouches113MSW0151.9547.79MSW Enhanced Baofeng Radio PouchTactical Tailor111The Need: The Baofeng UV5R is an extremely ubiquitous radio used around the world, both for hobby and professional usage. They are inexpensive, easy to program, but due to their compact size they don't fit well in standard radio pouches. Until now there has not been a commercially available radio pouch specifically sized and purpose built for Baofeng style radios. The Solution: Sized for Baofeng UV5R series radios with the extended battery pack, the MilSim West Radio Pouch is specifically designed for the needs of users from all ends of the spectrum, whether it be a warfighter, a downhill skier, or a mil-sim enthusiast. The MSW Enhanced Baofeng Pouch's fold down design, with vinyl window facilitates viewing the radio's face and channel selector. Improvements
-Elastic Webbing on the Flap for Chemlights
-Velcro on the Inside of the Pouch to prevent “side to side” wobble caused by heavier antennas.
-Opening on the side to accommodate accessory connectors without removing the radio from the pouch.
-Still fits the Baofeng UV5R radio WITH extended battery. Features
-500D Cordura
-3 inch Jacquard Webbing
-Attaches to standard MOLLE / PALS webbing
-Lightweight Large MALICE clips (x2)
-Manufactured by Tactical Tailor
-Uses 2 channels of PALS webbing on wearer's equipment Colors: Multicam, Ranger Green, Coyote Brown Pouch fits all UV-5R and UV-5RV2+ series radios.]]>1https://s.turbifycdn.com/aah/optacticalgear/milsim-west-baofeng-radio-pouch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-baofeng-radio-pouch-58.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-gopro-battery-pouch-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-gopro-battery-pouch-43.jpgcustom-itemoptacticalgear-pageheacandwe113MSW0020.518.99MSW GoPro Battery PouchTactical Tailor111Features:
-Velcro backed for easily attaching to helmets and other surfaces
-Velcro on the inside allows for the secure carrying of multiple sizes of battery packs as well as additional items such as batteries or weights. An included 1 inch velcro tie wraps around the battery pack and secures it to the inside.
-2x pieces of 1 inch elastic on each side of the pouch keeps the pouch nice and compact as well as allows for easy routing of cables.
-550 chord tie down points on the rear of the pouch to allow it to be securely attached to different points on the helmet or other surface.
-Velcro on the flap allows for attachment of IFF and morale pouches. As always, it is made in the USA by Tactical Tailor from USA made materials. No accessories included.]]>1https://s.turbifycdn.com/aah/optacticalgear/milsim-west-gopro-battery-pouch-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-gopro-battery-pouch-53.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/msw-lightweight-baofeng-radio-pouch-24.jpghttps://s.turbifycdn.com/aah/optacticalgear/msw-lightwieght-baofeng-radio-pouch-29.jpgcustom-itemoptacticalgear-pageradiopouches113MSW0622.7520.99MSW Lightweight Baofeng Radio Pouch Mil-Spec Monkey111The Need: The Baofeng UV5R is an extremely ubiquitous radio used around the world, both for hobby and professional usage. They are inexpensive, easy to program, but due to their compact size they don't fit well in standard radio pouches. Until now there has not been a commercially available radio pouch specifically sized and purpose built for Baofeng style radios. The Solution: Sized for Baofeng UV5R series radios with the extended battery pack, the MilSim West Radio Pouch is specifically designed for the needs of users from all ends of the spectrum, whether it be a warfighter, a downhill skier, or a mil-sim enthusiast. The MSW Enhanced Baofeng Pouch's fold down design, with vinyl window facilitates viewing the radio's face and channel selector. Improvements
-Single channel design takes up less space, creates capability to attach to single channel areas (shoulder straps)
-Hypalon Webbing on the Flap for attaching PALS compatible accessories
-Opening on the side to accommodate accessory connectors without removing the radio from the pouch.
-Still fits the Baofeng UV5R radio WITH extended battery. Features
-500D Cordura
-Hypalon
-Attaches to standard MOLLE / PALS webbing
-Lightweight Large MALICE clip (x1)
-Manufactured by Tactical Tailor
-Uses 1 channel of PALS webbing on wearer's equipment Colors: Multicam, Ranger Green, Coyote Brown Pouch fits all UV-5R and UV-5RV2+ series radios.]]>1https://s.turbifycdn.com/aah/optacticalgear/msw-lightwieght-baofeng-radio-pouch-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/msw-lightwieght-baofeng-radio-pouch-36.jpgMil-Spec Monkeyhttps://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-2-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-2-44.jpgcustom-itemoptacticalgear-pagebrtoki148-9993119.9517.95Multitasker NANO 2Multitasker Tools111DIMS: 1.2” x 0.5”
WEIGHT: Less than 1 oz
FEATURES:
• T10 Torx for Aimpoint ACRO P1/P2
• Light duty SLIM slotted screwdriver for Eotech EFLX, all Holosun, Leupold DeltaPoint Pro, Sig Romeo Pro1/Pro2, Steiner MPS, Trijicon RMR
• Also compatible with Aimpoint DUTY RDS and L3 HARRIS NGAL
• Lanyard hole accepts 550 paracord
• 420 stainless with Melonite® finish ]]>1https://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-2-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-2-58.jpgMultitasker Toolshttps://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-tool-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-tool-42.jpgcustom-itemoptacticalgear-pagebrtoki1489991118.9514.49Multitasker NANO Tool Multitasker Tools111• Size: 1.2 x 0.5 inches
• Weight: Less than 1 ounce
• Carry Options: Built-in lanyard hole and compatible with the integrated SpaceFrame locking storage slot on the front of the upcoming Gen3 MagPod®
• Material: 420 stainless with Melonite® finish ]]>1https://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-tool-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-nano-tool-56.jpgMultitasker Toolshttps://s.turbifycdn.com/aah/optacticalgear/multitasker-series-3x-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/noname1-29.jpgcustom-itemoptacticalgear-pagesukiandto14888611179.99149.99Multitasker Series 3X ToolMultitasker Tools111• CNC machined pliers (D2 tool steel) - Not investment cast
• Non-slip G10 scales (Black or Tan)
• 3/8" hex for LaRue mounts
• 1/2" hex for scope rings
• Dual lug M4 castle nut spanner wrench + screwdriver
• 3/32" pin punch with 8-32 male thread for OTIS cleaning kit compatibility
• Radiused tip carbon scraper
• 3" D2 tool steel knife blade - Plain edge or partially serrated
• Pocket clip (removable)
• 1/4" magnetic bit driver with M16A2 FSP adjuster
• Includes these commonly used hex bits and a convenient bit carrier: No.1 Phillips, 3/32 Slotted, 3/16 Hex, 9/64 Hex, 1/8 Hex, 7/64 Hex, T10 Torx, T15 Torx]]>1https://s.turbifycdn.com/aah/optacticalgear/noname1-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/noname1-36.jpgMultitasker Toolshttps://s.turbifycdn.com/aah/optacticalgear/multitasker-twist-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-twist-46.jpgcustom-itemoptacticalgear-pagesukiandto1488872164.9559.95Multitasker Twist ToolMultitasker Tools111• Aimpoint turret adjuster on rear cap
• Pocket clip is a light-duty slotted screwdriver
• Heavy-duty dental pick with brass shank
• 3/32 pin punch
• Radial carbon scraper
• M16A2 style FSP adjustment tool on a magnetic 1/4" hex bit holder
• 10 1/4" hex bits and carrier strip ]]>1https://s.turbifycdn.com/aah/optacticalgear/multitasker-twist-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/multitasker-twist-56.jpgMultitasker Toolshttps://s.turbifycdn.com/aah/optacticalgear/ordnance-pouches-51.jpgitem.optacticalgear-pageammopouchesMunitions / Ordnance Pouches1fecobapo1inmtrgravsoblfogehewhfrspsylidyflbaluanpoblfohewhsmgratssmflpoeoglowprdepohast405bahat340ba1https://s.turbifycdn.com/aah/optacticalgear/ordnance-pouches-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/ordnance-pouches-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-narrow-mouth-32-oz-grey-bottle-w-black-lid-40.jpgitem.optacticalgear-pagenalgene2634200012.9910.99Nalgene Sustain Narrow Mouth 32 oz. Grey Bottle w/ Black LidNalgene111This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-narrow-mouth-32-oz-grey-bottle-w-black-lid-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-narrow-mouth-32-oz-grey-bottle-w-black-lid-47.jpgNalgenehttps://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-wide-mouth-32-oz-grey-w-black-lid-47.jpgitem.optacticalgear-pagenalgene2634183315.9912.49Nalgene Sustain Wide Mouth 32 oz. Grey w/ Black LidNalgene111This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-wide-mouth-32-oz-grey-w-black-lid-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/nalgene-tritan-wide-mouth-32-oz-grey-w-black-lid-54.jpgNalgenehttps://s.turbifycdn.com/aah/optacticalgear/nar-ars-for-needle-decompression-14-gauge-x-3-25-in-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/ifak-ars-for-needle-decompression-14-gauge-x-3-25-in-24.jpgcustom-itemoptacticalgear-pagebandages114ZZ005610.99NAR ARS for Needle Decompression (14 gauge x 3.25 in.)North American Rescue111Specifications
SEL#: 09MS-02-THOR
Strong, reliable needle/catheter: 14 gauge x 3.25 in.
Rugged needle/catheter protective tube
Easy ID textured twist top with handy clip
Easy-open container for quick access
Capless flash chamber for immediate confirmation of needle placement
Convenient, compact size
U.S. Patents D595,847 and 001002372-0001, Patent(s) Pending Dimensions:
Packaged: L 5.7 in. x W 0.7 in. x 0.8 in.
Needle Size: 14 gauge x 3.25 in.
Weight: 0.6 oz THIS ITEM REQUIRES TRAINING PRIOR TO REAL WORLD USE. SEEK TRAINING FROM ACCREDITED SOURCES WITH REAL WORLD EXPERIENCE. O P Tactical Inc. will not be held responsible for misuse of this item. There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/ifak-ars-for-needle-decompression-14-gauge-x-3-25-in-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/ifak-ars-for-needle-decompression-14-gauge-x-3-25-in-31.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-bear-claw-glove-glove-kit-pack-of-25-pairs-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-bear-claw-glove-glove-kit-pack-of-25-pairs-46.jpgcustom-itemoptacticalgear-pagebandages114ZZ-024X26.69NAR Bear Claw Glove Glove Kit - Pack of 25 PairsNorth American Rescue111Designed for single-use only. Features:
• 100% nitrile gloves
• Textured for improved wet and dry gripping
• Longer and thicker than standard nitrile gloves
• Form fitting
• Extended, beaded cuff for quick and easy donning
• Sand color
• Non-sterile NATO NSN: 6515-01-600-6059 Made in the USA. There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-bear-claw-glove-glove-kit-pack-of-25-pairs-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-bear-claw-glove-glove-kit-pack-of-25-pairs-60.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-black-talon-glove-kit-pack-of-25-pairs-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-black-talon-glove-kit-pack-of-25-pairs-46.jpgcustom-itemoptacticalgear-pagebandages114ZZ-021X26.69NAR Black Talon Glove Kit - Pack of 25 PairsNorth American Rescue111Designed for single-use only. Features:
• 100% nitrile gloves
• Textured for improved wet and dry gripping
• Longer and thicker than standard nitrile gloves
• Form fitting
• Extended, beaded cuff for quick and easy donning
• Black color
• Non-sterile Made in the USA. There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-black-talon-glove-kit-pack-of-25-pairs-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-black-talon-glove-kit-pack-of-25-pairs-60.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-c-a-t-tourniquet-holder-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-c-a-t-tourniquet-holder-57.jpgcustom-itemoptacticalgear-pagetourniquets11430005X23.99NAR C-A-T Tourniquet HolderNorth American Rescue111• PALS/MOLLE-style connectors for versatile attachment to an armor vest, gear or belt (mounted horizontally or vertically) for rapid & easy access
• 1000D IR Signature Reduced Nylon
• Easy-open pull elastic tab with tourniquet ID patch – “TQ” Accommodates both Gen 6 and Gen 7 C-A-T Tourniquets (not included). Made in the USA. Note: Inset picture shows OD Green on the left and Ranger Green (darker color) on the right.]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-c-a-t-tourniquet-holder-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-c-a-t-tourniquet-holder-70.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-compressed-gauze-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-compressed-gauze-53.jpgcustom-itemoptacticalgear-pagebandages11430-00524.09NAR Compressed GauzeNorth American Rescue111Features -4.5 in. x 4.1 yd Sterile, 6-ply 100% cotton gauze -The compressed, rolled gauze is ideal for wound bandaging and wrapping of injuries -Unique crinkle weave ensures excellent fluid absorption -Ultra-compact size that expands to cover larger wound areas -Used as backing gauze for hemostatic agents, in conjunction with a compression bandage to control hemorrhage Dimensions: -Packaged: L 3 in. x W 2 in. x D 1 in. -Weight: 1.2 oz There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-compressed-gauze-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-compressed-gauze-67.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-cummerbund-tourniquet-holder-elastic-26.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-cummerbund-c-a-t-holder-elastic-22.jpgcustom-itemoptacticalgear-pageinmedpoipo1130021X15.99NAR Cummerbund Tourniquet Holder - ElasticNorth American Rescue111• Tailored to allow attachment to a variety of armor carriers from law enforcement style over and concealable carriers to more tactical armor like assault and plate carriers
• Accommodates Gen 6 and Gen 7 C-A-T Tourniquets and some other brand tourniquets like the SOFT-T Wide
• Utilizes 4 in. elastic coupled with hook and loop attachment to external cummerbund flap
• Rapid and Easy access with ambidextrous one handed TQ removal
• 4 in. Elastic Retention Band for Combat Application Tourniquet
• Hook and Loop attachment Specs:
• L 5 in. x W 4 in. x D 0.25 in.
• Weight: 0.6 oz Tourniquets sold separately. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-cummerbund-c-a-t-holder-elastic-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-cummerbund-c-a-t-holder-elastic-29.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-flat-emergency-trauma-dressing-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-flat-emergency-trauma-dressing-45.jpgcustom-itemoptacticalgear-pagebandages1143000937.99NAR Emergency Trauma DressingNorth American Rescue111Special Features:
-Sterile bandage with up to 5 year expiry
-Suitable for applying immediate direct pressure
-Flat folded, vacuum configuration reduces cube space and footprint in your kit
-Multi-functional, all-in-one design
-Simple application that is easy to remember under combat/survival stress
-Omission of pressure bars and hooks to moderate the use of fine motor skills
-Durable securing device
-Quick-Grip™ Roll Control tabs to prevent the bandage from unrolling during application
-Vacuum-sealed, flat low-cube packaging with NAR's signature Red-Tip Technology® red tear notches
-Cost effective Weight:
• 4-Inch: 2.6 oz
• 6-Inch: 4 oz There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-flat-emergency-trauma-dressing-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-flat-emergency-trauma-dressing-55.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-gen-7-combat-application-tourniquet-c-a-t-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-gen-7-combat-application-tourniquet-c-a-t-46.jpgcustom-itemoptacticalgear-pagetourniquets11430000131.59NAR Gen 7 Combat Application Tourniquet (C-A-T)North American Rescue111Description Noted as the best prehospital tourniquet in the February 2008 supplement of The Journal of Trauma The patented North American Rescue C-A-T® is a true one-handed tourniquet proven to be 100% effective by the U.S. Army’s Institute of Surgical Research. Tests proved that the C-A-T® completely occluded blood flow of an extremity in the event of a traumatic wound with significant hemorrhage. Features -Official Tourniquet of the U.S. Army -The CAT-T is proven to be 100% effective in occluding blood flow in both upper & lower extremities by the U.S. Army’s Institute of Surgical Research -NEW Single Routing Buckle for faster application, decreased blood loss, effective slack removal, fewer windlass turns, and simplified training with single protocol application standards -Includes reinforced windlass, stabilization plate, windlass clip and writeable windlass security strap -Featuring NAR's signature Red Tip Technology® elliptical tab providing added visual clues during application Dimensions: -Packaged: L 6.5 in. x W 2.4 in. x D 1.5 in. -Open Length: 37.5 in. -Weight: 2.7 oz There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-gen-7-combat-application-tourniquet-c-a-t-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-gen-7-combat-application-tourniquet-c-a-t-60.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-compact-chest-seal-twin-pack-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-compact-chest-seal-twin-pack-36.jpgcustom-itemoptacticalgear-pagebandages11410-004213.29NAR Hyfin Vent Chest Seal - Compact Model - Twin PackNorth American Rescue111Compact size fits in most IFAK/Medical Pouches better than the Full size model. Designed with 3-vented channels that allow air to escape the chest cavity during exhalation but prevents airflow from entering through the injury site during inhalation. Each HyFin Vent Compact Chest Seal is 4.75 in. x 4.75 in. and made with advanced adhesive to provide a superior adhesion in the most adverse conditions, including sweaty or hairy casualties. Packaged in a rugged, easy-to-open foil pouch, the perforated packaging allows users to open only one dressing at a time as needed. It’s small packaging is ideal for low profile kits as you do not have to fold it to get it to fit in your kit, go-bag, cargo pocket or body armor. Features:
• 3-channel pressure relief vents
• Two Chest Seals for the treatment of entry/exit or multiple penetrating wounds
• Advanced adhesive gel for superior adhesion, even to sweaty or hairy chests
• Large red tab for single step, peel and apply application that also allows for burping the wound if necessary Dimensions:
• Device: 4.75 in. x 4.75 in. (excluding tab)
• Packaged: H 3.875 in. x W 6.6 in. x D 0.13 in.
• Weight: 1.55 oz
• U.S. Patents: 7,504,549 & Patent(s) Pending There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-compact-chest-seal-twin-pack-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-compact-chest-seal-twin-pack-46.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-chest-seal-twin-pack-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-chest-seal-twin-pack-36.jpgcustom-itemoptacticalgear-pagebandages11410003716.39NAR Hyfin Vent Chest Seal - Full Size Model - Twin PackNorth American Rescue111Features:
-Patented, new design with 3-channel pressure relief vents
-Two Chest Seals for the treatment of both entry/exit or multiple penetrating injuries
-Advanced adhesive technology for a superior seal in the most adverse conditions, including sweaty or hairy casualties
-Easy-to-grip, large red tab for single step, peel-and-apply application that allows for the burping of the wound if necessary Specifications:
-Patented, new design with 3-channel pressure relief vents
-Two Chest Seals for the treatment of both entry/exit or multiple penetrating injuries
-Advanced adhesive technology for a superior seal in the most adverse conditions, including sweaty or hairy casualties
-3-vent channels that prevent airflow into the chest cavity during inspiration while allowing air to escape through the vent channels during exhalation
-Vent channels allow blood to escape and provides a backup fail-safe system as even if two of the three channels become obstructed, the vent will remain fully operational
-Easy-to-grip, large red tab for single step, peel-and-apply application that allows for the burping of the wound if necessary
-Rugged, easy-to-open foil package featuring signature Red-Tip Technology® tear notches with perforated packaging allowing rescuers to open only one dressing at a time as needed Dimensions:
-Device: H 6 in. x W 6 in.
-Packaged Folded: H 7.5 in. x W 4.5 in. x D 0.25 in.
-Packaged Unfolded: L 7.5 in. x W 9 in. x D 0.13 in.
-Weight: 2.5 oz.
-US Patents: 7,504,549 & Patent(s) Pending There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-chest-seal-twin-pack-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-hyfin-vent-chest-seal-twin-pack-46.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-mini-responder-4-inch-dressing-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-mini-responder-4-inch-dressing-43.jpgcustom-itemoptacticalgear-pagebandages11430-01796.19NAR Mini Responder 4-Inch DressingNorth American Rescue111• Small, compact packaging
• Flat folded
• Both hook and loop as well as C-Clip securing device
• 4 x 6 inch non-adherent sterile pad
• 42 inch elastic bandage (unstretched)
• Sterile unless package is opened or damaged There are no returns or exchanges on medical items.]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-mini-responder-4-inch-dressing-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-mini-responder-4-inch-dressing-57.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/ifak-nasopharyngeal-airway-28f-with-lubricant-23.jpgcustom-itemoptacticalgear-pagebandages114ZZ00345.99NAR Nasopharyngeal Airway 28F with LubricantNorth American Rescue111Specifications Not easily dislodged during transport
Better tolerated than an oropharyngeal airway by semi-conscious or unconscious patients with an intact gag reflex
Packaged with surgical lubricant attached Dimensions:
Packaged: L 6 in. x W 1.6 in. x D 0.5 in.
Device Size: 28 French
Weight: 0.5 oz THIS ITEM REQUIRES TRAINING PRIOR TO REAL WORLD USE. SEEK TRAINING FROM ACCREDITED SOURCES WITH REAL WORLD EXPERIENCE. O P Tactical Inc. will not be held responsible for misuse of this item. There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/ifak-nasopharyngeal-airway-28f-with-lubricant-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/ifak-nasopharyngeal-airway-28f-with-lubricant-30.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-polycarbonate-eye-shield-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-polycarbonate-eye-shield-44.jpgcustom-itemoptacticalgear-pagebandages11430-01423.3NAR Polycarbonate Eye ShieldNorth American Rescue111• Made of rigid, shatterproof polycarbonate
• Meets CoTCCC treatment protocols for penetrating eye trauma
• Holes allow air circulation
• Accommodates either eye
• Translucent orange color
• Engraved “Tape over eye this side out. Nothing under shield” Specs:
• Each: 3 in. x 2.375 in.
• Weight: 0.2 oz There are no returns or exchanges on medical items.]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-polycarbonate-eye-shield-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-polycarbonate-eye-shield-58.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-quiklitter-lite-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-quiklitter-lite-42.jpgcustom-itemoptacticalgear-pagemesuhy11460007131.99NAR QuikLitter LiteNorth American Rescue111Features: • Perfect balance of size, weight, cost, and capability • Features ten large carry handles with a load capacity tested to 750 lb • Made of lightweight, heavy-duty nylon • Vacuum-packed to conserve space and fit in a cargo pocket ]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-quiklitter-lite-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-quiklitter-lite-56.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/nar-roo-m-fak-kit-advanced-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-roo-m-fak-kit-advanced-38.jpgcustom-itemoptacticalgear-pageinmedpoipo11480106089.19NAR Roo M-FAK KitNorth American Rescue111Pouch Features:
Super compact
500 Denier nylon
Unique front tourniquet pouch, pull tab opening for one handed access
Multiple elastic loops on the interior
MOLLE style attachment
Mounts in vertical position, MOLLE
Mounts in horizontal position 3 in. internal sleeve for belt
Includes a 1 in. PVC Med Cross Patch Basic Kit Contents:
1 x C-A-T® (Combat Application Tourniquet®) Black
1 x 4 in. Flat ETD™
1 x S-rolled Gauze (4.5 in. x 4.1 yd)
1 x HyFin® Vent Compact Chest Seal, Twin Pack
1 x pair Bear Claw® Nitrile Trauma Gloves, large Advanced Kit Contents:
1 x C-A-T® (Combat Application Tourniquet®) Black
1 x 4 in. Flat ETD™
1 x Combat Gauze® LE Hemostatic Bandage
1 x Nasopharyngeal Airway 28F with Lubricant
1 x HyFin® Vent Compact Chest Seal, Twin Pack
1 x ARS® Needle Decompression Kit (10 G x 3.25 in.)
1 x pair Bear Claw® Nitrile Trauma Gloves, large Dimensions:
L 7 in. x W 3.75 in. x D 4 in.
Weight: 13 oz ]]>1https://s.turbifycdn.com/aah/optacticalgear/nar-roo-m-fak-kit-advanced-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/nar-roo-m-fak-kit-advanced-48.jpgNorth American Rescuehttps://s.turbifycdn.com/aah/optacticalgear/navigation-and-watches-73.jpgitem.optacticalgear-pagefigemiNavigation, Watches, Radios1gafo901baedgafo701baedeoggafo60wrsgafo801lugafogpsmodiupttrefecopttrediumoapxm11diuke2pindiapxrecadivemoansybndivemoansytnbaofengbff8hpssprnafleogga30wrst215geopgpsposucoallblmisum9wrcowistsucllbnhcocatrwrcocauslecotrrangerbeadswmapcaThe USPS will not insure watches shipped through the postal system, choose postal delivery at your own risk, this does include international and APO/FPO customers]]>1https://s.turbifycdn.com/aah/optacticalgear/navigation-and-watches-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/navigation-and-watches-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-commando-wire-saw-39.jpgitem.optacticalgear-pagesukiandto647101012NDuR Commando Wire sawNDuR111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The strongest (over 100 lbs. breaking strain) and most effective wire saw available. Cuts through wood, plastic, bone and even soft metals. Constructed using 8 strands of interwoven stainless steel wire, will easily reach inaccessible places. Attach rope ring on each end to cut higher branches. 24" saw edge. Many uses for the outdoors and home.]]>1https://s.turbifycdn.com/aah/optacticalgear/proforce-commando-wire-saw-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-commando-wire-saw-46.jpgNDuRhttps://s.turbifycdn.com/aah/optacticalgear/proforce-emergency-signalling-mirror-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-emergency-signalling-mirror-51.jpgitem.optacticalgear-pagesukiandto645122012NDur Emergency Signalling MirrorNDur111Robust high impact plastic. Easy to use with one hand. Suns reflection can be seen for many miles. Floats if accidentally dropped in water. Measures 3" x 2". 1https://s.turbifycdn.com/aah/optacticalgear/proforce-emergency-signalling-mirror-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-emergency-signalling-mirror-61.jpgNDurhttps://s.turbifycdn.com/aah/optacticalgear/night-vision-and-accessories-45.jpgcustom-itemoptacticalgear-pageheacNight Vision and Accessories1l3habinividel3hapvbinivil3hanivideannvgmosoweaponlaserswelilaswheliandacheacandwenonvgwrchemlights1https://s.turbifycdn.com/aah/optacticalgear/night-vision-and-accessories-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/night-vision-and-accessories-44.jpgitem.ysw-templates-to-change111https://s.turbifycdn.com/aah/optacticalgear/nocorium-bnvd1531-wrap-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-bnvd1531-wrap-49.jpgcustom-itemoptacticalgear-pagenonvgwrXXNOC-153129.99Nocorium BNVD1531 WrapNocorium111litoinvi1Battery Pack Wraps are sold separately. If this is your first time applying these NVG Wraps, or if you need a refresher on how to apply them / reminder of where the pieces go, make sure you watch our how to video (see link below). SPECS:
• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>1https://s.turbifycdn.com/aah/optacticalgear/nocorium-bnvd1531-wrap-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-bnvd1531-wrap-62.jpgNocoriumhttps://s.turbifycdn.com/aah/optacticalgear/nocorium-eotech-binonv-c-nvg-wrap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-eotech-binonv-c-nvg-wrap-45.jpgcustom-itemoptacticalgear-pagenonvgwrXXNOC-NV-BNVD32Nocorium EOTech BinoNV-C NVG WrapNocorium111litoinvi2• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>1https://s.turbifycdn.com/aah/optacticalgear/nocorium-eotech-binonv-c-nvg-wrap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-eotech-binonv-c-nvg-wrap-58.jpgNocoriumhttps://s.turbifycdn.com/aah/optacticalgear/nocorium-nvg-wraps-33.jpgcustom-itemoptacticalgear-pageniviandacNocorium NVG and Headset Wraps1nopvwrnobnwrnoeobinvgwrnopvbapawrnoopampearprnopvwr11https://s.turbifycdn.com/aah/optacticalgear/nocorium-nvg-wraps-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-nvg-wraps-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-opscore-amp-ear-protection-wrap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-opscore-amp-ear-protection-wrap-45.jpgcustom-itemoptacticalgear-pageheprXXNOC-OpsCore-AMP19.95Nocorium OpsCore AMP Ear Protection WrapNocorium111• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>1https://s.turbifycdn.com/aah/optacticalgear/nocorium-opscore-amp-ear-protection-wrap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-opscore-amp-ear-protection-wrap-58.jpgNocoriumhttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-14-wrap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-14-wrap-45.jpgcustom-itemoptacticalgear-pagenonvgwrXXNOC-PVS1422.99Nocorium PVS-14 WrapNocorium111litoinvi3PRODUCT NOTE: while most PVS14 Monocular devices are very similar, there are a few different battery housings available on the market. The wrap you see here, is designed specifically for the more common non-scooped battery housing, also often referred to as the Carson battery housing. The Nocorium PVS-14 Wrap™ is a non-permanent, adhesive-backed vinyl wrap carefully designed and precision cut to customize the appearance of your PVS-14 Night Vision Device This is for the more common single AA housing variant. Please double check to make sure you have the same style of housing. If this is your first time applying these NVG Wraps, or if you need a refresher on how to apply them / reminder of where the pieces go, make sure you watch our how to video (see link below). SPECS:
• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>1https://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-14-wrap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-14-wrap-58.jpgNocoriumhttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-battery-pack-wrap-31.jpgcustom-itemoptacticalgear-pagenonvgwrXXNOC-PVS31A-BATPACK23.99Nocorium PVS-31A Battery Pack WrapNocorium111liinvi• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>1https://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-battery-pack-wrap-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-battery-pack-wrap-40.jpgNocoriumhttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-wrap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-wrap-45.jpgcustom-itemoptacticalgear-pagenonvgwrXXNOC-PVS31A29.99Nocorium PVS-31A WrapNocorium111litoinviPVS-31A Battery Pack Wraps are sold separately. If this is your first time applying these NVG Wraps, or if you need a refresher on how to apply them / reminder of where the pieces go, make sure you watch our how to video (see link below). SPECS:
• Manufacturer : Nocorium
• Material : Premium Adhesive backed printed opaque vinyl film
• Adhesive Type : non-permanent acrylic adhesive
• Surface Finish : Matte finish overlaminate
• UV Resistance : UV coated to resist fading from sun exposure
• Shrinkage : Will not shrink
• Flammability Tested : ASTM E-84 tested and passed
• Operating temperatures : -70°F to 220°F Please note: Nocorium™ and associated dealers are not responsible for damaged NVG Wraps™ due to improper end user installation.]]>1https://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-wrap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/nocorium-pvs-31a-wrap-58.jpgNocoriumhttps://s.turbifycdn.com/aah/optacticalgear/non-reg-norse-face-sticker-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-norse-face-sticker-79.jpgcustom-itemoptacticalgear-pagestickers131NORSESTICKER3Non-Reg Norse Face Sticker Non-Reg111-Long-lasting printed vinyl sticker
-Size: 4 x 2.2 inches]]>1https://s.turbifycdn.com/aah/optacticalgear/non-reg-norse-face-sticker-91.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-norse-face-sticker-92.jpgNon-Reghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-parody-patch-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-parody-patch-70.jpgcustom-itemoptacticalgear-pagegrpa131NORSE6Non-Reg The Norse Face Parody PatchNon-Reg111-Velcro Hook backing, embroidered
-Includes Non-Reg vinyl sticker and artist info card More Info:
-Intended to help bring out the Norse warrior in all of us. ]]>1https://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-parody-patch-82.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-parody-patch-83.jpgNon-Reghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-t-shirt-100.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-t-shirt-98.jpgcustom-itemoptacticalgear-pagetshirts131NORSETEE25Non-Reg The Norse Face T-ShirtNon-Reg111 Intended to help bring out the Norse warrior in all of us. Printed on a comfortable Gildan Softstyle 100% Cotton T-Shirt. Regular Fit. T-Shirt only, gear not included.1https://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-t-shirt-111.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-reg-the-norse-face-t-shirt-112.jpgNon-Reghttps://s.turbifycdn.com/aah/optacticalgear/nuun-active-hydration-tube-of-12-46.jpgitem.optacticalgear-pagehysy264435__7.496.99Nuun Active HydrationNuun Hydration111NUUN Hydration Tablets A tasty & hydrating blend of electrolytes, minerals and caffeine provides complete hydration with an extra boost*. 10 tablets per tube. Dissolve in 16oz. of water. Features/Benefits:
Optimal electrolyte levels and salt balance; no carbs/sugars Tabs dissolve in the time it takes to tie your laces Tough, water-resistant tube is more convenient than bags of powder Nuun is triathlon tested to prevent cramping and maximize hydration Refreshing, light flavor designed for the active palate; not overwhelming; a bit tart and just right Nuun is not fizzy, not messy, not hard to dose like powder Great for long runs, rides, working out in the gym, anywhere. Active Ingredients:
Sodium (carbonates) 300 mg
Potassium (bicarbonate) 150 mg
Calcium (carbonate) 13 mg
Magnesium (sulfate) 25 mg
Sugar 1g Other Ingredients: Citric Acid, Dextrose, Sodium Carbonate, Potassium Bicarbonate, Sodium Bicarbonate, Natural Flavors, Potassium Chloride, Rice Extract Blend, Magnesium Oxide, Calcium Carbonate, Stevia Leaf Extract, Avocado Oil, Riboflavin (for color). This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/nuun-active-hydration-tube-of-12-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/nuun-active-hydration-tube-of-12-53.jpgNuun Hydrationhttps://s.turbifycdn.com/aah/optacticalgear/nvg-mounting-solutions-79.jpgcustom-itemoptacticalgear-pageniviandacNVG Mounting Solutions1wiinl4g24lowwig69nvgmosywiinl4g70nvguntasushwiinl4sehy3hwiinl4sethhoopmobushopskshtnnvgpopaexwiinanarmmowrataseskcrgecrprnicrprnibapofecopvbaresyagbrtaheacplwiinamficoasopbuforarcraspsylidsnv21https://s.turbifycdn.com/aah/optacticalgear/nvg-mounting-solutions-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/nvg-mounting-solutions-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/oakley-si-double-edge-thin-blue-line-prizm-grey-lens-41.jpgcustom-itemoptacticalgear-page124938018Oakley SI Double Edge Thin Blue Line - Prizm Grey Lens11Features
- High wrap rectangular lens shape with optimized peripheral vision and side protection suitable for medium to large faces
- Unobtainium® nosepads increase grip with perspiration for a no slip grip
- Three-Point Fit holds lenses in precise optical alignment while eliminating pressure points
- Plutonite® Lenses offer top UV Protection filtering 100% of all UVA, UVB, UVC and harmful blue light up to 400nm
- O Matter™ stress-resistant frame material is both lightweight and durable for all-day comfort and protection WARNING: Eyewear products contain chemicals known to the State of California to cause cancer and birth defects or other reproductive harm.]]>1https://s.turbifycdn.com/aah/optacticalgear/oakley-si-double-edge-thin-blue-line-prizm-grey-lens-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/oakley-si-double-edge-thin-blue-line-prizm-grey-lens-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/oc-tactical-cat-trap-tourniquet-holder-available-soon-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/oc-tactical-cat-trap-tourniquet-holder-available-soon-34.jpgcustom-itemoptacticalgear-pagetourniquets1128.57.5OC Tactical CAT Trap Tourniquet HolderOC Tactical111-Lightweight
-Adjustable tension
-Secures easily to PALS Webbing
-Shock cord adjusted tension weaves through PALS Webbing
-Shock cord and ITW cord lock easily replaced in the field
-Lined with a non-slip material, providing friction to hold tourniquet Available in Multicam, Coyote 498, Ranger Green, and Black Made in the USA, 100% Berry Compliant]]>1https://s.turbifycdn.com/aah/optacticalgear/oc-tactical-cat-trap-tourniquet-holder-available-soon-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/oc-tactical-cat-trap-tourniquet-holder-available-soon-44.jpgOC Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/oc-tactical-hearing-protection-cover-34.jpgcustom-itemoptacticalgear-pagehepr116HP222.519.5OC Tactical HP2 Hearing Protection CoverOC Tactical111Peltor: Approximately 9.25" x 2" when folded. (Fits earpro with 2" wide bands: Comtac, 6S, TacticalPro, Tactical Sport, and Sordin Supreme Pro with leather headband.) Sordin Pro x: Approximately 9.5" x 1.5" when folded (Designed for Sordin Pro X with 1.5" plastic headband) Howard Leight: Approximately 10.5" x 2" when folded (Designed specifically for the Howard Leight Impact Sport. Will also fit Sordin Supreme Pro with leather headband) Like the original, this version is made using cordura fabric instead of clothing weight material for better wear resistance and uses foam backed Dri-Lex on the underside. The reason for the new version? It's faster and easier to make, which equals being able to keep up with demand and best off all, lower prices. Although the price is lower I didn't compromise in the details. Like the original I opted to continuing using Dri-Lex. Why Dri-Lex instead of standard spacer mesh? Because it not only increases airflow, but also wicks moisture away from the surface. I'm also able to custom order it with a layer of foam laminated to the back for extra cushion. It's more expensive, but worth it as far as I'm concerned. The original was the first in the industry to offer loop on top for a name tape. The name tape loop is still standard, but can also be ordered without for a lower price if you don't need it. When possible I always use matching camouflage loop. Why? Because I don't mind spending a few extra pennies and that's the way you would do it if you were making it for yourself. Also like the original I opted to not go with a one size fits all approach. Is it easier and cheaper from a manufacturing stand point to go with one size? Sure, but if you were making it yourself you would make it to fit correctly, not just good enough. So I settled on the 3 most popular sizes. Lastly, one of the most popular custom features from the original was a small loop centered in the back allowing you to hang your hearing protection using a carabineer, grimloc, or similar item. This feature is now standard. This makes storing you hearing protection at home, in the vehicle or aircraft, or on you gear a lot easier. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/oc-tactical-hearing-protection-cover-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/oc-tactical-hearing-protection-cover-41.jpgOC Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/olicamp-space-saver-mug-hard-anodized-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/olicamp-space-saver-mug-hard-anodized-53.jpgcustom-itemoptacticalgear-pagenalgene2633044818.9917.49Olicamp Space Saver Mug - Hard AnodizedOlicamp111This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/olicamp-space-saver-mug-hard-anodized-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/olicamp-space-saver-mug-hard-anodized-66.jpgOlicamphttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-helmetscrim-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-helmetscrim-18.jpgcustom-itemoptacticalgear-pageshvescbaXXOHC-HC30One Hundred Concepts HelmetScrimOne Hundred Concepts111We have stocked the Coyote color for those who wish to paint their gear all together - rifle, scrim, and anything else - to get a consistent pattern, as well as those who may not be able to get Multicam HelmetScrim due to unit SOPs, and those who simply would like the base color.
The HelmetScrim does not come with a Helmet Cover]]>1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-helmetscrim-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-helmetscrim-32.jpgOne Hundred Conceptshttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-hexcap-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-hexcap-16.jpgcustom-itemoptacticalgear-pagerdsreddotsiaXXOHC-HC35One Hundred Concepts HexCapOne Hundred Concepts111• Minimizes downrange reflection.
• Snaps securely in place. The HexCap is a ruggedly simple, snap-fit Anti-Reflection Device (ARD) that installs securely in seconds to your red dot sight with no additional hardware. The HexCap was designed to be as low profile as possible while maintaining durability for use in the field. Its hexagonal lattice allows you to see through the optic with minimal obstruction while eliminating downrange reflections. Anti-Reflection Devices are nothing new, but there simply aren't good options for many of the red dots on the market today – especially with the rise in popularity of top-mounted and offset red dot sights. The goal of the HexCap is to solve that problem. Compatible with Aimpoint Micro:
• Aimpoint T1, T2, H1, H2, CompM5, Duty RDS
• Holosun 403C
• Vortex Crossfire RDS ]]>1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-hexcap-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-hexcap-30.jpgOne Hundred Conceptshttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-lightcap-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-lightcap-17.jpgcustom-itemoptacticalgear-pageweaponlights1XXOHC-LC20One Hundred Concepts LightCapOne Hundred Concepts111litoliandscsSizing: See link below for additional size chart based on model
• Small: 1.125"
• Medium: 1.25"
• Large: 1.45" Common Light Compatibility
• Small: non-turbo Surefire Scout
• Medium: REIN 2.0, Modlite
• Large: Rein 3.0, Surefire Turbo]]>1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-lightcap-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-lightcap-30.jpgOne Hundred Conceptshttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-packscrim-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-packscrim-16.jpgcustom-itemoptacticalgear-pagebaXXOHC-PS85One Hundred Concepts PackScrimOne Hundred Concepts1111https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-packscrim-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-packscrim-30.jpgOne Hundred Conceptshttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-ruggedized-lightcap-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-ruggedized-lightcap-17.jpgcustom-itemoptacticalgear-pagenewitemsXXOHC-LCR45One Hundred Concepts Ruggedized LightCap - ShockCollar IncludedOne Hundred Concepts111Small: Surefire 300/600/Vampire Series, Malkoff E1HT/E2HT
Medium: Modlite OKW/PLH-V2, Cloud Defensive Rein 2.0, Malkoff E2XT, Streamlight ProTac Rail Mount 1/2
Large: Cloud Defensive Rein 1.0, Streamlight ProTac 2.0 Rail Mount ]]>1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-ruggedized-lightcap-25.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-ruggedized-lightcap-26.jpgOne Hundred Conceptshttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-19.jpgcustom-itemoptacticalgear-pagelplowpovaopaXXOHC-SC20One Hundred Concepts ScopeCapOne Hundred Concepts111liandscsich• Protects your lens
• Low profile when off of the lens - when using scope
• Field repairable Sizing: See link below for additional size chart based on scope model
• Small: 1.125" / 28.58mm
• Medium: 1.25" / 31.75mm
• Large: 1.40" / 35.56mm
• Size 1: 1.58" / 40.2mm
• Size 2: 1.73" / 44mm
• Size 3: 1.83" / 46.5mm ]]>1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-33.jpgOne Hundred Conceptshttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-pro-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-pro-16.jpgcustom-itemoptacticalgear-pagelplowpovaopaXX-OHC-SCP65One Hundred Concepts ScopeCap ProOne Hundred Concepts111• Protect your lens and minimize downrange reflection
• Low profile in off position
• Field repairable Combining the technology of our ScopeCaps and HexCaps, the ScopeCap Pro features hexagonal lattice on the front lens when the cover is flipped up, which allows you to see through the optic with minimal obstruction while eliminating downrange reflections. The Cap itself is a simple, rugged, and low-profile solution to protect your scope's lenses and eliminate any reflections from them when not in use. Our signature flipper tab is integral to the ScopeCap and allows for fast and easy removal from your scope's bezel. When doffed, they have a lower profile than traditional flip style scope caps. Whether flipped up to take a shot or flipped down for ultimate signature reduction, the ScopeCap Pro combines all the features of products you've come to know and love from One Hundred Concepts. AVAILABLE SIZES:
• 30mm (30mm LPVOs)
• 33mm (Vortex Razor HD/Viper 1-6x24)
• 34mm (34mm LPVOs) ]]>1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-pro-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-scopecap-pro-30.jpgOne Hundred Conceptshttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-shockcollar-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-shockcollar-17.jpgcustom-itemoptacticalgear-pageweaponlights1XXOHC-CLR15One Hundred Concepts ShockCollarOne Hundred Concepts111• Eliminate excess shock cord and use of ranger bands
• Simplifies LightCap™ and ScopeCap™ installation
• Ease of manipulating light heads for battery changes and Vampire modes
• Better suited for scopes with rotating Oculars (EOTECH Vudu and NightForce Scopes) Size Corresponds to LightCap or ScopeCap Size
Common Light Compatibility
• Small: non-turbo Surefire Scout, S&S M-Ax Mount + Surefire IR Scout Light Head
• Medium: REIN 2.0, Modlite
• Large: Rein 3.0, Surefire Turbo]]>1https://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-shockcollar-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/one-hundred-concepts-shockcollar-30.jpgOne Hundred Conceptshttps://s.turbifycdn.com/aah/optacticalgear/ops-core-ach-arc-kit-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-ach-arc-kit-68.jpgitem.optacticalgear-pageachmiheandac562599203137.95124Ops-Core ACH Skeleton ARC Kit - Bungees IncludedOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Transform ACH style helmets into a streamlined platform capable of integrating mission enhancing components and accessories such as visors, mandibles, lights and cameras. Features:
• One size fits all. (Fits the bolt pattern of Gentex ACH style helmets, sizes small to extra-large.)
• Based on FAST ARC Rails.
• Quickly mounts to the sides of the helmet.
• Mounts using existing chinstrap holes in the helmet.
• Multiple non-snag attachment points provide quick, easy and secure donning and doffing of accessories, and clean routing of external wires and cables in a streamlined configuration to minimize user distraction.
• Compatible with ballistic visors and mandibles to offer several options for fully integrated face protection.
• Visor mounts directly; mandible through a point molded into the rail.
• May be integrated with liners and retention systems.
• Corners of the rail designed for compatibility with Ops-Core O2 Mask Straps making the helmet suitable for HALO/HAHO operations.
• Designed to emergency release accessories at 8ft-lbs (11 Newton meters) of torque to prevent neck injuries in the event of snagging.
• Durable, lightweight construction.
• Kit includes: (2) Skeleton ARCs, (2) Picatinny Adapters, (2) Wing- Loc Adapters, ballistic mounting hardware, and (10) cable ties, (2) hook bungees and (2) hook & carabiner bungees to assist with stabilization of night vision devices and mounting brackets. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-ach-arc-kit-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-ach-arc-kit-78.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-communication-headset-connectorized-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-communication-headset-connectorized-51.jpgcustom-itemoptacticalgear-pagehepr56N101153-011549.951289.95Ops-Core AMP Communication Headset - ConnectorizedOps-Core111litoampheramThis item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Near Field Magnetic Induction (NFMI) Earplugs Sold Separately for NFMI Enabled AMP Headset Models. For leading-edge tactical ear protection and unprecedented audio quality, choose the Ops-Core AMP® Communication Headset. This advanced tactical communications headset integrates seamlessly with Ops-Core helmets and accessories to create a lightweight protective headborne system for any mission and environment. AMP's unique 3D Hear-Through Technology and optional NFMI earplugs provide double hearing protection that restores and enhances natural hearing and sound localization while maintaining clear communication for enhanced situational awareness. With a noise-cancelling microphone that mitigates all background noise, AMP is the ideal communications headset to wear in any unpredictable combat environment. This ergonomically designed headset can be configured to meet a wide range of tactical communications needs and delivers ear protection while providing optimal comfort and a streamlined profile. This noise-cancelling headset has a user-based design and can be easily adapted to either headband or helmet configurations, and the optional Rail Mount Kit increases helmet stabilization. AMP features an integrated fixed downlead connection point and quick release downlead connection. The AMP Communication Headset is CE approved EN 352 and available in Berry Amendment compliant configurations. Features:
• World Class Audio Quality and Tactical Ear Protection
• CE approved EN 352
• Berry Amendment compliant configurations available
• 3D Hear-Through Technology
• Double Hearing Protection with optional Ops-Core Near Field Magnetic Induction (NFMI) Earplugs (sold separately for use with NFMI enabled headsets specifically)
• Mission Configurable Capability
• Ergonomic Headband for low profile hearing protection
• Quick Change Rail Mount Kit (sold separately)
• Quick Release Downlead Connections
• Noise-cancelling Headset/Microphone
• Integrated Microphone Mounting and Connection Point
• Ergonomic Earseals
• Auto Shutdown
• Fail-Safe Communications Noise Protection Ratings/Specs/Weight:
See small inset picture above. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-communication-headset-connectorized-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-communication-headset-connectorized-63.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-helmet-rail-mount-kit-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-helmet-rail-mount-kit-48.jpgcustom-itemoptacticalgear-pagehepr561000440129.95Ops-Core AMP Helmet Rail Mount KitOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Features:
• Allows for mounting to the rear of Ops-Core ARC Rails, leaving the top portion of the rails free for mounting accessories, such as lights, cameras, etc. This also creates better helmet stabilization and a counterbalancing effect of forward shroud mounted devices, such as night vision devices.
• A single point gimbal attachment to the ear cups allow for 360 degree adjustment, which not only allows for better fitment and seal to the user’s unique ear / head shape, but maintains that seal and moves more naturally with their head movement.
• Earcups rotate to the side or rear of helmet when not in use, streamlining stowage to create a very low profile. AMP Rail Mount Kit Only. AMP Headset sold separately. Designed to work only with the Ops-Core AMP Headset and ARC Rails. Adapters sold separately from other manufacturers are required for different headsets or rail system. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-helmet-rail-mount-kit-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-helmet-rail-mount-kit-60.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-u174-downlead-cable-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-u174-downlead-cable-53.jpgcustom-itemoptacticalgear-pagehepr56N254584199.95Ops-Core AMP U174 Downlead CableOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The Adaptive Mission Platform (AMP) Headset allows for multiple downlead cable options. These downlead cables gives operators the ability to tailor comms to their mission needs and preferences. Downlead cables allow operators to choose the side of the headset they are physically connected to - offering left, right, and dual downlead capabilities. Features:
• Connects AMP Communication Headsets to various push-to-talk, intercom, and radio options.
• Provides high quality, environmentally sealed connection points.
• Immersion: IPX7
• Multiple cable options are available for the AMP Communication Headset. See small inset photo above for Downlead type info. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-u174-downlead-cable-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-amp-u174-downlead-cable-65.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-ballistic-mounting-hardware-4-pcs-49.jpgitem.optacticalgear-pageopheandac56 039920322.9521Ops-Core Ballistic Mounting Hardware (4 pcs)Ops-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The ballistic mounting hardware set includes (4) custom ballistic screws and (4) T-nuts. It fits all Head-Loc™ Retention Systems. Available in black. Screws are 22mm length for use with Ops-Core ARC Rails and Chin Straps. This IS NOT a replacement for standard MICH or ACH hardware, it is intended to replace hardware used with Ops-Core chinstraps.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-ballistic-mounting-hardware-4-pcs-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-ballistic-mounting-hardware-4-pcs-58.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-bungees-for-arc-rails-48.jpgitem.optacticalgear-pagenvgmoso562599203-Bungee29.95Ops-Core Bungees For ARC Rails - ACHOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Bungee set for use with the Ops-Core ACH ARC Rails 2 Bungees per set. Length per bungee: approximately 4 inches tip-to-tip.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-bungees-for-arc-rails-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-bungees-for-arc-rails-55.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-cbrn-mask-extender-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-cbrn-mask-extender-56.jpgitem.optacticalgear-pagecbrngasmasks5619991015.9514Ops-Core CBRN Mask ExtenderOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. CBRN Mask Extender can be used with all current model Ops-Core Head-Loc™ Retention Systems. It adds 3.5” to the chinstrap, allowing it to fasten over the CBRN mask. The extender is simply attached and removed with one click of the buckle.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-cbrn-mask-extender-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-cbrn-mask-extender-69.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-bump-super-high-cut-helmet-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-bump-super-high-cut-helmet-18.jpgcustom-itemoptacticalgear-pageopheandac56A15057549.95495Ops-Core FAST Bump Super High Cut Helmet Ops-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. (Formerly the Base Jump Helmet) The FAST Bump High-Cut Helmet is the same design as the Ballistic and Carbon FAST helmets but with a polycarbonate shell. This helmet is NOT ballistic rated. The Ops-Core FAST® Bump high-cut shell is designed for less extreme environments where ballistic threats are not a priority, and the focus is on protection from blunt trauma forces, or where the primary need is for integration of mission-configured components. Features & Specifications
• Rigid polymer high-cut shell with eight vent holes to provide increased airflow and reduce heat stress
• Vented Lux Liner with Low Profile Occ-Dial and Head-Loc Retention System offering enhanced impact protection and unmatched stability and comfort
• Modular Bungee Shroud (MBS) for compatibility with most NVG mounts and integrated NVG retention
• Features PowerPath ARC rails with improved cable management and accessory integration Set up for Right-Eye Dominant Shooters. Please contact us if you need a Left-Eye Dominant chinstrap buckle. There are no returns or exchanges on helmets. Please be sure of your size before ordering. This Item is Excluded from ALL Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-bump-super-high-cut-helmet-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-bump-super-high-cut-helmet-30.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-mesh-helmet-cover-for-fast-helmets-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-mesh-helmet-cover-for-fast-helmets-66.jpgcustom-itemoptacticalgear-pageopheandac5641-98-259151.95137Ops-Core FAST Helmet CoverOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Latest Gen version of the Ops-Core Helmet Cover for FAST High-Cut and Super High-Cut Helmets. Design is slightly different on the front portion of each model type to accommodate different retention bungee positions. See pictures for reference. Functionally, they are the same. Features:
• Lightweight and easy to don and doff, providing the ultimate in signature management convenience.
• Lightweight mesh and tweave construction.
• Mesh overlaps vent holes on most FAST Non-Ballistic helmets to provide maximum air flow.
• Para-cord attachment points for natural foliage, camouflage material or cable management.
• Protects the shell while still providing all of the FAST helmet platform functionality.
• Attaches with integrated VELCRO brand tabs. Types:
• FAST Super High-Cut: Compatible with Ops-Core FAST SF Ballistic, FAST MT Ballistic, Current-Gen FAST XP, and FAST SF Carbon Helmets
• FAST High-Cut: Compatible with Previous-Gen Ops-Core FAST XP and other FAST High-Cut Ballistic and Non-Ballistic Helmets Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-mesh-helmet-cover-for-fast-helmets-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-mesh-helmet-cover-for-fast-helmets-76.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sf-super-high-cut-ballistic-helmet-r-96.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sf-super-high-cut-ballistic-helmet-r-94.jpgcustom-itemoptacticalgear-pageopheandac56A145702080.951873Ops-Core FAST SF Super High Cut Ballistic Helmet (R)Ops-Core111litodashUPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. The current issued helmet for USSOCOM, the FAST SF is one of the lightest and most advanced ballistic helmets ever designed. See small picture for Size Chart. Features:
• Super high cut, ballistic shell made of a hybrid composite of the most advanced Carbon, Unidirectional Polyethylene and woven Aramid.
• High performance evolution of the Ops-Core FAST MT Super High Cut Helmet, with an 8% weight reduction, while maintaining compatibility with FAST head borne accessories.
• Super high cut shell geometry extends critical coverage over the rear occipital bone without load carrier interference, and optimizes weight distribution for increased stability, integration, balance, and improved comfort.
• Ear cut geometry is 16 mm higher than the FAST XP High Cut shell shape, allowing for clearance of larger communication headsets.
• Super High Cut Skeleton Rails offer lower profile with a 30% weight reduction from FAST MT Super High Cut Rails.
• Features a lightweight Modular Bungee Shroud (MBS) which reduces snag hazards and interference. Carabiner clips improve NVG retention and stability.
• Molded liner features proprietary recessed groove, accommodating over-the-head communications headsets with no interference or user discomfort, and ability to doff and don helmet without removing the headset.
• Vented Lux Liner features expanded polypropylene liner, offering enhanced impact protection, and molded-in vent holes are integrated with the shell to provide increased airflow and reduce heat stress.
• Helmets come standard with right eye dominant retention (buckle on left) Liner: Vented Lux Liner - Occ-Dial Kit
• Suspension system combining a one-piece full coverage impact layer with modular breathable comfort pads which can be customized and/or repositioned for comfort without affecting impact performance
• Includes vents and a more streamlined geometry to enhance air flow, comfort, and fit
• Low Profile OCC-Dial provide easy adjustments to ensure NVG stability
• Designed for comfort during extended use
• Comfort Pads are durable, breathable, low absorbency, removable and washable
• Seamlessly integrates with all Ops-Core FAST Ballistic, and Non-Ballistic Helmets.
• Installs using VELCRO® brand fasteners
• Comes in corresponding helmet sizes (M, L, XL, XXL)
• 1/4", 1/2", and 3/4" Comfort pads are included for easy, customizable fit Testing/Rating Protocols: See Link Below for Data Sheet
• Modified and Abbreviated Family of Tactical Headborne Systems, dated June 30th 2017 Ops-Core Performance Specification FAST SF PS-1228 Specs:
• Large Shell Weight: 1.47 lbs
• XLarge Shell Weight: 1.59 lbs
• 2XL Shell Weight: 1.65 lbs Made in the USA, Berry Compliant. O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. There are no returns or exchanges on body armor items. Please be sure of your size before ordering. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. ]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sf-super-high-cut-ballistic-helmet-r-105.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sf-super-high-cut-ballistic-helmet-r-106.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-xp-super-high-cut-helmet-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-xp-super-high-cut-helmet-r-18.jpgcustom-itemoptacticalgear-pageopheandac56A151571820.951539Ops-Core FAST XP Super High Cut Helmet (R)Ops-Core111litodash1UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. See small picture for Size Chart. The Ops-Core® FAST XP helmet is part of the FAST ballistic protection helmet family. Its innovative, lightweight design resists penetration from 9mm and frag threats at a weight of 2.81lbs (Large). The FAST XP integrates into Ops-Core’s total headborne system solutions, which include situational awareness, optics, and respiratory protection.
• Lightweight design capable of resisting 9mm and frag threats
• High cut, ballistic shell made of a hybrid composite of the most advanced carbon, unidirectional polyethylene, and woven aramid
• High cut shell geometry extends critical coverage over the rear occipital lobe without load carrier interference and optimizes weight distribution for increased stability, integration, balance, and improved comfort
• Low Profile Skeleton Rail system offers a lightweight mounting system for the headborne eco-system
• Molded liner features proprietary recessed channel, accommodating over-the-head communications headsets with no interference or user discomfort, and ability to doff and don helmet without removing the headset Liner: Vented Lux Liner - Low Profile Occ-Dial Kit options
• Suspension system combining a one-piece full coverage impact layer with modular breathable comfort pads which can be customized and/or repositioned for comfort without affecting impact performance
• Includes vents and a more streamlined geometry to enhance air flow, comfort, and fit
• Low Profile OCC-Dial adjustment provides easy adjustments to ensure NVG stability
• Designed for comfort during extended use
• Comfort Pads are durable, breathable, low absorbency, removable and washable
• Seamlessly integrates with all Ops-Core FAST Ballistic, and Non-Ballistic Helmets.
• Installs using VELCRO® brand fasteners
• Comes in corresponding helmet sizes (M, L, XL, XXL)
• 1/4", 1/2", and 3/4" Comfort pads are included for easy, customizable fit Testing/Rating Protocols: See Link Below for Data Sheet
• Performance Specification: In accordance with Gentex PS-1063 Specification, Modified and Abbreviated US Army ACH Helmet CO/PD 05-04:2007
• Specification NIJ Standards: NIJ 0106.01 with NIJ 0108.01 Level IIIA (9mm FMJ @ 1,400 ft/s)
• Threat Fragmentation Protection: In accordance with PS-1063 and MIL-STD-662F Specs:
• Large Shell Weight: 1.72 lbs
• XLarge Shell Weight: 1.89 lbs
• 2XL Shell Weight: 1.97 lbs Specs:
• Large System Weight: 2.81 lbs
• XLarge System Weight: 3.02 lbs
• 2XL System Weight: 3.11 lbs Made in the USA, Berry Compliant. O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. There are no returns or exchanges on body armor items. Please be sure of your size before ordering. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-xp-super-high-cut-helmet-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-xp-super-high-cut-helmet-r-30.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sentry-helmet-counterweight-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sentry-helmet-counterweight-38.jpgcustom-itemoptacticalgear-pageopheandac5639-99-XX90.9582Ops-Core Helmet CounterweightOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Compatible with Sentry, FAST, and TBH IIIA helmets. Possibly compatible with other helmets using ARC Rails (not guaranteed). This customizable weight management system is designed to enhance comfort and reduce neck strain particularly when wearing NVGs. The five removable weights are housed in elastic pockets that can stretch to fit two weights or one weight and one battery. The Ops-Core Counterweight easily mounts to the rear of the helmet with custom anchors using the existing helmet holes with provided longer ballistic screws, and the VELCRO® brand fastener attachment ensures motion free and secure positioning. Compatible with Ops-Core FAST, Sentry and TBH IIIA Helmets. Possibly compatible with other Helmets using ARC Rails. this durable system also includes a Chemlight window and Velcro patch for Glint tape for use with low light IFF Features:
• Customizable weight management system designed to enhance comfort and reduce neck strain.
• (5) 70g removable weights and (5) elastic pockets.
• Total weight system is 0.85lbs (385g).
• Elastic pockets can stretch to fit (2) weights or (1) weight and (1) battery (AA, AAA or 123).
• Mounts to the rear of the helmet with custom anchors using the existing helmet holes with longer ballistic screws (provided).
• Rear VELCRO® brand fastener attachment ensures motion free and secure positioning.
• Chemlight window and the patch with VELCRO® brand fasteners for Glint tape for use with low light IFF.
• Durable construction.
• Includes 24mm Helmet Screws
• Compatible with Sentry, FAST, and TBH IIIA helmets. Possibly compatible with other helmets using ARC Rails (not guaranteed). Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sentry-helmet-counterweight-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-fast-sentry-helmet-counterweight-48.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-helmets-and-accessories-74.jpgcustom-itemoptacticalgear-pageheacOps-Core Helmets and Accessories1opfasfsuhicuopfaxpsuhicuopfabusuhicuuntama20ampuntamakit3mpearcadleauntasasoaduntareforpeagopmasfhecoagunrepoforhopmehecoforfagbrtaheacplopfahecofispophecohyfispopfabaheuntacoweliopmobushoppiadopluxliveockopbuforarcraopcbmaex20veopbamoha4pcratahecahi1https://s.turbifycdn.com/aah/optacticalgear/ops-core-helmets-and-accessories-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-helmets-and-accessories-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-modular-bungee-shroud-25.jpgcustom-itemoptacticalgear-pagenvgmoso56H10672202.95183Ops-Core Modular Bungee Shroud (MBS)Ops-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The new Ops-Core Modular Bungee Shroud is standard equipment on the next-generation Ops-Core FAST SF and USSOCOM Special Operations Forces Personal Equipment Advanced Requirements Family of Tactical Headborne Systems (SPEAR FTHS), and can be attached to any 3-Hole WARCOM pattern helmet. Made of a hybrid lightweight polymer frame and removable/replaceable machined aluminum mounting insert and featuring an integral bungee retention system with carabiner-style bungee attachments, the MBS is one of the most advanced and most secure NVG retention systems currently on the market.
Features:
• Lightest night vision shroud available.
•Comprised of a molded outer housing and a machined removable insert, designed to be changed out without removing the shroud from the helmet, to provide multiple mounting solutions within the same shroud platform. (Alternate shroud solutions often require the shroud to be removed from the helmet to change out the insert).
•Integrated NVG bungee eliminates interference with accessories.
•The low-profile bungee helps prevent snag hazards while stabilizing NVGs. ]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-modular-bungee-shroud-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-modular-bungee-shroud-32.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-nfmi-earplugs-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-nfmi-earplugs-41.jpgcustom-itemoptacticalgear-pagehepr56N100880234.95Ops-Core NFMI EarplugsOps-Core111litoopampheThis item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Designed for use with the Ops-Core AMP Communications Headset only (sold separately). The Ops-Core® Near Field Magnetic Induction (NFMI) Earplugs provide increased noise reduction, while maintaining clear communications and 3D Hear-Through, when used with NFMI enabled Ops-Core headsets. Do not need batteries, recharging, or any wired connection. When engaged, the NFMI earplug will seamlessly integrate for clear communication. The kit ships with standard, slim, and large Comply foam tips, to accommodate a wide variety of users. See inset picture for Noise Protection Ratings. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-nfmi-earplugs-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-nfmi-earplugs-52.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-picatinny-adapter-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-picatinny-adapter-54.jpgitem.optacticalgear-pageopheandac5620-99-10322.9521Ops-Core Picatinny AdapterOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Works with the ACH-ARC Kit and the FAST Helmet rails Use it to mount a variety of headborne accessories to the helmet Quickly attaches or releases from the rail system]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-picatinny-adapter-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-picatinny-adapter-67.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-skeleton-shroud-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-skeleton-shroud-64.jpgcustom-itemoptacticalgear-pagenvgmoso5634-99-XXX137123Ops-Core Skeleton ShroudOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Features:
• Forged aluminum construction for greater strength and lower weight than the VAS shroud
• High tolerance CNC machined mount arm interface for perfect fit without rattle
• Multiple bungee and lanyard mounting points for compatibility with visors
• Fits all ACH, MICH, PASGT, and LWH helmets with the MARSOC / WARCOM 3-hole pattern, including Crye Airframe and Ops-Core FAST Helmets The Skeleton Shroud’s sleek design will not snag on risers during airborne operations and is HALO, HAHO, and Static Line rated. Mounting hardware included. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-skeleton-shroud-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-skeleton-shroud-78.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/ops-core-lux-liner-vented-occ-dial-kit-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-lux-liner-vented-occ-dial-kit-16.jpgcustom-itemoptacticalgear-pageopheandac56H10758382.95345Ops-Core Vented Lux Liner - Low Profile OCC-Dial KitOps-Core111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Choose the option based on your dominant eye. "Right Eye Dominant" has the buckle on the left side of the chin strap to accommodate for the buttstock. "Left Eye Dominant" has the buckle on the right side of the chin strap for the same reason. Features:
• Suspension system combining a one-piece full coverage impact layer with modular breathable comfort pads which can be customized and/or repositioned for comfort without affecting impact performance
• Includes vents and a more streamlined geometry to enhance air flow, comfort, and fit
• Low Profile OCC-Dial provides easy adjustments to ensure NVG stability
• Designed for comfort during extended use
• Comfort Pads are durable, breathable, low absorbency, removable and washable
• Seamlessly integrates with all Ops-Core FAST Ballistic, and Non-Ballistic Helmets
• Installs using VELCRO® brand fasteners
• 1/4", 1/2", and 3/4" Comfort pads are included for easy, customizable fit Note: Screws NOT included. You use the ones that came with your FAST Helmet. ]]>1https://s.turbifycdn.com/aah/optacticalgear/ops-core-lux-liner-vented-occ-dial-kit-25.jpghttps://s.turbifycdn.com/aah/optacticalgear/ops-core-lux-liner-vented-occ-dial-kit-26.jpgOps-Corehttps://s.turbifycdn.com/aah/optacticalgear/opt-3-inch-dot-target-30.jpgcustom-itemoptacticalgear-pagetargetsOPT3IDTGT1.25 10 10 25 21.25 50 37.5 100 50OPT 3 inch Dot TargetOPT11110 Target: $1.00/piece
25 Targets: $0.85/piece
50 Targets: $0.75/piece
100 Targets: $0.50/piece UPS OR INTERNATIONAL SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. CONTACT US FOR SHIPPING COST IF ORDERING MORE THAN 100 TARGETS.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-3-inch-dot-target-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-3-inch-dot-target-40.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-large-33.jpgcustom-itemoptacticalgear-pagestickersOPTACESTLG3OPT Ace Tomato Co Sticker - LargeOPT111One of the greatest covers for action in the history of espionage. Adhesive backed. 3" x 2.25". Matte finish.1https://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-large-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-large-43.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-small-31.jpgcustom-itemoptacticalgear-pagestickersOPTACESTSM2OPT Ace Tomato Co Sticker - SmallOPT111One of the greatest covers for action in the history of espionage. Adhesive backed. 2" x 1.5". Matte finish.1https://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-small-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-co-sticker-small-40.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-tee-31.jpgcustom-itemoptacticalgear-pagetshirtsOPTACETEE2520OPT Ace Tomato TeeOPT111Shirt Details: •The preferred T-Shirt of the military in tropical environments. •Tan/OCP goes with New Scorpion Pattern ACUs •Adult size •50% Cotton, 50% Polyester jersey •Lightweight 4 ounce fabric •Crewneck Made and printed in the USA]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-tee-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-ace-tomato-tee-40.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-be-a-man-vinyl-sticker-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-be-a-man-vinyl-sticker-59.jpgcustom-itemoptacticalgear-pagestickersOPBAMAMS3OPT Be A Man Vinyl StickerOPT111A tribute to one of the most successful COIN units in the history of modern warfare, The Rhodesian Light Infantry. Vinyl sticker 3 x 4.5 inches1https://s.turbifycdn.com/aah/optacticalgear/opt-be-a-man-vinyl-sticker-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-be-a-man-vinyl-sticker-72.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-best-in-life-t-shirt-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-best-in-life-t-shirt-60.jpgcustom-itemoptacticalgear-pageoptapparelOPTBILT3025OPT Best In Life T-ShirtOPT111Back of shirt features the graphic and saying. Next Level Brand T-shirt: Athletic Fit, 60% Cotton 40% Poly Blend, Lightweight Material. For a loose fit, order one size larger than normal. Black shirt, tan print, short sleeve.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-best-in-life-t-shirt-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-best-in-life-t-shirt-73.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-blood-type-tape-patch-40.jpgitem.optacticalgear-pagegrpa12CP506502OPT Blood Type Tape PatchOPT1111" x 2" For quick and easy identification in an emergency situation these patches have the blood type stated in bold capital letters. VELCRO Brand fastener backed with the "hook" portion, ready to be placed on any available surface with pile tape on it.1https://s.turbifycdn.com/aah/optacticalgear/opt-blood-type-tape-patch-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-blood-type-tape-patch-49.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-burn-down-commies-sticker-13.jpgcustom-itemoptacticalgear-pagestickersOPTBDCDST3OPT Burn Down Commies StickerOPT111In 1967, Polish mercenary Rafal Ganowicz was asked what it felt like to take human life... "I wouldn't know, I've only ever killed Communists." Adhesive backed 3" x 5" Matte finish1https://s.turbifycdn.com/aah/optacticalgear/opt-burn-down-commies-sticker-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-burn-down-commies-sticker-21.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTBUSH3OPT Bush Wars Logo StickerOPT111Features:
-Long-lasting printed vinyl sticker
-Size: 3.63 x 4 inches]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-t-shirt-light-weight-loose-fit-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-t-shirt-light-weight-loose-fit-45.jpgcustom-itemoptacticalgear-pageoptapparelOPTBUSHTEETB25OPT Bush Wars Logo T-Shirt - Light Weight Loose FitOPT111TRI-BLEND Specs
50/37/13 Polyester/Cotton/Rayon Pre-shrunk Jersey
Weight approx. 4.5 oz / 153 g
Soft, lightweight jersey with moisture wicking
Seamless 1x1 rib collar with two-needle coverstitching on front neck
Tear away label
Shoulder-to-shoulder taping
Two-needle hemmed sleeves and bottom
Quarter-turned to eliminate center crease Imported, printed in USA]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-t-shirt-light-weight-loose-fit-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-logo-t-shirt-light-weight-loose-fit-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-morale-patch-30.jpgcustom-itemoptacticalgear-pagegrpaOPTBWMP4OPT111As a tribute to all who follow the exploits of the RLI, RAR, Selous Scouts, RSAS, 32BN, SADF, etc. OPT presents the Bush Wars Logo, a tribute to both the Bushwood Country Club, and the incredible stories of African counter-insurgency against the Soviet backed revolutions of the 60s-80s. Sewn embroidery patch. Velcro Hook backing. 4 inch x 4 inch1https://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-morale-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-bush-wars-morale-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-calico-jack-patch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-calico-jack-patch-54.jpgitem.optacticalgear-pageflagpatches12CP5065034OPT Calico Jack PatchJack]]>111VELCRO Brand fastener backed, approximately 2.25" by 3.5" patch. Inset picture is taken on USGI ACUs. Colors: Black, Olive, Sand, Gray1https://s.turbifycdn.com/aah/optacticalgear/opt-calico-jack-patch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-calico-jack-patch-67.jpgJack]]>https://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-bumper-sticker-40.jpgcustom-itemoptacticalgear-pagestickersOPDBBS3.5OPT Douchebag Bumper StickerOPT111Revered and praised by Communists for his mediocre book about Guerrilla Warfare and his failures at actually leading anything; we bring you... The ultimate Douchebag Communist, celebrated through capitalism! "Che was like the little engine that couldn't, he just sucked" -Fidel Castro "I love celebrating communist revolutionaries by wearing shirts with their icons on them made in third world slave labor factories, it's how they would have wanted it!" -American Hipster, Dew Schnozzle "Che was pretty awesome... what did he do? I don't have any idea, all my buddies say he was awesome, why would I even research something like that?" -Ben Atool, Minimum Wage Rights Activist "I love the sticker, but I'm kind of scared someone who was alive back then will see his face and try to rear end me." -Javier Alejandro, Paraguay 3.5" x 11"1https://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-bumper-sticker-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-bumper-sticker-49.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-t-shirt-athletic-fit-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-t-shirt-athletic-fit-45.jpgcustom-itemoptacticalgear-pagetshirtsOPTATFTCHET3025OPT DouCheBag T-Shirt Athletic FitOPT111Dedicated to the ultimate communist douchebag. Wanna piss off liberals, commies, socialists, and clueless douchebags who have no idea who Che was or what he stood for? Athletic fit Next Level SHORT SLEEVE Tee, poly-cotton blend, order one size larger for loose fit Set-in rib collar with shoulder-to-shoulder taping Double-needle sleeve and bottom hems Color: Heather Gray Sizes: Small - 3XLarge1https://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-t-shirt-athletic-fit-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-douchebag-t-shirt-athletic-fit-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-emanuel-wyne-pirate-flag-patch-32.jpgitem.optacticalgear-pageflagpatches12CP5070884OPT Emanuel Wynn Pirate Flag PatchOPT111Approximately 3 inches by 2 inches, backed with hook side VELCRO Brand fastener.1https://s.turbifycdn.com/aah/optacticalgear/opt-emanuel-wyne-pirate-flag-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-emanuel-wyne-pirate-flag-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-enhanced-watch-cap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-enhanced-watch-cap-45.jpgcustom-itemoptacticalgear-pageopthatsOPTWATCAP19.9914.39OPT Enhanced Watch CapOPT111THE NEED:
Upgrade the Army issue cold weather / watch cap and modify it to be a solid patch platform for duty patches, or morale items. THE SOLUTION:
OPT's owner approached Milspec Monkey about modifying an existing design he sells by adding a rear patch panel to hold the US Army Nametape. THE OUTCOME: A quality, comfortable, and warm watch cap which accommodates duty patches or morale items. TECH SPECS:
- 100% synthetic, microfleece, no-pill POLARTEC 100
- Front Pile Tape is 3.75" x 2.5" with tapered corners
- Rear Pile Tape is 1.5" x 4.75"
- Edges sewn with a lock stitch to prevent snags when brushing by the loop area
- One Size Design
- Made in U.S.A.
- Berry Amendment Compliant All materials and workmanship are 100% made in the USA Patches not included.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-enhanced-watch-cap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-enhanced-watch-cap-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-exclusives-62.jpgcustom-itemoptacticalgear-pageindex-OPT Exclusives1optmasofpadejowabllahooptappareloptshortsopthatsopttagemedicalpatchesgrpaflagpatchespvcpatchesstickershodepaandstlacutpaOur proprietary designs and collaborations.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-exclusives-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-exclusives-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-fun-meter-patch-40.jpgitem.optacticalgear-pagegrpa12CP5064992OPT Fun Meter PatchOPT111Is your fun-meter pegged? These items measure one inch by two inches, and come with a "hook" VELCRO Brand fastener back. Available in full color, blue with white trim, or in tactical colors subdued for green or desert type operations.1https://s.turbifycdn.com/aah/optacticalgear/opt-fun-meter-patch-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-fun-meter-patch-49.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-chest-patch-3-inch-x-5-inch-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-chest-patch-3-inch-x-5-inch-59.jpgcustom-itemoptacticalgear-pageflagpatchesOPTGFCP6OPT Gadsden Flag Large Patch 3 x 5 inchOPT111The Gadsden flag is a historical American flag with a yellow field depicting a rattlesnake coiled and ready to strike. Positioned below the rattlesnake are the words "Don't tread on me." The flag is named after American general and statesman Christopher Gadsden (1724–1805), who designed it in 1775 during the American Revolution. It was also used by the Continental Marines as an early motto flag, along with the Moultrie Flag. Hook Tape Backing. Designed to be worn on the chest of Body Armor. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-chest-patch-3-inch-x-5-inch-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-chest-patch-3-inch-x-5-inch-69.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-small-patch-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-small-patch-58.jpgcustom-itemoptacticalgear-pageflagpatchesOPTGADSM4OPT Gadsden Flag Small PatchOPT111 The Gadsden flag is a historical American flag with a yellow field depicting a rattlesnake coiled and ready to strike. Positioned below the rattlesnake are the words "Don't tread on me." The flag is named after American general and statesman Christopher Gadsden (1724–1805), who designed it in 1775 during the American Revolution. It was also used by the Continental Marines as an early motto flag, along with the Moultrie Flag. Velcro Hook Tape Backing. Size approximately 2 x 3 inches. 1https://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-small-patch-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-small-patch-71.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-sticker-29.jpgcustom-itemoptacticalgear-pagestickersOPTGADSSTICKER3OPT Gadsden Flag StickerOPT111Long-lasting printed vinyl sticker featuring the Gadsden Flag. The Gadsden flag is a historical American flag with a yellow field depicting a rattlesnake coiled and ready to strike. Positioned below the rattlesnake are the words "Don't tread on me." The flag is named after American general and statesman Christopher Gadsden (1724–1805), who designed it in 1775 during the American Revolution. It was also used by the Continental Marines as an early motto flag, along with the Moultrie Flag. Size approximately 2.63 x 4 inches. Long-lasting printed vinyl sticker.1https://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gadsden-flag-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-pvc-patch-46.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTGRENPVC7OPT Gren-Ade Logo PVC PatchOPT111Features:
-PVC Material.
-Velcro Hook backing
-Size: 3.5 inch diameter]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-pvc-patch-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-pvc-patch-55.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTGREN3OPT Gren-Ade Logo StickerOPT111Features:
-Long-lasting printed vinyl sticker
-Size: 4 inch diameter]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-t-shirt-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-t-shirt-17.jpgcustom-itemoptacticalgear-pageoptapparelOPTGRENTEENEW25OPT Gren-Ade Logo T-ShirtOPT111T-Shirt tribute to the finest of tossable munitions, this shirt is built to the quality, and specs that OPT demands of its products. This is a light weight, athletic fit, durable, moisture wicking shirt. Built for those times when a clingy fabric is least desirable, whether in the gym, at the range, on the trail, lounging and chill on the couch, or spending time with friends and family. OPT Gren-Ade Logo on front, small sign logo on upper back. Next Level Brand T-shirt: Athletic Fit, 60% Cotton 40% Poly Blend, Lightweight Material. For a loose fit, order one size larger than normal. Charcoal-Heather shirt, short sleeve.1https://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-t-shirt-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gren-ade-logo-t-shirt-30.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-patch-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-patch-45.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTJOEP5OPT Gustav Joe Logo PatchOPT111-High quality PVC material
-Velcro Hook backing
-Size: 1.5 x 1.25 inches Types:
-Standard Full Color
-Glow in the Dark Full Color (looks the same as Standard version)]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-patch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-patch-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTJOE3OPT Gustav Joe Logo StickerOPT111Features:
-Long-lasting printed vinyl sticker
-Size: 5 x 4 inches]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-mini-30.jpgcustom-itemoptacticalgear-pagestickersOPTJOEM1.5OPT Gustav Joe Logo Sticker - MiniOPT111-Long-lasting printed vinyl sticker
-Size: 2 x 1.5 inches]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-mini-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-gustav-joe-logo-sticker-mini-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-hats-38.jpgcustom-itemoptacticalgear-pageoptexclusivesOPT Hats1hodefrskpahahodedetistpahodekhpahathoderagrpahaliedhodetanhoptrahatsocooptrangehatoptmutrflhatoptenwacapoptsignlogohathodeataupahahodemupahathodemublpahahodemutrpahahodewatrclhahodemublcltrhodewatrpahahodewocapahahodeorclorha1https://s.turbifycdn.com/aah/optacticalgear/opt-hats-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hats-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/special-forces-maritime-operations-oda-team-patch-production-over-run-45.jpgcustom-itemoptacticalgear-pagegrpaG003OPT Hellfish PatchOPT111-Left-Facing: Hellfish facing to left of patch.
-Right-Facing: Hellfish facing to right of patch. Sold individually.]]>1https://s.turbifycdn.com/aah/optacticalgear/special-forces-maritime-operations-oda-team-patch-production-over-run-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/special-forces-maritime-operations-oda-team-patch-production-over-run-52.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-henry-every-pirate-flag-patch-39.jpgitem.optacticalgear-pageflagpatches12CP5070894OPT Henry Every Pirate Flag PatchOPT111Approximately 3 inches by 2 inches, backed with hook side VELCRO Brand fastener.1https://s.turbifycdn.com/aah/optacticalgear/opt-henry-every-pirate-flag-patch-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-henry-every-pirate-flag-patch-48.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/clearance-opt-i-fight-for-bush-patch-48.jpgitem.optacticalgear-pagegrpa21IFB43.5OPT I Fight For Bush PatchOPT1111https://s.turbifycdn.com/aah/optacticalgear/clearance-opt-i-fight-for-bush-patch-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-opt-i-fight-for-bush-patch-55.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/johnnie-warpath-black-label-hoodie-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/johnnie-warpath-black-label-hoodie-43.jpgcustom-itemoptacticalgear-pageoptexclusivesOPT-JWH44.95OPT Johnnie Warpath HoodieOPT111Sizing: standard Hoodie fit, go with your normal size.]]>1https://s.turbifycdn.com/aah/optacticalgear/johnnie-warpath-black-label-hoodie-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/johnnie-warpath-black-label-hoodie-53.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-johnnie-warpath-sticker-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-johnnie-warpath-sticker-45.jpgcustom-itemoptacticalgear-pagestickersXXJW43OPT Johnnie Warpath StickerOPT111Top shelf stickers for those on the Warpath. Keep Warring. Size: 4 x 3.71 inches1https://s.turbifycdn.com/aah/optacticalgear/opt-johnnie-warpath-sticker-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-johnnie-warpath-sticker-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-large-blackbeard-pirate-patch-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-large-blackbeard-pirate-patch-48.jpgcustom-itemoptacticalgear-pageflagpatchesOPTBBPPL6OPT Large Blackbeard Pirate PatchOPT111 Ask and ye shall receive... driven by customer requests, OPT brings you our exclusive Large Blackbeard Pirate Flag Patch. Approximately 3 inches by 4.25 inches, hook VELCRO Brand fastener backed.1https://s.turbifycdn.com/aah/optacticalgear/opt-large-blackbeard-pirate-patch-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-large-blackbeard-pirate-patch-61.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-large-pvc-flag-patch-3-x-5-inch-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-large-pvc-flag-patch-3-x-5-inch-44.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTPVCFLAG7OPT Large PVC US Flag Patch 3 x 5 inchOPT111 Rubberized/PVC material with Hook tape backing. Easier to clean off than embroidered version when dirty. Designed to be worn on the chest of an armor carrier. 1https://s.turbifycdn.com/aah/optacticalgear/opt-large-pvc-flag-patch-3-x-5-inch-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-large-pvc-flag-patch-3-x-5-inch-54.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-major-league-wolverine-patch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-major-league-wolverine-patch-54.jpgitem.optacticalgear-pagegrpa12CP5179754OPT Major League Wolverine PatchOPT111WOLVERINES!!! What more needs to be said? OPT exclusive, made in collaboration with Mil-Spec Monkey. Measures 3" x 2.2" Picture taken on a Crye Combat Shirt and a PCU soft shell. VELCRO Brand fastener backed1https://s.turbifycdn.com/aah/optacticalgear/opt-major-league-wolverine-patch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-major-league-wolverine-patch-67.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-embroidery-patch-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-embroidery-patch-48.jpgcustom-itemoptacticalgear-pagegrpaOPTMANDINFPTCH43OPT Mandalorian Infantry Embroidered PatchOPT111 Modeled after the Mandalorian symbol found on Boba Fett's armor, this patch features added Infantry crossed Rifles in the background. Sewn embroidery patch. Velcro Hook backing. 2.5 inch x 3.5 inch1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-embroidery-patch-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-embroidery-patch-61.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-ranger-panties-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-ranger-panties-45.jpgcustom-itemoptacticalgear-pageoptshortsOPTMANDINRP20OPT Mandalorian Infantry Ranger PantiesOPT111 Our exclusive Mandalorian Infantry Ranger Panties feature the Mandalorian symbol found on Boba Fett's armor with added Infantry crossed Rifles in the background. These Silkies are just what a grunt needs when you're knee deep in the Sarlacc Suck.1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-ranger-panties-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-ranger-panties-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTMANDIN3OPT Mandalorian Infantry StickerOPT111A tribute to all things Mandalorian and Grunt (yes, we were Infantry, give me a buffer, simple green, and I'll prove it while making mom jokes, and bitching about the shammers in 2nd platoon). Modeled after the Mandalorian symbol found on Boba Fett's armor, this sticker features added Infantry crossed rifles in the background. Adhesive backed. 3-inch by 5-inch oval1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-t-shirt-36.jpgcustom-itemoptacticalgear-pageoptapparelOPTMANDINTEE25OPT Mandalorian Infantry T-ShirtOPT111Modeled after the Mandalorian symbol found on Boba Fett's armor, this T-Shirt features Infantry crossed Rifles in the background. This is just what a grunt needs when you're knee deep in the Sarlacc Suck. Next Level Brand T-shirt: 60% Cotton 40% Poly Blend, lightweight material. Color: Black with off-white logo. T-Shirt only. Helmet not included.1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-t-shirt-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-infantry-t-shirt-45.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-patch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-patch-48.jpgcustom-itemoptacticalgear-pagegrpaOPTMANDPATCH3OPT Mandalorian SOF Embroidered PatchOPT111 Modeled after the Mandalorian symbol found on Boba Fett's armor, this patch features added Special Forces crossed arrows and Dagger in the background. Sewn embroidery patch. Velcro Hook backing. 3-inch diameter. 1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-patch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-patch-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-package-deal-39.jpgcustom-itemoptacticalgear-pageoptexclusivesOPTMANDSOFD44.7927.99OPT Mandalorian SOF Package Deal!OPT111IT'S BACK! For the price of 1 Mandalorian SOF T-Shirt and 1 Mandalorian SOF PVC Patch you get an additional Embroidered Patch and 2 Stickers. That's 38% off the regular price and you're covered for whatever the galaxy throws at you! Deal Includes:
1 x Mandalorian SOF T-Shirt
1 x Mandalorian SOF PVC Patch
1 x Mandalorian SOF Embroidered Patch
2 x Mandalorian SOF Stickers This deal available for a limited time, get some and may the force be with you... This item is excluded from the OPT Exclusive Swag Sale.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-package-deal-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-package-deal-49.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-pvc-patch-45.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTMANDPVC6OPT Mandalorian SOF PVC PatchOPT111Modeled after the Mandalorian symbol found on Boba Fett's armor, this PVC vinyl patch features added Special Forces crossed arrows and Dagger in the background. PVC Material. Velcro Hook backing. 3-inch diameter. 1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-pvc-patch-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-pvc-patch-54.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-ranger-panties-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-ranger-panties-49.jpgcustom-itemoptacticalgear-pageoptshortsOPTMANDRP20OPT Mandalorian SOF Ranger PantiesOPT111 Exclusively through O P Tactical! These are custom printed SOFFE Tricot Running Shorts (AKA Ranger Panties) with our Mandalorian SOF Logo on the left side. Modeled after the Mandalorian symbol found on Boba Fett's armor, this logo features added Special Forces crossed arrows and Dagger in the background. Color: Black1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-ranger-panties-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-ranger-panties-62.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-sticker-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-sticker-61.jpgcustom-itemoptacticalgear-pagestickersOPTMAND3OPT Mandalorian SOF StickerOPT111 Modeled after the Mandalorian symbol found on Boba Fett's armor, this sticker features added Special Forces crossed arrows and Dagger in the background. Adhesive backed. 3-inch diameter.1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-sticker-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-sticker-74.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-t-shirt-42.jpgcustom-itemoptacticalgear-pageoptapparelOPTMANDT621025OPT Mandalorian SOF T-ShirtOPT111Modeled after the Mandalorian symbol found on Boba Fett's armor, this T-shirt features added Special Forces crossed arrows and Dagger in the background. Next Level Brand T-shirt: 60% Cotton 40% Poly Blend, lightweight material. Color: Black with off-white logo.1https://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-t-shirt-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mandalorian-sof-t-shirt-51.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mega-force-shoulder-insignia-pvc-30.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTMFSIP7OPT Mega Force Shoulder Insignia PVCOPT111Mega Force, Shoulder Unit Insignia PVC Patch. In honor of the finest SOF Light Infantry unit ever assembled. Size: 4" Tall x 2.25" Wide PVC material Velcro hook backing1https://s.turbifycdn.com/aah/optacticalgear/opt-mega-force-shoulder-insignia-pvc-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mega-force-shoulder-insignia-pvc-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-minor-league-shooters-pvc-patch-38.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTMLSPVC7OPT Minor League Shooters PVC PatchOPT111We can't all be first round picks, but we can still answer the call Size: 2" x 3" PVC material Glows in the dark Velcro hook backing.1https://s.turbifycdn.com/aah/optacticalgear/opt-minor-league-shooters-pvc-patch-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-minor-league-shooters-pvc-patch-47.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-mobile-infantry-pvc-patch-30.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTMOBINFPVC7OPT Mobile Infantry PVC PatchOPT111Service guarantees citizenship! Everybody fights, no one quits. If you don't do your job, I'll kill you myself! Size: 3" PVC material Velcro hook backing. 1https://s.turbifycdn.com/aah/optacticalgear/opt-mobile-infantry-pvc-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mobile-infantry-pvc-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-multicam-tropic-flag-hat-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-multicam-tropic-flag-hat-45.jpgcustom-itemoptacticalgear-pageopthatsOPTFLAGHAT20OPT Multicam Tropic Flag HatOPT111THE NEED:
A simple range hat with embroidered US Flag and no top button for use with electronic hearing protection. THE SOLUTION:
OPT's owner approached a hat manufacturer that does Berry Compliant hats for a simple solution to a simple need. THE OUTCOME:
A quality, comfortable range hat with embroidered US Flag in matching colors that meets the needs of both professional and civilian shooters. OPT website located on the back for others to know where to go for quality kit. TECH SPECS:
- Genuine Crye Precision 50/50 Ripstop Fabric
- Flag is 3" x 2"
- One Size Design
- Bungee retention on the back is internally adjustable and provides added comfort.
- Made in U.S.A.
- Berry Amendment Compliant Life time warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-multicam-tropic-flag-hat-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-multicam-tropic-flag-hat-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-north-carolina-large-state-flag-patch-31.jpgcustom-itemoptacticalgear-pageflagpatchesOPTNCFLAG6OPT North Carolina Large State Flag PatchOPT111North Carolina State Flag, 3 x 5 inch size, velcro hook backing. The perfect size to fit on the front panel of most armor carriers. Note - dimensions on the flag were scaled to best fit the 3 x 5 inch size common to most armor carriers and vests.1https://s.turbifycdn.com/aah/optacticalgear/opt-north-carolina-large-state-flag-patch-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-north-carolina-large-state-flag-patch-40.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-patch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-patch-54.jpgcustom-itemoptacticalgear-pagegrpa12ND6OPT Nous Defions Patch - LargeOPT111OPT's custom Nous Defions Patch, 3.5 x 3.5 inch size with velcro hook backing for attaching to combat shirts, vests, and packs. US Army Special Forces Direct Action (DA) CQB Skull, Dagger and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is the symbol that represents DA units and schools, its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the skull represents the same thing any skull represents, death. "Nous Defions" is French for "we defy" representing the unit's audacity.1https://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-patch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-patch-67.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-pvc-patch-30.jpgcustom-itemoptacticalgear-pagepvcpatches12NDPVC6OPT Nous Defions PVC PatchOPT111OPT's custom Nous Defions PVC Patch, 3 x 3 inch size with velcro hook backing for attaching to combat shirts, vests, and packs. US Army Special Forces Direct Action (DA) CQB Skull, Dagger and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is the symbol that represents DA units and schools, its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the skull represents the same thing any skull represents, death. "Nous Defions" is French for "we defy" representing the unit's audacity.1https://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-pvc-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-nous-defions-pvc-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-omega-sector-patch-30.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTOMSECTPVC7OPT Omega Sector PatchOPT111Omega Sector, the true silent professionals Size: 3.5" PVC material Velcro hook backing.1https://s.turbifycdn.com/aah/optacticalgear/opt-omega-sector-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-omega-sector-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-original-t-shirt-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-original-t-shirt-59.jpgcustom-itemoptacticalgear-pageoptapparelOPTLOGOT3025OPT Original T-Shirt OPT111 The original OPT Logo. Athletic fit Next Level Tee, poly-cotton blend, order one size larger for loose fit. Set-in rib collar with shoulder-to-shoulder taping Double-needle sleeve and bottom hems Color: Black Sizes: Small - 3XLarge1https://s.turbifycdn.com/aah/optacticalgear/opt-original-t-shirt-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-original-t-shirt-72.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-pvc-us-flag-patch-standard-size-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-pvc-us-flag-patch-standard-size-45.jpgcustom-itemoptacticalgear-pageflagpatchesOPTPVCUSSTD7OPT PVC US Flag Patch - Standard SizeOPT111Velcro backed US Flag patch made from heavy duty PVC for to withstand all environments. •Hook Tape backing •3.25" x 2" •Heavy duty washable PVC1https://s.turbifycdn.com/aah/optacticalgear/opt-pvc-us-flag-patch-standard-size-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-pvc-us-flag-patch-standard-size-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-52.jpgcustom-itemoptacticalgear-pageopthatsOPTRANHAT24.9920OPT Range HatOPT111THE NEED:
A simple range hat with no top button for use with hearing protection, and available Pile Tape panels for morale or IFF items. THE SOLUTION:
OPT's owner approached a hat manufacturer that does Berry Compliant hats for a simple solution to a simple need. THE OUTCOME:
A quality, comfortable range hat that meets the needs of both professional and civilian shooters. TECH SPECS:
- Genuine Crye Precision 50/50 Ripstop Fabric
- Front Pile Tape is 3" x 2"
- Rear Pile Tape is 3" x 2"
- Top Pile Tape is 1" x 1"
- One Size Design
- Bungee retention on the back is internally adjustable and provides added comfort.
- Made in U.S.A.
- Berry Amendment Compliant OPTIONS:
Multicam, Multicam Black, Multicam Arid, Multicam Tropic Life time warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-65.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-solid-color-all-cotton-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-solid-color-all-cotton-47.jpgcustom-itemoptacticalgear-pageopthatsOPTRANHATSC2520OPT Range Hat Solid Color - All CottonOPT111THE NEED:
A simple range hat with no top button for use with hearing protection, and available Pile Tape panels for morale or IFF items. THE SOLUTION:
OPT's owner approached a hat manufacturer that does Berry Compliant hats for a simple solution to a simple need. THE OUTCOME:
A quality, comfortable range hat that meets the needs of both professional and civilian shooters. TECH SPECS:
- 100% Cotton
- Front Pile Tape is 3" x 2"
- Rear Pile Tape is 3" x 2"
- Top Pile Tape is 1.5" x 1.5"
- One Size Design
- Bungee retention on the back is internally adjustable and provides added comfort.
- Made in U.S.A.
- Berry Amendment Compliant OPTIONS:
Jalepeno (close match to Ranger Green), Khaki Life time warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-solid-color-all-cotton-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-range-hat-solid-color-all-cotton-60.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-red-crescent-red-diamond-patch-40.jpgitem.optacticalgear-pagegrpa12CP5070914OPT Red Cross - Red Crescent - Red Diamond PatchOPT111Approximately 2 inches by 3 inches, hook VELCRO Brand fastener backed.1https://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-red-crescent-red-diamond-patch-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-red-crescent-red-diamond-patch-49.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-patch-49.jpgitem.optacticalgear-pagegrpa12CP5070933OPT Red Cross PatchOPT1111.75 inches by 1.75 inches, backed with hook side VELCRO Brand fastener.1https://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-patch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-red-cross-patch-58.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-logo-sticker-68.jpgcustom-itemoptacticalgear-pagestickersOPTSFALS3OPT SF Assaulter Logo StickerOPT111OPTactical Historical SOF Unit Tribute Series: US Army Special Forces Direct Action (DA) CQB Skull, Dagger and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is the symbol that represents DA units and schools, its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the skull represents the same thing any skull represents, death. "Nous Defions" is French for "we defy" representing the unit's audacity. Diameter: 4 inches Adhesive backed sticker.1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-logo-sticker-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-logo-sticker-77.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-us-flag-patch-3-x-5-inch-30.jpgcustom-itemoptacticalgear-pageflagpatchesOPTSFAUS6OPT SF Assaulter US Flag Patch 3 x 5 InchOPT111Hook Tape Backing, 3 x 5 inches. US Army Special Forces Direct Action (DA) CQB Skull, Dagger and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is a US flag inlaid with the symbol for DA units and schools, its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the skull represents the same thing any skull represents, death. "Nous Defions" is French for "we defy" representing the unit's audacity. Designed to be worn on the chest of Body Armor.1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-us-flag-patch-3-x-5-inch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-assaulter-us-flag-patch-3-x-5-inch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-34.jpgcustom-itemoptacticalgear-pageoptshortsOPTSFRP20OPT SF Ranger Panties - Assaulter LogoOPT111Exclusively through O P Tactical! These are custom printed SOFFE Tricot Running Shorts (AKA Ranger Panties) with Special Forces "Nous Defions" Assaulter Logo on the left side. Color: Black1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-41.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-sniper-logo-33.jpgcustom-itemoptacticalgear-pageoptshortsOPTSFRPSNIPER20OPT SF Ranger Panties - Sniper LogoOPT111Exclusively through O P Tactical! These are custom printed SOFFE Tricot Running Shorts (AKA Ranger Panties) with Special Forces Sniper Logo on the left side. Color: Black1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-sniper-logo-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-ranger-panties-sniper-logo-42.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-patch-56.jpgcustom-itemoptacticalgear-pagegrpaOPTSFSLP5OPT SF Sniper Logo PatchOPT111OPTactical Historical SOF Unit Tribute Series: US Army Special Forces Snipers Skull, Dagger, Crosshairs, and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is the symbol that represents a particular group of SFODAs in a direct action unit. Its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg, and this symbol was developed by an SFODA that has its roots in the units that came out of that project. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the crosshairs represent the long range interdiction capability, the skull represents the same thing any skull represents, death. The original version of this is still in use by certain units, this is modified and is not a direct copy. Hook Tape backing, 3.5 inch diameter.1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-patch-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-patch-65.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-sticker-66.jpgcustom-itemoptacticalgear-pagestickersOPTSFSLS3OPT SF Sniper Logo StickerOPT111OPTactical Historical SOF Unit Tribute Series: US Army Special Forces Snipers Skull, Dagger, Crosshairs, and Crossed Arrows. A time honored symbol of excellence in the realm of small unit surgical strike operations. This is the symbol that represents a particular group of SFODAs in a direct action unit. Its roots come from the original Blue Light project run by 5th SFG (A) at Mott lake in Ft. Bragg, and this symbol was developed by an SFODA that has its roots in the units that came out of that project. The Arrows represent the SF Regiment and American Indian field craft, the Dagger represents covert action and unconventional warfare, the crosshairs represent the long range interdiction capability, the skull represents the same thing any skull represents, death. The original version of this is still in use by certain units, this is modified and is not a direct copy. Diameter: 4 inches Adhesive backed sticker.1https://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-sticker-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sf-sniper-logo-sticker-75.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-apparel-65.jpgcustom-itemoptacticalgear-pageoptexclusivesOPT Shirts1optgrlothodetophattehoderesiloteoptbeinlitoptdotatfitoptoriginalteeoptacetoteerosqtwifitoptmaintoptmasoftoptbuwalotlioptsilotliwe1https://s.turbifycdn.com/aah/optacticalgear/opt-apparel-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-apparel-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-shorts-35.jpgcustom-itemoptacticalgear-pageoptexclusivesOPT Shorts1optmasofrapaoptmainrapaoptsfrapaoptsfrapasnl1https://s.turbifycdn.com/aah/optacticalgear/opt-shorts-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-shorts-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-hat-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-hat-49.jpgcustom-itemoptacticalgear-pageopthatsOPTLHAT3025OPT Sign Logo HatOPT111 Our store sign logo. Adjustable strap back closure, ripstop material hat, with OPT logo embroidered on the front, and our URL embroidered on the rear. No button on top for comfort when using over the head ear protection. Light Olive Green in color ripstop material. Logo is Grey-Green with Tan Lettering.1https://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-hat-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-hat-62.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-patch-30.jpgcustom-itemoptacticalgear-pagegrpaOPTSIGNEMB43OPT Sign Logo PatchOPT111An embroidery tribute to the newest chapter in the OPT Legacy, this patch is built to the quality and specs that people have come to expect from OPT. 3.75 x 2.30 inches, Velcro Backed.1https://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-sticker-21.jpgcustom-itemoptacticalgear-pagestickersOPTSIGNSTK32OPT Sign Logo StickerOPT111A sticker tribute to the newest chapter in the OPT Legacy. 4 x 2.85 inches1https://s.turbifycdn.com/aah/optacticalgear/opt-sign-sticker-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-sticker-28.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-t-shirt-light-weight-loose-fit-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-t-shirt-light-weight-loose-fit-53.jpgcustom-itemoptacticalgear-pagetshirtsOPTSIGNTEETB25OPT Sign Logo T-Shirt - Light Weight Loose FitOPT111TRI-BLEND Specs
50/37/13 Polyester/Cotton/Rayon Pre-shrunk Jersey
Weight approx. 4.5 oz / 153 g
Soft, lightweight jersey with moisture wicking
Seamless 1x1 rib collar with two-needle coverstitching on front neck
Tear away label
Shoulder-to-shoulder taping
Two-needle hemmed sleeves and bottom
Quarter-turned to eliminate center crease Imported, printed in USA]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-t-shirt-light-weight-loose-fit-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-sign-logo-t-shirt-light-weight-loose-fit-66.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-blackbeard-pirate-flag-patch-32.jpgitem.optacticalgear-pageflagpatches12CP5070874OPT Small Blackbeard Pirate Flag PatchOPT111Approximately 2 inches by 3 inches, hook VELCRO Brand fastener backed.1https://s.turbifycdn.com/aah/optacticalgear/opt-blackbeard-pirate-flag-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-blackbeard-pirate-flag-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-tactical-gear-43.jpgcustom-itemoptacticalgear-pageoptexclusivesOPT Tactical Gear and Exclusive Offers1vesyliweplcaopmbasplca1https://s.turbifycdn.com/aah/optacticalgear/opt-tactical-gear-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-tactical-gear-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-texas-flag-large-patch-3-x-4-5-inch-32.jpgcustom-itemoptacticalgear-pageflagpatchesOPTTFPL6OPT Texas Flag Large Patch 3 x 4.5 InchOPT111Hook Tape Backing, 3 x 4.5 inches. Designed to be worn on the chest of Body Armor. 1https://s.turbifycdn.com/aah/optacticalgear/opt-texas-flag-large-patch-3-x-4-5-inch-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-texas-flag-large-patch-3-x-4-5-inch-41.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-large-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-large-55.jpgitem.optacticalgear-pagegrpaOPTGCLG5OPT The Original Guns and Coffee Patch - LargeOPT111Both colors are 3.5 inches in diameter.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-large-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-large-68.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-small-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-small-54.jpgitem.optacticalgear-pagegrpaOPTGCSMALL3OPT The Original Guns and Coffee Patch - SmallOPT111NOTE: the Green&White patch is 2.75 inches in diameter, and the Green&Tan is 3 inches in diameter.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-small-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-patch-small-67.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-sticker-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-sticker-61.jpgcustom-itemoptacticalgear-pagestickersGACS3OPT The Original Guns and Coffee 4 inch StickerOPT111This is the original, and still the best, dating back to spring 2010, an idea born from a thread on Lightfighter forum and that has come to be the cornerstone of a very common icon within the industry. The emblems on the side of the patch are E-Type Silhouettes used as rifle targets in the military. Sticker comes in 4 inch and 6 inch diameter. Full color or subdued color options.1https://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-sticker-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-the-original-guns-and-coffee-sticker-74.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-total-war-bumper-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTTOTWARBS4OPT Total War Bumper StickerOPT111A design that speaks for itself... Working with a renowned artist in the gear industry, OPT teamed up with Righteous Duke to bring you a tribute to the perfect form of coexistence, Total WAR. 3" x 10"1https://s.turbifycdn.com/aah/optacticalgear/opt-total-war-bumper-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-total-war-bumper-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-us-flag-large-patch-3-x-5-inch-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-us-flag-large-patch-3-x-5-inch-53.jpgcustom-itemoptacticalgear-pageflagpatchesOPTUSFCP6OPT US Flag Large Patch 3 x 5 inchOPT111 Hook Tape Backing, 3 x 5 inches. Designed to be worn on the chest of Body Armor. 1https://s.turbifycdn.com/aah/optacticalgear/opt-us-flag-large-patch-3-x-5-inch-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-us-flag-large-patch-3-x-5-inch-66.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/us-flag-patch-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/us-flag-patch-54.jpgitem.optacticalgear-pageflagpatches34734_4OPT US Flag PatchPatch]]>111Note: Due to how small this item is, the Multicam version has very little of the pattern shown on it.]]>1https://s.turbifycdn.com/aah/optacticalgear/us-flag-patch-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/us-flag-patch-64.jpgPatch]]>https://s.turbifycdn.com/aah/optacticalgear/opt-war-drug-sticker-30.jpgcustom-itemoptacticalgear-pagestickersOPTDRU3OPT War Drug StickerOPT111Features:
-Long-lasting printed vinyl sticker
-Size: 5 x 3 inches]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-war-drug-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-war-drug-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-yeet-sticker-30.jpgcustom-itemoptacticalgear-pagestickersoptyeetsticker43OPT YEET! StickerOPT111Features:
- Long-lasting printed vinyl sticker
- Size 2" x 4.75"]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-yeet-sticker-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-yeet-sticker-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-altama-exclusive-maritime-assault-land-warfare-mod-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-altama-exclusive-maritime-assault-land-warfare-mod-21.jpgcustom-itemoptacticalgear-pageovbeofo138330002112.49104.99OPT-Altama Exclusive Maritime Assault - Land Warfare ModAltama Boots111Features
• Mid cut design for better ankle support while being low enough for easy range of motion
• High abrasion quick drying 1000D Cordura quarter panels
• Air mesh linings help wick away sweat and other moisture quickly from your feet
• Non-shine rust-proof lace hardware will not break on the battle field
• Low profile laces
• Full length one piece ABS shank provides stability and support when climbing a caving ladder
• Anti-microbial foam insole with fabric top cover for ease of use with socks
• High abrasion rubber sticky outsole originally developed for rock climbing shoes, meets ASTM F2913-17 test for slip resistance
• Zero Drop outsole provides full contact with the floor for increased stability
• Heel counter is Back Part Molded to produce a customized curve that cups the foot, eliminated all "break-in" discomfort. Designed for Specials Ops. Worn by the Elite. These shoes are no longer fin-friendly; they do not feature drain holes, nor do they have the SEAL Rubber sticky outsoles. Sizing: Available in Regular and Wide sizes. Similar sizing to Converse Chuck Taylors. True to size for most people. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-altama-exclusive-maritime-assault-land-warfare-mod-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-altama-exclusive-maritime-assault-land-warfare-mod-35.jpgAltama Bootshttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-belt-pack-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-belt-pack-34.jpgcustom-itemoptacticalgear-pagehipegekitba117BLPM81137OPT-Hill People Gear M81 Woodland Belt Pack - SnubbyHill People Gear111Custom M81 Woodland Belt Pack available at O P Tactical! Sometimes attire and situations don't lend to on-body pistol carry very well and HPG's chest mounted kit bags might be out of place in those circumstances. HPG took their Snubby Kit Bag Original Pattern and replaced the mesh harness with a 1.5" webbing belt that can be worn around the waist or cross-body. This is a great solution to keep all your EDC items organized when you go to the gym, travel to a new city, or on a front country hike. This bag can carry up to a stock Glock 19 size firearm, but really shines with sub-compact pistols. Features:
- 500d construction
- Quick access concealed pistol compartment.
- 1.5" webbing belt with ITW Nexus buckle
- Elastic keepers for the webbing strap
- Velcro loop and dummy cord loop in pistol compartment allow for various retention options
- Tabs on the bottom to hang items.
- Front zippered access flat pocket with two interior slot pockets with dummy cord loops above them
- Large 1" deep main compartment with dual interior slot pockets with dummy cord loops above them.
- Main Compartment lined with 6/12 velcro loop that is laser cut to accept PALS style pouches. Specifications:
- Weight: 0.88 lb
- Length: 2.00 in
- Width: 8.50 in
- Height: 6.00 in Made in the USA. This Item is Excluded from ALL Coupon Codes.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-belt-pack-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-belt-pack-44.jpgHill People Gearhttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-original-kit-bag-full-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-original-kit-bag-full-56.jpgcustom-itemoptacticalgear-pagehipegekitba117M81OKBF148OPT-Hill People Gear M81 Woodland Original Kit Bag - FullHill People Gear111Custom M81 Woodland Kit Bags available at O P Tactical! Kit Bags were born out of the desire to discreetly carry a pistol in a way that doesn't interfere with a full size backpack. Kit Bags are so handy for keeping small items close at hand on the trail (or in the ATV, or in the canoe, or on the stand, etc.) that many folks choose to use them even without a pistol. The original Kit Bag has been around long enough now that we've added a few updates to the original design for V2:
• #10 zipper on the main cargo compartment instead of #8
• rear of the main cargo compartment is lined with PALS cut velcro faced fabric (First Spear 6/12) which allows for the mounting of PALS or velcro backed pouches inside the main compartmnet
• single row of PALS on the underside allows for mounting small items such as a knife The original Kit Bag V2 also includes the following features:
• 500d construction
• Quick access concealed pistol compartment
• Comfortable mesh backed H-harness allows you to wear the Kit Bag by itself or underneath of a pack
• Elastic keepers for the H-harness straps
• Velcro loop and dummy cord loop in pistol compartment allow for various retention options
• tabs with grimlocs at the top for hanging on another pack, or for use with Lifter Straps (included) for docking to a host pack
• Tabs on the bottom for attaching to another pack, or for use with the Stabilizer Kit (optional) for running with
• Front zippered access flat pocket with two interior slot pockets with dummy cord loops above them
• Large 1" deep main compartment with dual interior slot pockets with dummy cord loops above them Specifications:
• Weight: 1.00 lb
• Length: 2.50 in
• Width: 11.50 in
• Height: 7.50 in Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-original-kit-bag-full-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-original-kit-bag-full-70.jpgHill People Gearhttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-recon-kit-bag-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-recon-kit-bag-36.jpgcustom-itemoptacticalgear-pagehipegekitba117REKBM81120OPT-Hill People Gear M81 Woodland Recon Kit Bag - FullHill People Gear111Custom M81 Woodland Kit Bags available at O P Tactical! Some folks really like to have their own organizational layout and HPG gets that. The Recon Kit Bag takes the thin Runner's profile and adds a PALS grid on the front. This gives you the option of running low profile (size wise if not social wise) or adding your own PALS compatible pouches on the front. It is really nice with a Blue Force Gear triple 5.56 ten speed pouch on the front. It makes for a good weapon support platform for training classes (mags on front, BUG in the pistol compartment) or a mini-chest rig over a slick plate carrier for patrol. Features:
-500d construction
-8 channel / 3 row PALS grid
-Quick access concealed pistol compartment
-Comfortable mesh backed H-harness allows you to wear the Kit Bag by itself or underneath of a pack
-Elastic keepers for the H-harness straps
-Velcro loop and dummy cord loop in pistol compartment allow for various retention options
-Tabs with grimlocs at the top for hanging on another pack, or for use with Lifter Straps (optional) for docking to a host pack
-For use with the Stabilizer Kit (optional) for running with
-Front zippered access flat pocket with two interior slot pockets with dummy cord loops above them
-Pro-tip: one of our GI 1qt bottle holsters mounted on the front of a Recon makes a dandy quick access binocular carrier.

-Weight: 0.81 lb
-Length: 1.00 in
-Width: 11.50 in
-Height: 7.50 in Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-recon-kit-bag-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-recon-kit-bag-46.jpgHill People Gearhttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-runners-kit-bag-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-runners-kit-bag-34.jpgcustom-itemoptacticalgear-pagehipegekitba117RUKBM81106OPT-Hill People Gear M81 Woodland Runners Kit Bag - FullHill People Gear111Custom M81 Woodland Kit Bags available at O P Tactical! The Runner's Kit Bag was designed specifically for carrying a pistol while running in urban environments. It also works well in higher activity situations (running, mountain biking, rock climbing) where you would like to discreetly carry a pistol and very little else. Features:
-500d construction
-Quick access concealed pistol compartment
-Comfortable mesh backed H-harness allows you to wear the Kit Bag by itself or underneath of a pack
-Tabs on the bottom for attaching to another pack, or to use with the Stabilizer Kit (included) for less movement when running
-Velcro loop and dummy cord loop in pistol compartment allow for various retention options
-Tabs with grimlocs at the top for hanging on another pack, or for use with Lifter Straps (optional) for docking to a host pack
-Front zippered access flat pocket with two interior slot pockets with dummy cord loops above them
-Pro - tip: replace the color matched parachute cord zipper pulls with flamboyant contrasting colors of your choosing for an even lower social profile.
-This is not a good choice if you want to carry a 6 shot bigger bore revolver (S&W N-frame and similar). The lack of a middle pocket for the cylinder to intrude into tends to jam the cylinder into your chest. Go with the original Kit Bag instead.

-Weight: 0.81 lb
-Length: 1.00 in
-Width: 11.50 in
-Height: 7.50 in Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-runners-kit-bag-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hill-people-gear-m81-woodland-runners-kit-bag-44.jpgHill People Gearhttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-reagan-patch-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-reagan-patch-43.jpgcustom-itemoptacticalgear-pagehodepaandstOPTREAGAN6.5OPT-Hodge Defense Reagan PatchHodge Defense111 Fight the next Evil Empire with this high quality screen printed patch featuring our 40th President, Hodge Defense, and O P Tactical. Size: 4 x 3 inches Velcro hook backing.1https://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-reagan-patch-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-reagan-patch-56.jpgHodge Defensehttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-space-gun-patch-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-space-gun-patch-43.jpgcustom-itemoptacticalgear-pagehodepaandstOPTSG6.5OPT-Hodge Defense Space Gun PatchHodge Defense111 Hodge Defense, OPT War Department, Space Gun - a superior combination in design and excellence. If you get it, you get it. Size: 4 x 2.5 inches Velcro hook backing.1https://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-space-gun-patch-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-hodge-defense-space-gun-patch-56.jpgHodge Defensehttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-apc-shoulder-pads-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-apc-shoulder-pads-47.jpgcustom-itemoptacticalgear-pagecaac150VS-CPAD235OPT-Mayflower MBAV APC Shoulder PadsMayflower111• Stretchable Tweave material allows for slings and communications wiring to fit through the pad easily.
• Slim design for greater range of motion and less chafing along neck line.
• Thin foam padding for comfort on the underside of pad.
• Designed for 2-inch wide shoulder straps and will fit most carriers including vests from Mayflower, Velocity Systems, Crye Precision and Blue Force Gear.
• Similar design to shoulder pads found on the Velocity Systems Scarab LT. Sold as a set of 2 shoulder pads. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-apc-shoulder-pads-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-apc-shoulder-pads-63.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-assault-plate-carrier-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-assault-plate-carrier-45.jpgcustom-itemoptacticalgear-pagemaveclqaco50OPTMBAV276235OPT-Mayflower MBAV APC with Mesh PaddingMayflower111Our exclusive MBAV APC now includes 3D spacer mesh padding along the inner face of the front and back panels for comfort and ventilation! THE NEED:
A plate carrier that accommodates USSOCOM issued MBAV (Modular Body Armor Vest) soft armor and SAPI plates. Must feature high degree of scalability, modularity, PALS webbing, QASM compatibility, while maintaining the fundamentals of simplicity in wear and maintenance. THE SOLUTION: OPT's owner approached Mayflower about making simple modifications to the time proven, simple design of the Assault Plate Carrier. This is an APC sized to hold MBAV soft armor and SAPI plates, with added features of a removable front flap that exposes a pile tape belly area that easily accommodates any QASM compatible placard or chest rig, and updated slim shoulder pads with padding and stretchable tweave covering. THE OUTCOME: An affordable, highly modular, armor carrier, that provides any USSOCOM Operator with a high degree of load flexibility, and mobility; whether in training, or on the battlefield. FEATURES:
• Updated slim Shoulder Pads with thin padding for comfort and tweave stretch covering for running comms wiring and hydration tubing through. These are very similar to shoulder pads found on the Scarab LT Plate Carrier. Note: shoulder pads on the Multicam Tropic model are Ranger Green color since Tropic pattern is not yet available in tweave material. • The MBAV-APC comes with a removable front flap for optimized use with a SwiftClip Chest Rig or Placard. Front of the flap also features MOLLE/PALS webbing for pouch attachment and 3 rows of velcro loop for use with placards and chest rigs. • The upper front of the MBAV-APC contains an integral admin pouch with internal elastic loops to retain pens, pencils, chemlites or similar items. This pouch has a wider opening than the standard APC and can fit larger documents easier. • There is an additional pocket in front of the admin pouch to hold quick access documents like maps/index cards. • The front lower half of the APC has a velcro kangaroo pocket sized to hold up to three M4 sized magazines. A triple M4 pouch insert is available separately to fit this pocket. When using a triple mag insert, only hard plates that are less than 0.75 inches thick will fit properly. Plates that are 0.75 inches or thicker may have issues fitting into plate pocket when triple shingle is used and all 3 mags are in the shingle insert. • Cummerbund is made to Soft armor inserts, and can also fit thin 6x6 inch side plates in a separate pocket (may require an additional retainer strap to secure the top of a hard plate). Use same size Velocity Systems soft armor cummerbund insert as the size of the cummerbund. • The MBAV-APC features removable SwiftClip® Buckles on the front of the carrier to allow the individual to mount various chest rigs and placards directly to the carrier. This configuration allows the individual to use the same loadout with or without armor or have multiple rigs configured for different mission requirements. • Front/Back panels feature an internal plate strap to secure Hard plates and soft armor in place and adjust ride height in the pocket. Front/Back Panels available in two sizes; Small/Medium and Large/XLarge. Cummerbund available in 4 sizes. The plate pockets are sized to accommodate stand alone or in-conjunction with SAPI/ESAPI or Swimmer cut plates. Sized to fit MBAV soft armor or regular SAPI plate backer soft armor.Extensive testing has proven plate shifting is not an issue. The S/M APC will fit small, medium and 10”x12” sized plates. The L/XL APC will fit large and extra-large plates. Sizing:
S/M1 - Small/Medium Front and Back Panel, Small Cummerbund: 5 Columns of MOLLE per side
S/M2 - Small/Medium Front and Back Panel, Medium Cummerbund: 6 Columns of MOLLE per side
L/XL3 - Large/XLarge Front and Back Panel, Medium Cummerbund: 6 Columns of MOLLE per side
L/XL4 - Large/XLarge Front and Back Panel, Large Cummerbund: 8 Columns of MOLLE per side Cummerbund has a wide range of adjustment, when in doubt go with the larger Cummerbund size, as your armor will increase the diameter once in the carrier. S/M1 is best suited for users who wear Small or Medium SAPI Plates and have a thin waist (32 inch or less). Most users who wear Medium SAPI plates will need the S/M2 size. Most users who wear Large SAPI Plates will need L/XL3. L/XL4 will accommodate users who have a wider waist line and use Large or XL SAPI Plates. Weight: Approximately 2 lbs (S/M2 size) Material: 500D Cordura, Tweave Shoulder Pads All materials and workmanship are 100% made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-assault-plate-carrier-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-mayflower-mbav-assault-plate-carrier-55.jpgMayflowerhttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-47.jpgcustom-itemoptacticalgear-pageflagpatches82BLKBRD19.9917.99OPT-Spartan Village Blackbeard Pirate Patch - Large SizeSpartan Village111IR REFLECTIVE MODEL CANNOT SHIP INTERNATIONAL. USA Addresses only for this version. Made by Spartan Village at O P Tactical's request, these Blackbeard Pirate Flag Patches are laser-cut from Cordura nylon and feature Velcro Hook backing. They are the perfect size to fit on the front of a vest or carrier. Camouflage pattern colors are exact matching. Specs:
• 3 x 5 inch size
• Cordura material with matte vinyl background
• Velcro Hook backing Types:
• Black Vinyl background: visible spectrum only
• Black IR background: Infrared reflective Made in the USA. IR REFLECTIVE MODEL CANNOT SHIP INTERNATIONAL. USA Addresses only for this version. This Item is Excluded from the Limited Sale Coupon Codes.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-60.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-laser-cut-us-flag-patch-large-ir-r-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-laser-cut-us-flag-patch-large-ir-r-53.jpgcustom-itemoptacticalgear-pagelacutpa82SVFLAGIRLG27.9924.99OPT-Spartan Village Laser-Cut US Flag Patch - Large IR Version (R)Spartan Village111-3 x 5 inch size
-Cordura material with matte vinyl IR background
-Velcro Hook backing Made in the USA. Per ITAR regulations, IR flags are NOT AVAILABLE FOR EXPORT. USA Addresses Only. This Item is Excluded from the Limited Sale Coupon Codes.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-laser-cut-us-flag-patch-large-ir-r-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-laser-cut-us-flag-patch-large-ir-r-63.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-large-us-flag-patch-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-large-us-flag-patch-35.jpgcustom-itemoptacticalgear-pagelacutpa82SVFLAG21.9919.99OPT-Spartan Village Laser-Cut US Flag Patch - Large SizeSpartan Village111These patches are NOT IR reflective, which means no ITAR restrictions and makes them significantly less expensive. They are also non-reflective for visible light spectrum. Specs:
-3 x 5 inch size
-Cordura material with matte vinyl background
-Velcro Hook backing Made in the USA. This item is allowed to ship to international for our foreign customers! This Item is Excluded from the Limited Sale Coupon Codes.]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-village-large-us-flag-patch-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-large-us-flag-patch-45.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-44.jpgcustom-itemoptacticalgear-pagelacutpa82OPTMANDO18.9916.99OPT-Spartan Village Mandalorian SOF PatchSpartan Village111These patches are NOT IR reflective, which means no ITAR restrictions and makes them significantly less expensive. They are also non-reflective for visible light spectrum. 3.5 x 3.5 inches. Velcro Hook backing. Made in the USA. This Item is Excluded from the Limited Sale Coupon Codes.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-57.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-ir-r-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-ir-r-36.jpgcustom-itemoptacticalgear-pagelacutpa82MANDAIR27.9925.99OPT-Spartan Village Mandalorian SOF Patch - IR Version (R)Spartan Village111Per ITAR regulations, IR flags are NOT AVAILABLE FOR EXPORT. USA Addresses Only. This Item is Excluded from the Limited Sale Coupon Codes.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-ir-r-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-mandalorian-sof-patch-ir-r-46.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/opt-velocity-systems-assault-zip-on-panel-type-1-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-velocity-systems-assault-zip-on-panel-type-1-36.jpgcustom-itemoptacticalgear-pagevesyscplcaan98ZOMF-BP189.99OPT-Velocity Systems Scarab Assault Zip-On Panel Type 1Velocity Systems111Designed specifically to zip onto the Scarab LT Plate Carrier only. Not MOLLE compatible. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-velocity-systems-assault-zip-on-panel-type-1-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-velocity-systems-assault-zip-on-panel-type-1-46.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/optic-mounting-tools-35.jpgcustom-itemoptacticalgear-pageopticsOptic Mounting Tools1ardeoplecofixitstscjafixitstaltod1https://s.turbifycdn.com/aah/optacticalgear/optic-mounting-tools-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/optic-mounting-tools-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/optics-60.jpgcustom-itemoptacticalgear-pageweac-Optics / Mounts1lplowpovaopardsreddotsiamrmireddotsiopmotospscmobi1https://s.turbifycdn.com/aah/optacticalgear/optics-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/optics-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/ors-oral-rehydration-salts-37.jpgcustom-itemoptacticalgear-pagehysyorsorresa1.5 25 30ORS Oral Rehydration Salts PacketORS111Description: NSN# 6505-01-197-8809 Required treatment for severe diarrhea, or other illnesses where dehydration is a problem. These rehydration salts, made from the standard World Health Organization formula, should be a part of every travel kit, particularly for those traveling with children or in Third World countries. The combination of salt (as Sodium Chloride, 3.5 g. and Trisodium Citrate, Dihydrate, 2.9 g.), potassium (as Potassium Chloride, 1.5 g.) and glucose (Anhydrous, 20 g.) enhances the ability of the large intestine to absorb fluids. Includes instructions Weight: 1.1oz Manufactured in Kansas City, MO, USA Dissolve in 1 liter of drinking water. 1 Packet = $1.50 25 Packets = $30]]>1https://s.turbifycdn.com/aah/optacticalgear/ors-oral-rehydration-salts-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/ors-oral-rehydration-salts-44.jpgORShttps://s.turbifycdn.com/aah/optacticalgear/oss-agent-yugoslavia-ww2-49.jpgcustom-itemoptacticalgear-pagegearloadoutsOSS, WWII, Yugoslavia1Weapon
Ammo
Sensitive items
Map
Flashlight
Raincoat
Sleeping Bag
Extra socks 1 pair
First aid kit, eventually aspirin and iodine
Toothbrush
Soap
Razor
Emergency rations Reference: Beacons in the Night, Franklin Lindsay, 1993 Stanford University Press, Stanford, CA]]>1https://s.turbifycdn.com/aah/optacticalgear/oss-agent-yugoslavia-ww2-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/oss-agent-yugoslavia-ww2-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-als-nub-mod-for-safariland-als-holsters-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-als-nub-mod-for-safariland-als-holsters-52.jpgcustom-itemoptacticalgear-pagesahoandacXXOTD26.99OT Defense ALS NUB MOD for Safariland ALS HolstersOT Defense111NOTE: This model is ONLY for ALS Level 1 retention 6000 and 7000 series holsters. Also fits 6000 series RDS holsters such as the 6354DO and 6390RDS.
Your ALS lever must be the standard height version as shown in the inset photo. If you have a longer ALS lever it will not be compatible. This model will NOT fit 1911/2011/Staccato and other large thumb safety pistol holsters. It will NOT fit SLS or Level 3 Retention models. Made in the U.S.A., this aluminum product is blasted and finished with mil-spec anodizing. Faster: The reversed angle matches up with the pad of your thumb sooner than the factory button. You will find the gun in your hand just by grabbing it. Weak hand drawing becomes faster as well. More Reliable: The wider release button means you have even less potential to miss the activation, especially on thigh rigs or mounting systems that push the holster away from your body. If you have ever found yourself pulling up on the gun before hitting the release you've noticed that gun is difficult to almost impossible to get out. The additional leverage of the Nub Mod fixes this stress induced or poor training problem if it ever arises due to the increased surface area for the thumb to engage. Simple Install: Simply press the larger nub piece over the factory button from the inside of the holster. Align the smaller narrow piece with the top of the larger one. Insert screw and tighten with supplied allen wrench. You may add Loc Tite or finger nail polish to the threads if desired. ]]>1https://s.turbifycdn.com/aah/optacticalgear/ot-defense-als-nub-mod-for-safariland-als-holsters-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-als-nub-mod-for-safariland-als-holsters-65.jpgOT Defensehttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-long-nub-mod-for-safariland-als-holsters-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-long-nub-mod-for-safariland-als-holsters-12.jpgcustom-itemoptacticalgear-pagesahoandacXXOTD-LONGNUB29.99OT Defense Long NUB MOD for Safariland ALS Holsters111NOTE: This model is ONLY for ALS Level 1 retention 6000 and 7000 series holsters. Also fits 6000 series RDS holsters such as the 6354DO and 6390RDS.
Starting 2024, Safariland® lengthened the lever on the 6000 series RDS and RDSO holsters for Glocks and other common pistols. If your lever looks like the image below, this is what you need.
Your ALS lever must be the tall height version as shown in the inset photo. If you have a shorter ALS lever it will not be compatible. This model will NOT fit 1911/2011/Staccato and other large thumb safety pistol holsters. It will NOT fit SLS or Level 3 Retention models. Level 1 and Level 3 use. This is NOT 'longer' or bigger then other Nubs, it simply fits the longer lever design from Safariland! Washer included for level 3 users, screw has threadlocker pre-applied. Due to the nature of Safariland holsters being handmade, some users will need to file behind the lever to ensure proper movement with no resistance. Faster: The reversed angle matches up with the pad of your thumb sooner than the factory button. You will find the gun in your hand just by grabbing it. Weak hand drawing becomes faster as well. More Reliable: The wider release button means you have even less potential to miss the activation, especially on thigh rigs or mounting systems that push the holster away from your body. If you have ever found yourself pulling up on the gun before hitting the release you've noticed that gun is difficult to almost impossible to get out. The additional leverage of the Nub Mod fixes this stress induced or poor training problem if it ever arises due to the increased surface area for the thumb to engage. Simple Install: Simply press the larger nub piece over the factory button from the inside of the holster. Align the smaller narrow piece with the top of the larger one. Insert screw and tighten with supplied allen wrench. You may add Loc Tite or finger nail polish to the threads if desired. ]]>1https://s.turbifycdn.com/aah/optacticalgear/ot-defense-long-nub-mod-for-safariland-als-holsters-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-long-nub-mod-for-safariland-als-holsters-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-sls-nub-mod-for-safariland-holsters-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-sls-nub-mod-for-safariland-holsters-39.jpgcustom-itemoptacticalgear-pagesahoandacXXOTDSLS29.99OT Defense SLS NUB MOD for Safariland Duty HolstersOT Defense111NOTE: Your ALS lever must be the standard height version as shown in the inset photo. If you have a longer ALS lever it will not be compatible. The SLS NUB MOD is needed for users running Level III Safariland Holsters with the ALS lever and the SLS hood. It also works with the ALS only (Level I) holsters for those with a larger waist girth to allow a smoother contact with the body over the ALS Nub Mod. Upon engaging the SLS hood downward with the thumb, the users thumb cannot help but land on the NUB MOD, releasing the weapon into the drawstroke. Starting in 2020 Safariland has started releasing some new ALS levers on the 7TS holsters. If your lever has 3 planes on the outside, YOU WILL NEED TO FILE THE LEVER FLAT as shown in the image above to make the Nub Mod fit. 7TS RDS holsters may require a different version of the Nub Mod to work. Slightly grooved to keep the thumb in contact with the lever, blasted and hard anodized black for a long lasting finish. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/ot-defense-sls-nub-mod-for-safariland-holsters-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/ot-defense-sls-nub-mod-for-safariland-holsters-49.jpgOT Defensehttps://s.turbifycdn.com/aah/optacticalgear/otis-223-cal-5-56mm-9mm-defender-series-cleaning-kit-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-223-cal-5-56mm-9mm-defender-series-cleaning-kit-17.jpgcustom-itemoptacticalgear-pageotweclkiXXFG-901-556-994.99Otis .223 cal / 5.56mm / 9mm Defender Series Cleaning KitOtis Technology111• .223 cal/5.56mm and 9mm Ripcords® for quick, one-pass cleaning
• 100% cotton 2" and 3" patches (10 each) and small & large slotted tips
• .223 cal/5.56mm and 9mm bronze bore brushes with size marked on brush stem
• 8" and 30" aircraft grade Memory-Flex® cables for proper Breech-to-Muzzle® cleaning
• Blue Nylon All Purpose Brush removes fresh carbon or powder residue but won't scratch your firearm finish
• .223 cal/5.56mm chamber brush for more precise chamber cleaning
• 8-32 thread solid rod set
• Also includes 0.5 fl.oz. of Shooter's Choice FP-10 Lubricant Elite® CLP and instruction manual
• All items packed neatly in a 10"x4"x2" soft pack case
• No Nonsense Warranty
• Made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/otis-223-cal-5-56mm-9mm-defender-series-cleaning-kit-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-223-cal-5-56mm-9mm-defender-series-cleaning-kit-30.jpgOtis Technologyhttps://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-deluxe-kit-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-deluxe-kit-14.jpgcustom-itemoptacticalgear-pageotweclkiXXFG-RCD24.99Otis Ripcord Deluxe Kit for Rifle / PistolOtis Technology111• Offers complete cleaning for field/on-the-go use
• Includes Ripcord® plus caliber/gauge specific bore brush & cotton bore mop
• Shooter’s Choice FP-10 Lubricant Elite® CLP (0.5 oz) dropper tip bottle for an all-in-one cleaning, lubricating and protecting formula
• Short AP brush locks into the notch of the T-handle for better grip
• Microfiber gun cloth works great to wipe fingerprints, fouling and extra solvent from the exterior of your firearm
• Available in all calibers Ripcord® is sold
• Made in the USA
.22 / 5.56 cleans: .22 Rimfire/.22LR/ 22 Long, .22 Short,.22 Magnum. 220/.22-250 and more
9mm cleans: .38 cal /9mm, 35 Caliber, .350 Legend .357 cal
.264 / 6.5mm cleans: .260 cal/.264 cal/6.5mm]]>1https://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-deluxe-kit-22.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-deluxe-kit-23.jpgOtis Technologyhttps://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-for-rifle-pistol-12.jpgcustom-itemoptacticalgear-pageotweclkiXXFG-RC15.99Otis Ripcord for Rifle / Pistol Otis Technology111• Length: 36"
• 10 inches of aggressive cleaning surface
• Caliber specific molded rubberized core for 360 degree cleaning
• Heat resistant up to 700 degrees F
• Nomex® fibers act as both a brush to loosen and a patch to capture fouling particles
• Easy-feed design makes for quicker cleaning from Breech-to-Muzzle®
• Equipped with 8-32 threaded ends to fit all Otis cleaning components
.22 / 5.56 cleans: .22 Rimfire/.22LR/ 22 Long, .22 Short,.22 Magnum. 220/.22-250 and more
9mm cleans: .38 cal /9mm, 35 Caliber, .350 Legend .357 cal
.264 / 6.5mm cleans: .260 cal/.264 cal/6.5mm]]>1https://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-for-rifle-pistol-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-ripcord-for-rifle-pistol-21.jpgOtis Technologyhttps://s.turbifycdn.com/aah/optacticalgear/otis-sectional-rod-cleaning-kit-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-sectional-rod-cleaning-kit-17.jpgcustom-itemoptacticalgear-pageotweclkiXXFG-SRS30.99Otis Sectional Rod Cleaning KitOtis Technology111• Solid brass rod section with female 8/32 threaded end and swivel handle for easy cleaning
• Bronze phosphor bore brush
• Cotton bore mop
• Brass component adaptor
• 100 count 1”x1” cleaning patches for the .22 / 5.56 and 9mm options; 20 count 2.5"x2.5" cleaning patches for the .30 Cal option
• Nylon All-Purpose cleaning brush
• Brass pierce point jag
• 0.5 fl. oz. bottle of FP-10 Lubricant Elite® CLP
• Precision machined and proudly made in the USA
.22 / 5.56 cleans: .22, .22 Rimfire, .22LR
.30 Cal cleans .30,.30-06,.30-30,.303,.308 caliber,300 Win Mag,.32 cal, 7.62mm & 8mm rifles
9mm cleans .38 cal/9mm/.357 pistols]]>1https://s.turbifycdn.com/aah/optacticalgear/otis-sectional-rod-cleaning-kit-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/otis-sectional-rod-cleaning-kit-30.jpgOtis Technologyhttps://s.turbifycdn.com/aah/optacticalgear/otto-noizebarrier-micro-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/otto-noizebarrier-micro-45.jpgcustom-itemoptacticalgear-pagehepr141V4-11029452.35439.99Otto NoizeBarrier MicroOtto Communications111Features
- Up to 40 dB of impulse noise protection
- Up to 15 dB adaptive noise attenuation
- Hearing enhancement mode – amplifies soft sounds up to 5X
- Natural hearing for safe sounds
- Accu-Technology® high-definition sound quality
- One-button touch pad, 2-mode operation
- Rechargeable with up to 16 hours of continuous use
- Earpiece and case IP67 water resistant
- Charging status LCD panel
- 1-year warranty Specs
- NRR: 28 dB(Foam Tips); 23 dB (3-Flange Tips)
- Frequency Response: 40Hz - 16kHz
- Transducers: Balanced armature receivers (speakers), Wide bandwidth, low-noise MEMS microphones
- Battery Performance:
Earplugs: Up to 16 hours
Charge Station: 20 earplug charge cycles This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/otto-noizebarrier-micro-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/otto-noizebarrier-micro-58.jpgOtto Communicationshttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-allies-microgravity-jacket-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-allies-microgravity-jacket-56.jpgcustom-itemoptacticalgear-pageinoulal761300211300259.95Outdoor Research Allies Microgravity JacketOutdoor Research111Fabric: AscentShell™ 3L, 100% nylon 70D plainweave with 100% polyester 30D knit backer Fabric Performance:
•Waterproof
•Windproof
•Breathable
•Air Permeable
•Electrospun Membrane
•Movement-Mirroring Stretch (solids only) Design Features:
•Helmet Compatible Halo-Hood with Hood Lock™
•YKK AquaGuard™ Zippers
•Internal Front Stormflap
•Fully seam sealed
•Elastic Drawcord Hem
•Zip Chest and Hand
•Pockets
•Left Hand Pocket Doubles As Stuff Sack
•Carabiner Loop and Key Clip
•Dynamic Reach™ Underarm Panels
•Torsoflow side zippers
•Hook / Loop Cuff Closure]]>1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-allies-microgravity-jacket-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-allies-microgravity-jacket-69.jpgOutdoor Researchhttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ferrosi-hoody-coyote-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ferrosi-hoody-coyote-66.jpgcustom-itemoptacticalgear-pagesoftshells6155531OR149124.99Outdoor Research Ferrosi HoodyOutdoor Research111sizechart11Features:
• Water Resistant
• Wind Resistant
• Breathable
• Durable
• Quick Drying
• Lightweight
• Movement-Mirroring Stretch
• Adjustable Hood Fits over Climbing Helmet
• Single-Separating Front Zipper
• Zippered Napoleon Pocket
• Two Zippered Hand Pockets
• Drawcord Hem Details:
• Fit: Standard Fit
• Fabric: 86% nylon, 14% spandex 90D stretch woven ripstop body and hood // Cordura®, 91% nylon, 9% spandex 120D stretch woven shoulders and lower sleeves
• Avg. Weight (oz./g): 13.9oz Backed by Outdoor Research's Infinite Guarantee lifetime warranty. SIZING: See link to Size Chart Below]]>1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ferrosi-hoody-coyote-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ferrosi-hoody-coyote-76.jpgOutdoor Researchhttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-foray-jacket-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-foray-jacket-coyote-35.jpgcustom-itemoptacticalgear-pageinoulal76155011OR225199.99Outdoor Research Foray JacketOutdoor Research111sizechart6Features
• Waterproof
• Breathable
• Windproof
• Lightweight
• Fully Seam-Taped
• Fully Adjustable Hood
• YKK® AquaGuard® Double-Separating Center Front Zipper, allows for unzipping from top or bottom end, perfect for conceal carry use
• Internal Front Stormflap
• Double-Sliding TorsoFlo™ Hem-To-Bicep Zippers
• Zippered Chest Pocket
• Two Zippered Hand Pockets
• Left-hand Pocket Doubles as Stuff Sack
• Hook/Loop Cuff Closures
• Carabiner Loop
• Key Clip Details
• Fit: Standard Fit
• Fabric: GORE-TEX® with Paclite® product technology 2L, 100% polyester 50D plain weave
• Avg. Weight (oz./g): 15.8 oz (Large size) Backed by Outdoor Research's Infinite Guarantee lifetime warranty. Colors:
-Coyote Brown
-Black SIZING: See link to Size Chart Below]]>1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-foray-jacket-coyote-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-foray-jacket-coyote-42.jpgOutdoor Researchhttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-helium-ii-jacket-coyote-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-helium-ii-jacket-coyote-55.jpgcustom-itemoptacticalgear-pageinoulal76155230OR170144.99Outdoor Research Helium JacketOutdoor Research111sizechart10Features:
• Waterproof
• Breathable
• Lightweight
• Fully Seam-Taped
• YKK® AquaGuard® Center Front Zipper
• Adjustable Hood
• Single-Separating Front Zipper
• Zippered Napoleon Pocket
• Chest Pocket Doubles as Stuff Sack
• Carabiner Loop
• Elastic Cuffs
• Elastic Drawcord Hem Details:
• Product #: 275386
• Fit: Standard
• Fabric: bluesign® approved Pertex® Shield Diamond Fuse 2.5L and bluesign® approved 100% Nylon, 30D Ripstop
• Avg. Weight (oz./g): 6.2 oz Backed by Outdoor Research's Infinite Guarantee lifetime warranty. SIZING: See link to Size Chart Below]]>1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-helium-ii-jacket-coyote-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-helium-ii-jacket-coyote-65.jpgOutdoor Researchhttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ironsight-gloves-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ironsight-gloves-65.jpgitem.optacticalgear-pagegloves61702904537.99Outdoor Research Ironsight Sensor GlovesOutdoor Research111Ironsight Gloves are now touch-screen compatible! Legendary within the tactical community for their amazing tactility and grip, the Ironsight Gloves are quick drying, highly breathable gloves made with dexterous and supple synthetic leather for solid grip yet are extremely sensitive during delicate tasks. Slip-free grip pads on the palms and fingers and seamless Precision Grip™ construction provide superior tactility. Shell:
-Breathable, stretch nylon
-Synthetic leather with flex cutouts for abrasion and impact protection while maintaining dexterity Palm:
-Touch-screen compatible on the index finger and thumb
-Highly breathable synthetic palm
-Hybrid leather and fabric finger sidewalls offer superior flex at joints and reinforcement at high abrasion points
-Silicone pads provide solid grip of weapons and tools Details:
-Injection molding on back of hand for impact protection
-Precision grip for seamless, next-to-skin tactility
-Pull-on loop doubles as attachment for securing gloves Backed by Outdoor Research's Infinite Guarantee lifetime warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ironsight-gloves-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-ironsight-gloves-75.jpgOutdoor Researchhttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-wind-pro-hat-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-wind-pro-hat-72.jpgitem.optacticalgear-pagewatchcaps61838054436Outdoor Research Wind Pro Hat - USAOutdoor Research111Staff Favorite. This is a very warm yet slim beanie that has excellent water resistance in light rain and snow. + Polartec® Wind Pro® with Hard Face™ finish and soft fleece interior is highly wind and abrasion resistant. + Three-dimensional design for head-conforming fit + Double layer of fabric on ear band area for added warmth Backed by Outdoor Research's Infinite Guarantee lifetime warranty. Sizing: Hat will break in and stretch a slightly with use.
• Small/Medium: Head Circumference = 21.5 - 22.9 inches
• Large/XLarge: Head Circumference = 23 - 24 inches Made in the USA, Berry Compliant.]]>1https://s.turbifycdn.com/aah/optacticalgear/outdoor-research-wind-pro-hat-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/outdoor-research-wind-pro-hat-82.jpgOutdoor Researchhttps://s.turbifycdn.com/aah/optacticalgear/outerwear-78.jpgcustom-itemoptacticalgear-pageunclOuterwear1javeswsoftshellsinoulal7Clothing Layering System: Level 1- Light Weight Base Layer
Level 2- Mid-Weight Base Layer
Level 3- Heavy Weight Base Layer (fleece)
Level 4- Wind Jackets (Ultra-Thin Barriers)
Level 5- Weather Resistant Outer Layer (Soft Shell)
Level 6- Water Repellant Outer Layer (Hard Shell)
Level 7- High Loft Outer Layer Level 7 can often be worn right over individual armor or load bearing equipment, some versions are also designed to be used in lieu of a sleeping system, so the wearer can don them, get warm, and sleep in them in the field. This reduces gear taken to the field and makes fighting from a sleeping system much easier. The layering system of clothing is designed around the concept that fabrics pushing moisture away from the body will keep you warm while in motion, once you go static you can don waterproof or warm layers to insulate yourself. While in motion, you will not be 100% protected from precipitation, however, at the same time you will not have water retention in your fabrics that will keep you cold. We hope this helps you in your selection for cold weather outerwear.]]>1https://s.turbifycdn.com/aah/optacticalgear/outerwear-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/outerwear-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-falx-trigger-for-glock-9.jpgcustom-itemoptacticalgear-pagestweliandmo15592C135121.5Overwatch Precision FALX Trigger for Glock (R)Overwatch Precision111• Reduced Pre-Travel
• Tactile Reset
• Machined out of billet 7075-T6 aluminum alloy
• Type III hard coat anodized to MIL-A-8625 standard, so you can get rough with it. (See above) Compatible Glock Models:
• Glock Gen 2-4 G17/19 22/23 24 26 27 31 33 34/35
• Glock Gen5 G17/19 19X 22/23 24 26 27 31 33 34/35 45 What is NP3 Coating?
NP3 coating is a space age material used for coating the external and internal parts of firearms. A proprietary blend of submicron particles makes for an excellent surface treatment on all metal surfaces including stainless steel and hard chrome. NP3 coating offers high lubricity, corrosion resistance, micro hardness, and is self-lubricating. This is achieved via a process which binds the NP3 to the metal surfaces at the molecular level. The color options reflect the color of the trigger shoe. The trigger safety for all models is black. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-falx-trigger-for-glock-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-falx-trigger-for-glock-16.jpgOverwatch Precisionhttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-glock-magwell-r-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-glock-magwell-r-56.jpgcustom-itemoptacticalgear-pagestweliandmo1552210X89.9981.9Overwatch Precision Glock Magwell (R)Overwatch Precision111Fits Respectively:
• Gen 4- G19, G23, G32 (with or without Backstrap)
• Gen 5- G19, G23, G44 without Cutout, No Backstrap
• Gen 5- G17, G34, G45 without Cutout, No Backstrap Features:
• Ultra strong and lightweight 7075-T6 Aluminum construction
• Single piece design limits potential failure points
• Aggressive funnel for rapid magazine insertion
• Includes screw and Allen wrench for assembly
• Color: black Made in the USA, Lifetime Warranty. WARNING: This product can expose you to chemicals including lead, which is known in the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warningsca.gov]]>1https://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-glock-magwell-r-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-glock-magwell-r-70.jpgOverwatch Precisionhttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-polydat-trigger-for-glock-np3-coated-r-11.jpgcustom-itemoptacticalgear-pagestweliandmo155262269.9962.99Overwatch Precision PolyDAT Trigger for Glock - NP3 Coated (R)Overwatch Precision111• Reduced Pre-Travel
• Tactile Reset
• Machined out of billet 7075-T6 aluminum alloy
• Type III hard coat anodized to MIL-A-8625 standard, so you can get rough with it. What is NP3 Coating?
NP3 coating is a space age material used for coating the external and internal parts of firearms. A proprietary blend of submicron particles makes for an excellent surface treatment on all metal surfaces including stainless steel and hard chrome. NP3 coating offers high lubricity, corrosion resistance, micro hardness, and is self-lubricating. This is achieved via a process which binds the NP3 to the metal surfaces at the molecular level. Color: Black Shoe with Black Safety Compatible Glock Models:
• Glock Gen 2-4 G17/19 22/23 24 26 27 31 33 34/35
• Glock Gen5 G17/19 19X 22/23 24 26 27 31 33 34/35 45 This trigger will NOT work in the G42, G43, or Large Frame Glocks. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-polydat-trigger-for-glock-np3-coated-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/overwatch-precision-polydat-trigger-for-glock-np3-coated-r-21.jpgOverwatch Precisionhttps://s.turbifycdn.com/aah/optacticalgear/pact-club-timer-iii-available-soon-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/pact-club-timer-iii-available-soon-33.jpgcustom-itemoptacticalgear-pageshottimers51CT3129.95Pact Club Timer IIIPACT Inc Shooting Products111A Display Big Enough You Can Read Easily The purpose built display on the PACT Club Timer 3 tells you everything you need to know about your shot string at a glance. Shot Number and Total Time are highlighted with FIRST SHOT and last SPLIT displayed with no button pushing required. As you press the REVIEW button, each shot Total Time and split are displayed. PAR time (if any) is also displayed along with letting you know if the timer is set to a delayed or instant GO. Club Timer III Ultra Loud Buzzer Shooting Timer A Buzzer You Can Hear OK…OK We hear you, you wanted a louder buzzer. You got it. Way back, 1982 or so, there were some really great buzzers. Unfortunately the federal specs changed for smoke alarm\’s, and those great old buzzers went away. The buzzer used in almost all the shooting timers really are the loudest commercially available low frequency buzzers on the market – but they just aren\’t loud enough. We went on a quest to come up with a better buzzer, and after testing dozens of them over the course of a year we were not impressed – so we decided to make our own. You will be pleased with the results. Club Timer III Shooting Timer by PACT Form Follows Function The Club Timer III is designed to fit the hand. Both the buzzer and microphone are located to the side of the timer, away from your hand, to minimize the possibility of blocking them. All the control buttons are recessed below the top of the Club Timer III so that there is no chance of accidentally pressing them as you run with the timer. Yet, when you want to press them, you\’ll find they fall naturally under your fingers – no more hunting for the GO button. And speaking of buttons, our custom sealed conductive rubber keypad is water proof and there are no mechanical switches to fail at the worst possible time. Weight: 1 lb. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/pact-club-timer-iii-available-soon-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/pact-club-timer-iii-available-soon-43.jpgPACT Inc Shooting Productshttps://s.turbifycdn.com/aah/optacticalgear/patches-32.jpgitem.optacticalgear-pageindex-Patches / Morale1stickersflagpatchesmedicalpatchespvcpatchesgrpalacutpahodepaandstwagl1ininirrkidegrmredog1https://s.turbifycdn.com/aah/optacticalgear/patches-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/patches-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-hand-warmer-aor1-exclusive-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-hand-warmer-aor1-exclusive-67.jpgcustom-itemoptacticalgear-pageglovesXXWMAOR1129.99116.99Perroz Designs Hand Warmer - AOR1 ExclusivePerroz Designs111Exclusively at O P Tactical, custom Hand Warmers in AOR1 directly from Perroz Designs! Keep your hands warm and dry. Lightweight, compressible and wind resistant - a must have for anyone outdoors. Constructed with AOR1 pattern 330D Cordura and insulated with high loft Polartec® polar fleece that is soft and retains heat. Worn via adjustable waist strap. Currently all Hand Warmers use BLACK color high loft Polartec polar fleece. Quality guaranteed. Made in Canada. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/perroz-designs-hand-warmer-aor1-exclusive-79.jpghttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-hand-warmer-aor1-exclusive-80.jpgPerroz Designshttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-triple-5-56-magazine-placard-aor1-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-triple-5-56-magazine-placard-aor1-45.jpgcustom-itemoptacticalgear-pagemaveclqacoXXTMPAOR1149129Perroz Designs Triple 5.56 Magazine Placard - AOR1Perroz Designs111litopedelpaoExclusively at O P Tactical, custom Triple 5.56 Magazine Placard in AOR1 directly from Perroz Designs! Secure and fast attachment via hooked Velcro® back and buckles. Clips directly into ITW QASM female buckles - height adjustable utilizing Velcro® One-Wrap. Magazines individually retained by 1/8th inch bungee cord and synthetic rubber S&S Precision® pull tabs which provide a non-slip ergonomic grip. Integrates seamlessly with Haley Strategic MP2 Magazine Pouch Inserts (sold separately), which lock into place by an internal nylon webbing strip. AOR1 Material: 330D Cordura. Quality guaranteed. Made in Canada. Triple Magazine Placard Only. Mags sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/perroz-designs-triple-5-56-magazine-placard-aor1-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/perroz-designs-triple-5-56-magazine-placard-aor1-58.jpgPerroz Designshttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-iwb-universal-holster-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-iwb-universal-holster-50.jpgcustom-itemoptacticalgear-pagephhoandpr101PHLFLOOD124.99112.99PHLster Floodlight (IWB) - Universal HolsterPHLster111The Floodlight confirmed fit list is as follows:
- 1911 and 2011 pistols
- Glock 19/17/34 (and .40 and .357 variants)
- Glock 20/21
- S&W M&P and SD series pistols
- HK VP9, VP40, and P30
- FN 509 and FNS
- CZ P10, P07, P09, 75 SP01
- Sig P226, 229, 220, and P320
- Walther PPQ (any gen)
- Polymer 80
- Beretta 92, M9, PX4, APX
- XD and XDM DOES NOT FIT STEYR PISTOLS.

- Weight 0.34 lbs
- Dimensions 9 × 6 × 3.5 in No Hassle Warranty:
Phlster offers a no-hassle warranty policy. It doesn’t matter if you’re the original owner or if you acquired your gear second hand, if it’s broken, they’ll repair or replace the item. ]]>1https://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-iwb-universal-holster-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-iwb-universal-holster-64.jpgPHLsterhttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-owb-universal-holster-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-owb-universal-holster-51.jpgcustom-itemoptacticalgear-pagephhoandpr101PHLFLOOD2119112.99PHLster Floodlight (OWB) - Universal HolsterPHLster111Compatible with Blade Tech, G-Code, and Safariland attachments The OWB Floodlight is ambidextrous and adjustable to fit just about any pistol capable of mounting a Surefire X300 or Streamlight TLR-1. The OWB Floodlight includes a Blade Tech Tek Lok belt attachment and three adjustment hardware kits to achieve the best fit on your pistol. The hardware kits are color coded, to keep the appropriate screw lengths with their respective spacers. Please be sure to refer to the Instructions page for details on adjusting your holster. Like all Phlster holsters, the OWB Floodlight accommodates muzzle devices, suppressor height sights, and slide-mounted optics. The Floodlight confirmed fit list is as follows:
- 1911 and 2011 pistols
- Glock 19/17/34 (and .40 and .357 variants)
- Glock 20/21
- S&W M&P and SD series pistols
- HK VP9, VP40, and P30
- FN 509 and FNS
- CZ P10, P07, P09, 75 SP01
- Sig P226, 229, 220, and P320
- Walther PPQ (any gen)
- Polymer 80
- Beretta 92, M9, PX4, APX
- XD and XDM DOES NOT FIT STEYR PISTOLS.

- Weight 0.34 lbs
- Dimensions 9 × 6 × 3.5 in No Hassle Warranty:
Phlster offers a no-hassle warranty policy. It doesn’t matter if you’re the original owner or if you acquired your gear second hand, if it’s broken, they’ll repair or replace the item. ]]>1https://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-owb-universal-holster-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-floodlight-owb-universal-holster-64.jpgPHLsterhttps://s.turbifycdn.com/aah/optacticalgear/phlster-holsters-and-products-36.jpgcustom-itemoptacticalgear-pageholstersPhlster Holsters and Products1phfliunhophflounhophprosehogl11https://s.turbifycdn.com/aah/optacticalgear/phlster-holsters-and-products-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-holsters-and-products-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-pro-series-holster-glock-17-19-26-34-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-pro-series-holster-glock-17-19-26-34-36.jpgcustom-itemoptacticalgear-pagephhoandpr101PHLPRO0379.9969.99PHLster Pro Holster for GlockPHLster111Types:
• Standard comes with a pair of adjustable IWB loops and an adjustable ModWing to reduce printing (Main picture)
• TuckStrut (see inset picture)
• Grip Hooks (Pair) (see inset picture)
• Discreet Carry Concepts Monoblock Clip (see inset picture) The Pro Holster is compatible with optics, suppressor sights, threaded barrels, and Gen5 Glocks. Compatible Glock Models:
• 9mm/40 Glock (26-34 lengths) No Hassle Warranty:
Phlster offers a no-hassle warranty policy. It doesn’t matter if you’re the original owner or if you acquired your gear second hand, if it’s broken, they’ll repair or replace the item. ]]>1https://s.turbifycdn.com/aah/optacticalgear/phlster-pro-series-holster-glock-17-19-26-34-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-pro-series-holster-glock-17-19-26-34-46.jpgPHLsterhttps://s.turbifycdn.com/aah/optacticalgear/picatinny-rail-and-geiselle-smr-416-accessories-36.jpgcustom-itemoptacticalgear-pageweacPicatinny Rail, and Geiselle SMR 416 Accessories1ardehastpirtrnocopiragrmamoervgraveardeingesmr4ardefistpirmaxtmmoracomaxthastkit1mabifor19pirvitalplprslmmarsraslat1https://s.turbifycdn.com/aah/optacticalgear/picatinny-rail-and-geiselle-smr-416-accessories-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/picatinny-rail-and-geiselle-smr-416-accessories-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-delta-utility-glove-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-delta-utility-glove-55.jpgcustom-itemoptacticalgear-pagegloves7375429.95PIG Full Dexterity Tactical (FDT) - Delta Utility GlovePIG (FDT)111sichforpigfd1-Full touchscreen compatible forefinger and thumb
-Fold-over finger construction to eliminate fingertip discomfort
-Single-layer palm for tactile sensitivity
-Bar-tacked paracord pull loop
-Silicon printed grip on the palm
-Elastic wrist for quick don and doff sequence Designed as a "Utility" glove, if you use your tactical shooting gloves both on and off the range, the PIG FDT Delta Utility Glove is the best solution on the market today for ease of use, durability and the tactile-dexterity you need to make your shot count! OPT will not take returns on this item if it has been used or has hangtags removed. Thoroughly inspect your item prior to removal of the hangtag. No shipping to the UK, Denmark, Finland, Sweden, Hong Kong, and South Korea See link below for sizing chart.]]>1https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-delta-utility-glove-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-delta-utility-glove-69.jpgPIG (FDT)https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-fr-glove-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-fr-glove-44.jpgcustom-itemoptacticalgear-pagegloves73PIG72664.95PIG Full Dexterity Tactical (FDT) Alpha FR GlovePIG (FDT)111Features
- Touchscreen Compatible Leather thumb and forefinger
- Leather padded knuckles
- Flame resistant Nomex® material
- Isolated knife-edge padding
- Bar-tacked webbing wrist pull
- Low profile hook and loop wrist strap
- Tailored Fourschettes
- Sensitized Trigger Finger
- Single Layer Palm
- Short cuff with loop-maximum comfort and convenience There will be temporary color transfer from the conductive leather onto wearer's forefinger and thumb which will diminish with use and washing.]]>1https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-fr-glove-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-fr-glove-58.jpgPIG (FDT)https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-gloves-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-gloves-44.jpgcustom-itemoptacticalgear-pagegloves73PIGFDT44.95PIG Full Dexterity Tactical (FDT) Alpha GlovesPIG (FDT)111sichforpigfdNo shipping to the UK, Denmark, Finland, Sweden, Hong Kong, and South Korea See link below for sizing chart.]]>1https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-gloves-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-alpha-gloves-58.jpgPIG (FDT)https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-cold-weather-glove-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-cold-weather-glove-54.jpgcustom-itemoptacticalgear-pagegloves73FDT-CWG59.95PIG Full Dexterity Tactical (FDT) Cold Weather GlovePIG (FDT)111 The ALL-NEW PIG FDT Cold Weather Glove (CWG) finally brings PIG’s unsurpassed dexterity to a wind-resistant insulated glove. Maintaining the PIG-FDT line-up’s short cuff design, the ALL-NEW CWG includes features such as Touch Screen Compatibility (all 5 digits), grippy Silicon-print palm and a Terry cloth nose-wipe. When the temperatures drop, transition from your current FDT Gloves to the ALL-NEW WARMNESS that is the PIG FDT Cold Weather Glove!1https://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-cold-weather-glove-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/pig-full-dexterity-tactical-fdt-cold-weather-glove-68.jpgPIG (FDT)https://s.turbifycdn.com/aah/optacticalgear/pistol-accessories-83.jpgitem.optacticalgear-pageweacPistol Accessories 1ovprfatrforgovprpotrforgedshdeesdmakkmprrspgl19raweaframicozevz19dustslzevconisisetzevopmabag19zevopmabag192zevopmabathpzevprocogen5ovprglmarmaglenmawefo1racofrmargetarelaaiglmosacmop(R)=ITEMS WILL NOT BE SHIPPED OUT OF UNITED STATES1https://s.turbifycdn.com/aah/optacticalgear/pistol-accessories-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/pistol-accessories-82.jpghttps://s.turbifycdn.com/aah/optacticalgear/pistol-magazine-pouches-54.jpgitem.optacticalgear-pageammopouchesPistol Magazine Pouches1shcodoelpidpfecodoelpies40ansipikyessipikymagpesdopikymagpesdopigapkyphsgen2pitahsgen2dopitahsgipistoltacohspitaltmopopitav2moanhspopitamoanhspomipitamohsdopitamohstrpitamohsgen2expitahsexpitaitwfapimoblfotesipimablfogetedopiblfogesipimafisppimaposp2fisppimapospespikyinatssipisuleatsdopisulepmsmwrmupo1https://s.turbifycdn.com/aah/optacticalgear/pistol-magazine-pouches-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/pistol-magazine-pouches-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-1-litre-flask-31.jpgcustom-itemoptacticalgear-pagenalgene1338298878.95Platatac 1 Litre FlaskPlatatac111Features:
- 51 grams approx per flask
- Robust construction
- Measurements on the side in 100ml increments
- 2 flasks will fit into a issued SAW pouch
- BPA free
- Freezer safe
- Dish Washer Safe
- Food safe
- Large mouth screw top for ease of filling
- Resistant to Odors
- Olive
- Made in Australia ]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-1-litre-flask-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-1-litre-flask-41.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-accessories-small-flask-152-w-front-pouch-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-accessories-small-flask-152-w-front-pouch-45.jpgcustom-itemoptacticalgear-pagewabopo13383279349.95Platatac Accessories Small Flask 152 W/Front PouchPlatatac111Features:
- Weighs 180 grams
- Front zippered pouch for additional storage
- PALS on sides to attach additional pouches
- Internal radio pouch with Hook and loop/shock cord retention
- Silent Para Cord Zipper pulls for ease of use with gloved hands
- Button Hole at the base of the pouch for drainage
- Reversed gauge 10 YKK zippers to keep out dust and moisture
- Multicam® 500D Cordura® tactical nylon Dimensions: 20cm (H) x 90cm (W) x 80cm (D) Bottle not included]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-accessories-small-flask-152-w-front-pouch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-accessories-small-flask-152-w-front-pouch-58.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-billy-patrol-pouch-v2-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-billy-patrol-pouch-v2-47.jpgcustom-itemoptacticalgear-pageoptopmapo133838XXX149.9999.99Platatac Billy Patrol Pouch V2Platatac111Billy Pouch Includes the following inserts:
• Double M4 style magazine insert
• Single M4 style magazine insert
• Double 9mm pistol magazine insert
• Pistol holster insert
• Zippered admin insert The Billy Patrol V2 is fabricated in tough 500d Nylon with ultralight laser-cut ULTRAcomp® panels on the sides. ULTRAcomp® is a high-performance laminate that far exceeds the strength and durability of traditional nylon fabrics. These side panels feature 2 rows of Molle for the mounting of any additional pouches the user may require, the back of the pouch also utilises ULTRAcomp® to shed weight and increase strength. Features:
• Fits up to 200 rounds of 5.56mm link or 6x m4-style magazines in the main compartment
• Internal hard plate face protects link integrity
• Fastex® clip closure
• Drainage grommets
• 2 column x 5 rows PALS field on sides for additional pouches made from laser-cut Ultracomp fabric
• MOLLE attachment system made Lightweight laser-cut Ultracomp fabric
• D Rings on top of the pouch to attach a PLATATAC Jungle Harness, or similar harness system. Weight & Dimensions:
• Weight: 250g
• Dimensions: 150 (w) x 200 (h) x 90 (d) mm
• Requires Four PALS Columns Materials:
• Outer Fabric: 500d Cordura
• Blue Force Gear Ultracomp Laminate
• Fastex Clips
• Elastic: Mil-W-5664
• Hook and Loop: Mil-Spec AA-A 55126 ]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-billy-patrol-pouch-v2-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-billy-patrol-pouch-v2-61.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-mk-3-with-straps-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-mk-3-with-straps-62.jpgcustom-itemoptacticalgear-pageassaultpacks133833076249209.99Platatac Bullock Echo Pack MK 3 with StrapsPlatatac111- Padded shoulder straps with quick detach option
- Padded back for added comfort and protection of contents
- 6 x 4 MOLLE field on the main compartment for attachment of extra pouches
- Fixed adjustable cargo carrier to hold ballistic helmet, cold/wet weather jacket or additional gear
- External zippered pocket on the front of cargo carrier
- Internal bladder sleeve that holds up to a 3ltr bladder i.e. Platatac Insertion bladder (Include link)
- 2 x Internal mesh cargo pockets on front
- Removable internal zippered mesh pocket for small items
- 2 x side pockets for storing smaller additional items.
- 150x75mm loop field for IFF, ANFs or nametape
- 4 x 3 MOLLE field on cargo cradle for extra pouches
- 1” web tape handle for carriage or hanging in vehicles
- 2 x hydration tube/radio antenna routing ports
- Drainage eyelets on main compartment, side pockets and front pocket
- Double stitched and bar tacked on all major seams
- Made from 500 denier nylon Dimensions and weight;
- Main compartment 36cm (H) x 23.5cm (W) x 9.5cm (D)
- Side pockets: 19cm (H) x 9cm (W) x 5cm (D)
- Front zippered pouch: 25cm (at widest) x 6cm (D)
- Mesh cargo compartment: 20cm (H) x 23.5cm (W) x 14.5cm (D)
- Weight 1.02Kg COLOR PICTURED IS NOT COYOTE]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-mk-3-with-straps-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-mk-3-with-straps-74.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-v4-with-straps-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-v4-with-straps-12.jpgcustom-itemoptacticalgear-pageassaultpacks133840856269.99219.99Platatac Bullock Echo Pack V4 with StrapsPlatatac111• Padded shoulder straps with quick adjust/detach option
• Padded back for added comfort and protection of contents
• 6 x 4 PALS field on the main compartment for attachment of extra pouches
• Fixed adjustable/expandable cargo carrier to hold a ballistic helmet, cold/wet weather gear or additional MEIs
• External zippered pocket on the front of cargo carrier with internal cyalume loops
• Internal bladder sleeve that holds up to a 3ltr bladder e.g. Platatac Insertion bladder
• 2 x Internal zippered pockets
• Removable internal zippered pocket for small items
• 2 x Zippered side pockets sized to fit a Platatac 1L flask or 1L Nalgene
• 150 x 75mm loop field for IFF, ANFs or nametape
• 5 x 3 PALS field with Velcro loop on cargo cradle
• 1” web tape handle for carriage or hanging in vehicles
• Web tape daisy chain on each side
• Hydration tube/radio antenna routing ports
• Drainage eyelets on main compartment, side pockets and front pocket
• Double stitched and bar tacked on all major seams
• Made from 500 denier nylon Dimensions and weight
• Main compartment 38cm (H) x 23.5cm (W) x 9.5cm (D)
• Side pockets: 21.5cm (H) x 9cm (W) x 8cm (D)
• Front zippered pouch: 19.5cm (H) x 25cm (W) (at widest) x 6.5cm (D)
• Mesh cargo compartment: 20cm (H) x 23.5cm (W) x 17cm (D) (When fully expanded)
• Weight 1.02 Kg / 2.20 Lbs ]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-v4-with-straps-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-bullock-echo-pack-v4-with-straps-17.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-lw-h-harness-31.jpgcustom-itemoptacticalgear-pagechrigac338320577954.95Platatac Chicom LW H-HarnessPlatatac111- 55mm Folded 500D Cordura nylon to support heavy loads
- Folded construction with soft edges for optimized comfort
- 25mm elastic to attach PTTs or route hydration tube/antenna/comms cable
- Low profile, lightweight without affecting durability
- Adjustable 1 inch web tape straps
- Velcro loop at rear to attach individual ID markers
- All ITW Nexus Hardware ]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-lw-h-harness-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-lw-h-harness-40.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-y-harness-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-y-harness-46.jpgcustom-itemoptacticalgear-pagevests13382718X119.9589.95Platatac Chicom Y-HarnessPlatatac111• ITW-Nexus style 1-inch male-end buckles on the sides; female-end buckles on the front/chest portion to integrate with several chest rig manufacturers
• Full MOLLE backing for hydration/comms pouches
• Mesh design to enhance breathability
• Comms cable / hydration tube routing
• Reinforced drag handle
• Compatible with Chisel MK IV and Chicom Lightweight rig
• Rig height adjustable via ITW SR Split bar clips
• ITW nexus hardware
• Manufactured from water and abrasion resistant 500 Denier Nylon and mesh
• Weight: 10.5 oz ]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-y-harness-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-chicom-y-harness-60.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-echo-pack-straps-pair-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-echo-pack-straps-pair-44.jpgcustom-itemoptacticalgear-pageassaultpacks1338337364432.95Platatac Echo Pack Straps (Pair)Platatac111Features
Compatible with Bullock Echo and Echo Hydration Pack series
3D Airmesh backing for added comfort
Removable sternum strap (Only included with Multicam straps)
Quick release mechanism
Strap Keep-Tidy system ]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-echo-pack-straps-pair-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-echo-pack-straps-pair-58.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-gbh-r-hat-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-gbh-r-hat-55.jpgcustom-itemoptacticalgear-pagemilitaryhats13383198239.9534.95Platatac GBH-R HatPlatatac111- Lightweight and crushable to stow easily in a uniform pocket
- Medium height crown with a 4.5cm brim
- Self-fabric sweatband
- Internal hi-vis panel/pocket
- Internal mesh lining with heat dissipation vents
- 35x35mm square Velcro® brand loop on the crown for attaching IFF patches
- Self-fabric foliage loops
- Elastic shock cord adjustment
- Adjustable para cord neck strap
- Fours sizes available - 7", 7.25", 7.5" and 7.75"
*3 Color Desert is also referred to as "DCU," and 6 Color Desert is also referred to as "Chocolate Chip."* ]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-gbh-r-hat-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-gbh-r-hat-68.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-jaywick-shorts-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-jaywick-shorts-65.jpgcustom-itemoptacticalgear-pagecombatshirts133833704-C149.99104.99Platatac Jaywick ShortsPlatatac111See Sizing Info Below Before Ordering. 2 September 1943. Under the cover of darkness and disguised as a fishing vessel, the MV Krait snuck out of Exmouth in Australia’s North, bound for Singapore on a daring raid known as Operation JAYWICK. Operation JAYWICK was a joint UK Special Operations Executive and Royal Australian Navy mission, supported by the Allied Intelligence Bureau (AIB), through its Army support unit – Z Special Unit. AIB – including Z Special Unit – would later become the genesis for Australia’s first special forces units which have developed into what is now Special Operations Command. The PLATATAC Jaywick Shorts are a full featured, above the knee tactical short. Taking inspiration from our TAC DAX, we have simplified the design to create a slim profile. Made from tactical 50-50 Nyco Ripstop, the Jaywick shorts feature a reinforced seat, a range of pockets, and the same dynamic movement and comfort our TAC DAX are famous for. The Jaywick shorts are suitable for long-duration operations in all-round conditions and will keep you mission-ready and in the fight. Features:
• Dedicated knife pocket in hand pockets
• Zippered fly with Canadian button closure
• Rear pockets with Velcro closure
• Large thigh pockets with Canadian Button closure
• Open top pockets behind large pockets
• Dual-layer seat to reduce wear Sizing: Measurements shown are actual Waist measurement size, NOT generic Jeans Size. Please measure your waist before ordering.
• 30": Waist 30", Inseam 9.3"
• 32": Waist 32", Inseam 9.3"
• 34": Waist 34", Inseam 9.6"
• 36": Waist 36", Inseam 9.6"
• 38": Waist 38", Inseam 9.6"
• 40": Waist 40", Inseam 9.6"]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-jaywick-shorts-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-jaywick-shorts-79.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-kurtz-shirt-tigerstripe-84.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-kurtz-shirt-tigerstripe-69.jpgcustom-itemoptacticalgear-pageprun133837459-C229179.99Platatac Kurtz ShirtPlatatac111Designed to be close-fitting, yet a comfortable garment, with a long tail for easy tuck into pants. A full Zip and bar button front closure for redundancy, allowing you to use just the buttons, thereby maximising airflow. Mesh in the pockets to drain water and ventilation points in strategic areas, provide maximum comfort and performance. Features:
• Made with an accurate reproduction of a classic Tiger stripe pattern
• Two large angled top opening chest pockets with a mesh bottom and ITW slotted bar button and Velcro closure
• Two upper-arm zip and top access pockets allow for convenient access when wearing LCE or body armour
• Pen sleeve in bicep pocket zip placard and eye protection stowage loop in the top flap
• Bellowed compass pocket on the front placard will hold most in-service Silva prismatic compasses
• Velcro loop fields on sleeve pockets for ID & IFF patches
• Paracord lanyard points in all pockets to secure small items
• Underarm and upper back mesh vents keep airflow to a maximum when active or static
• Three-piece fold down collar with an extension for added sun protection
• YKK zip and bar button closure behind the front placard
• Three-button adjustable wrist cuff Materials:
• 50/50 NYCO (Nylon Cotton Mix) Rip-Stop]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-kurtz-shirt-tigerstripe-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-kurtz-shirt-tigerstripe-78.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-jw-chest-rig-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-jw-chest-rig-60.jpgcustom-itemoptacticalgear-pagevests133JWCR299Platatac Peacekeeper JW Chest RigPlatatac111Note from OPT: We reached out to Platatac and are now currently including the Chicom Y-Harness with the PK-JW, which we feel is a perfect match. These Platatac PK-JW Chest Rigs originally come with just two harness options - the standard CHICOM H Harness and the CHICOM low pro adjustable shoulder straps; there are now 3 included harness options. The PLATATAC Peacekeeper JW (Jungle Warfare) chest rig is a low profile, light weight general purpose chest rig designed for close country patrols, or hot weather/water operations which can be worn standalone, or in conjunction with over body armour systems. The PK-JW features dedicated pouches that hold just the right amount of essentials and features a front centre zip for easy doffing and donning. The dual centre mounted magazine pouches, one each side of the zip, will hold two M4 mags each, with an recently added magazine pouch for 2x M4 mags, and two vertically mounted frag grenade pouches beside the magazine pouches allow easy access to EO. At the extreme ends of the PKJW are two medium sized zippered accessory pouches with additional clip closure, these will hold a water bottle such as the Platatac 1L flask, 1L Nalgene, or a medium sized radio utilising the internal open-top mesh pouch with bungee retention to hold a 152 or similar sized radio when utilising the 19mm clip to close the pouch. On the sides of each GP pouch are TQ or Strobe pouches that will also hold other similar sized items. All Mag and EO pouches have velcro and 19mm clip closures for added security, and all pouches feature mesh areas in the bottom to provide rapid drainage. Against the body are two open-top mesh pouches which can hold flat items such as maps, GRGs or marker panels. Included with the PK-JW are two harness options, the standard CHICOM low pro adjustable shoulder straps and the CHICOM LW H-Harness which provides a lightweight general-purpose alternative to the low pro straps. Both harnesses are flat sewn, and are designed to remain as flat as possible for use with packs and other harness systems. Features
- Can carry up to six 30 Round AR/M4 style magazines
- 2 x Accessories/Water bottle/GP pouches with the ability to hold an ANPRC 152 radio at left and right of rig
- 2 x Frag Grenade Pouches
- Dedicated TQ and Strobe Light on GP pouches that will hold other like sized items.
- Mesh areas in all pouches to provide rapid drainage
- Comes standard with PLATATAC CHICOM Low Pro strap set, CHICOM LW H Harness and adjustable back strap Materials and weight
- 500 Denier Cordura nylon
- ITW Nexus hardware
- YKK Zips with heat shrink paracord pulls Compatible Items:
- Chicom LW H Harness
- Chicom Y Harness
- Chicom Back Panel Large
- Chicom Back Straps Note from OPT: We reached out to Platatac and are now currently including the Chicom Y-Harness with the PK-JW, which we feel is a perfect match. These Platatac PK-JW Chest Rigs originally come with just two harness options - the standard CHICOM H Harness and the CHICOM low pro adjustable shoulder straps; there are now 3 included harness options.]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-jw-chest-rig-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-jw-chest-rig-76.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-mk4-chest-rig-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-mk4-chest-rig-73.jpgcustom-itemoptacticalgear-pagevests133831373349239.99Platatac Peacekeeper MK5 Chest RigPlatatac111• Can carry up to six 30 Round AR/M4 style magazines (Each pouch will also accommodate 2 x AK mags, or a single 20rnd. 417/.308 mag)
• 2 x Accessories/Water bottle/GP/ANPRC 152 pouches with front zip admin pockets
• 1 x Large Velcro mesh pocket with included Velcro in zipper insert (removable)
• 2 x Tweave 4 way stretch pockets at the flanks
• 1 x Horizontal zippered pocket with webbing loops to attach elastic loop inserts to carry a TQ, Plasti Cuffs or Cyalume
• 2 x Elastic Inserts included, one holds SOF or CAT TQ and the other can hold two 4" or 6" cyalume
• PALS areas between pouches and on the sides of the GP pouches to attach additional MOLLE-compatible pouches
• Velcro sandwich for sub load pouches to boost carrying capacity
• Color matched velcro loop for IFF, C/S or Flag patch with embroidered Platatac logo
• Sewn drainage holes in all pouches
• 2 x Harness options: standard Chicom low pro adjustable shoulder straps (X straps) and Chicom LW H-Harness Materials and weight:
• 500 Denier Cordura nylon
• Tweave 520E 4 way Stretch
• ITW Nexus hardware
• YKK Zips with heat shrink paracord pulls]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-mk4-chest-rig-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-peacekeeper-mk4-chest-rig-82.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-silks-alpha-jacket-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-silks-alpha-jacket-18.jpgcustom-itemoptacticalgear-pagejavesw13383855229Platatac Silks Alpha JacketPlatatac111• Regulates Warmth
• Advanced Breathability
• Fast Drying
• Compressible
• Lightweight
• Highly Durable ]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-silks-alpha-jacket-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-silks-alpha-jacket-30.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/platatac-spur-tropical-pack-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-spur-tropical-pack-66.jpgcustom-itemoptacticalgear-page72hourpacks133823394389269.99Platatac SPUR Tropical PackPlatatac111Features
• 56 litre capacity
• Weight 1.9kg
• Ventilated harness with internal frame
• 3 zippered compartments
• 4 External pockets with dual closure
• Hydration hanger and removable mesh pocket
• 3 zippered mesh pockets inside the main compartment
• 2 zippered mesh pockets inside the second compartment
• Sewn drainage holes
• 500 denier Multicam® nylon
• 140mm x 50mm loop for IFF, patches ect.
• Milspec thread and stitching
• YKK zips with paracord pulls Dimensions approx.
• Main compartment 50cm (H) x 34cm (W) x 20cm (D)
• Front large compartment 44cm (H) x 29cm (W) x 6.5cm (D)
• Flat zippered pocket 27cm (H) x 28cm (W) x 2.5cm (D)
• External pockets x4 24cm (H) x 12cm (W) x 11.5cm (D) 3L Hydration Bladder Sold Separately. UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item (due to the size of item).]]>1https://s.turbifycdn.com/aah/optacticalgear/platatac-spur-tropical-pack-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/platatac-spur-tropical-pack-79.jpgPlatatachttps://s.turbifycdn.com/aah/optacticalgear/plate-carriers-45.jpgitem.optacticalgear-pagemollevestsrigsPlate Carriers and Vests1crprjpc20andfecoslandcocrprrsecrpraispcandcrprjuplcajafecofcv5andcspsylvplcaanmarcasplcaaavesyscplcaanvesyliweplcacrprlvsandpacrprlvandcofispasarcav2fispaacandovopmbasplcavesylawenplcagkplcafispstv3sacufispslulliplfispfionwigppedelowprslppedetr5maplaeamumiarcamaloasarca20maloarca20vearrekitNone of the items in this section come with body armor in any form (unless noted), they are not designed to stop bullets, have no ballistic rating and are not to be employed as life-support equipment.]]>1https://s.turbifycdn.com/aah/optacticalgear/plate-carriers-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/plate-carriers-44.jpgcustom-itemoptacticalgear-pageindexPouch, Ammo1avssmposuandoptopmapocltopmapohyamporandpipimapohagrsmgrflflshsmcrsemgpomacllopkgof4maclshpkgof4shcoreba1item.optacticalgear-pageindexPouch, Other 1avssmposuandspsyworadiopouchesinmedpoipomohypagepuutpoadminpouchesdupoevbacocavebahogpcopowrdohobrpowabopophflpdbapocbrngasmaskswalletsmaclshpkgof4macllopkgof4madapo1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-byte-tactical-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-byte-tactical-44.jpgcustom-itemoptacticalgear-pageheadlamps59BYTTAC29.99Princeton Tec Byte TacticalPrinceton Tec111LAMP: 1 Maxbright LED, 1 Red Ultrabright LED
BURN TIME: 8 hours
BATTERIES: 2 AAA Alkaline or Lithium
WEIGHT: 2.25 oz / 64g
WATER RESISTANT: IPX4
WARRANTY: 5 Years ]]>1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-byte-tactical-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-byte-tactical-58.jpgPrinceton Techttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-46.jpgcustom-itemoptacticalgear-pageheadlamps59xxx138.99125.99Princeton Tec Charge MPLS - AA BatteryPrinceton Tec111• Standard Nylon Headstrap
• Helmet Side Mount
• ARC Rail
• EXFIL Rail
• MOLLE/PALS
• Picatinny
• Above the Rail Specs:
• NSN: 6230-01-606-1473
• Power: 55 Lumens
• Lamp: 1 x Maxbright LED (regulated), (dimmable)3 Ultrabright LEDs
• Burn Time: 24 hours
• Batteries: 1 AA Lithium
• Weight: 1.67oz / 47g
• Water Resistant: IPX7
• Warranty: 1 Years IR Version is not available for export. Must ship inside the USA or to an APO Address.]]>1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-56.jpgPrinceton Techttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-pro-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-pro-56.jpgcustom-itemoptacticalgear-pageheadlamps59CPRBI149.99134.99Princeton Tec Charge Pro MPLS - CR123 BatteryPrinceton Tec111 The Charge Pro model provides increased run time of 40 hours and a more compact profile. It is designed to use 1 x CR123 Lithium battery. The Charge Pro mounts to various helmet rail systems, but has become more versatile including a wide variety of mounts that allow you to use the light on all of your gear. The Charge Pro runs off of a single CR123 Lithium battery, keeping it lightweight, extending burn time and standing up to colder climates. The Charge Pro offers a clean white flood light for distance spotting or large area lighting and a lower lumen light output for close at hand administrative tasks when in the field. The white flood light is fueled by a Maxbright LED, while the lower lumen administrative lighting comes from 3 Ultrabright LEDs, which are available in a number of specialty color configurations. (Read more about our specialty LED color options here.) Choose your LED configuration in the drop down menu above. Ease of performance in exacting situations was kept top-of-mind while designing the user interface, so the Charge Pro’s Maxbright white mode requires a full two-second button press to be turned on to avoid accidental activation. Versatile, smart and tough, the Charge Pro (along with our other MPLS Helmet Lights) were created with our exclusive flexi-neck design allowing you to direct light where you need it, regardless of the angle of your helmet. All Princeton Tec MPLS Helmet Lights come with the following mounts:
• Standard Nylon Headstrap
• Helmet Side Mount
• ARC Rail
• EXFIL Rail
• MOLLE/PALS
• Picatinny
• Above the Rail POWER: 55 Lumens
• LAMP: 1 Maxbright LED (regulated), (dimmable) 3 Ultrabright LEDs
• BURN TIME: 40 hours
• BATTERIES: 1 CR123 Lithium
• WEIGHT: 1.67oz / 47g
• WATER RESISTANT: IPX7
• WARRANTY: 1 Year ]]>1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-pro-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-pro-66.jpgPrinceton Techttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-x-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-x-12.jpgcustom-itemoptacticalgear-pageheliandac59C23149.99Princeton Tec Charge X111 Standard Nylon Headstrap
Helmet Side Mount
ARCs
EXFIL Rail
MLOK®
MOLLE/PALS
Picatinny
Above the Rail
POWER: 100 Lumens
LAMP: 1 Maxbright LED w/ Spot1 Red Ultrabright LED1 Blue Ultrabright LED1 Green Ultrabright LED1 IR Ultrabright LED
BURN TIME: 50 hours
BATTERIES: Dual-Fuel (1) CR123 Lithium or (1) AA Lithium or (1) AA Alkaline
WEIGHT: 2oz / 55g
WATER RESISTANT: IPX8
WARRANTY: 1 Year thru manufacturer ]]>1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-x-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-charge-x-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-point-mpls-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-point-mpls-64.jpgitem.optacticalgear-pageheliandac59MPLS-150.9945.99Princeton Tec Point MPLSPrinceton Tec111• Helmet Side Mount
• ARC Rail Mount
• EXFIL Rail
• MOLLE/PALS
• Picatinny
• Above the Rail
• Hat Brim Clip Specs:
• Power: 10 Lumens
• Lamp: 1 Ultrabright LED
• Burn Time: 36 hours
• Batteries: 2 x 2016 Lithium Coin Cells
• Weight: 0.6oz / 17g
• Water Resistant: IPX4
• Warranty: 1 Year IR Version is not available for export. Must ship inside the USA or to an APO Address. ]]>1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-point-mpls-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-point-mpls-77.jpgPrinceton Techttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-multicam-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-multicam-61.jpgitem.optacticalgear-pageheadlamps59HYB12364.9956.99Princeton Tec Remix ProPrinceton Tec111• NSN: 6230-01-606-1095
• Power: 300 Lumens
• Lamp: 1 x Maxbright LED3 Ultrabright LEDs
• Burn Time: 116 hours
• Batteries: 1 x CR123 Lithium
• Weight: 2.3oz / 66g
• Water Resistant: IPX4
• Warranty: 5 Years IR Version is not available for export. Must ship inside the USA or to an APO Address. ]]>1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-multicam-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-multicam-71.jpgPrinceton Techttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-mpls-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-mpls-47.jpgcustom-itemoptacticalgear-pageheliandac59RMX150PRO-NOD102.9992.69Princeton Tec Remix Pro MPLS - NODs KitPrinceton Tec111• Flashing IR model option (RBI, RGI models only)
• Large, simple to operate switch for activation
• Headlamp rotates 185 degrees, even when mounted on helmet, to direct IR in various angles Includes MPLS Headlamp mounts:
• NVG Adapter Plate
• Bracket mount for MOLLE and/or standard nylon headstrap
• Standard nylon headstrap Specs:
• NSN: 6230-01-633-4682
• Power 300 Lumens
• Lamp: 1 Maxbright LED3 Ultrabright LEDs
• Burn Time: 40 hours
• Batteries: 1 CR123 Lithium
• Weight: 2.3oz / 66g
• Water Resistant: IPX4
• Warranty: 5 Years IR Version is not available for export. Must ship inside the USA or to an APO Address.]]>1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-mpls-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-remix-pro-mpls-57.jpgPrinceton Techttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-mpls-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-mpls-55.jpgitem.optacticalgear-pageheliandac59MPLS-572.9965.69Princeton Tec Switch MPLS with Helmet Mounts IncludedPrinceton Tec111• Helmet Side Mount
• ARC Rail
• EXFIL Rail
• MOLLE/PALS
• Picatinny
• Above the Rail
• Hat Brim Clip Specs:
• NSN: 6230-01-622-7180
• Power: 10 Lumens
• Lamp: 2 Ultrabright LEDs
• Burn Time: 36 hours
• Batteries: 2 x 2016 Lithium Coin Cell
• Weight: 0.6oz / 17g
• Water Resistant: IPX4 IR Version is not available for export. Must ship inside the USA or to an APO Address. ]]>1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-mpls-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-mpls-65.jpgPrinceton Techttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-rgb-mpls-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-rgb-mpls-17.jpgcustom-itemoptacticalgear-pageheliandac59-SWITCH-RGB79.99Princeton Tec Switch RGB MPLSPrinceton Tec111• POWER: 10 Lumens
• LAMP: 1 Red Ultrabright LED, 1 Blue Ultrabright LED, 1 Green Ultrabright LED, 1 White or IR Ultrabright LED
• BURN TIME: 16 hours
• BATTERIES: (2) CR2016 Lithium Coin Cells
• WEIGHT: 0.6oz / 17g
• WATER RESISTANT: IPX4
• WARRANTY: 1 year through the manufacturer The MPLS platform includes all equipment necessary to tailor Switch RGB to your personal needs:
• Helmet Side Mount
• ARCs
• MOLLE/PALS
• Picatinny
• Above the Rail
• Hat Brim Clip
• M-LOK® ]]>1https://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-rgb-mpls-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tec-switch-rgb-mpls-30.jpgPrinceton Techttps://s.turbifycdn.com/aah/optacticalgear/princeton-tectactical-quad-multicam-38.jpgitem.optacticalgear-pageheadlamps59QUAD-TAC-MC44.9939.99Princeton Tec Tactical Quad - MulticamPrinceton Tec111• NVG Adapter Plate
• Bracket mount for MOLLE and/or standard nylon headstrap
• Standard nylon headstrap Specs:
• NSN: 6210-01-614-7831
• Power: 78 Lumens
• Lamp: 4 x White Ultrabright LEDs (regulated)
• Burn Time: 60.5 hours
• Batteries: 3 x AAA Alkaline or Lithium
• Weight: 3.6oz / 101g
• Water Resistant: IPX7
• Warranty: Lifetime ]]>1https://s.turbifycdn.com/aah/optacticalgear/princeton-tectactical-quad-multicam-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/princeton-tectactical-quad-multicam-45.jpgPrinceton Techttps://s.turbifycdn.com/aah/optacticalgear/proctor-sling-installation-video-21.jpglink.frprsl1https://s.turbifycdn.com/aah/optacticalgear/proctor-sling-installation-video-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/proctor-sling-installation-video-20.jpglink.blfogetrkitn21https://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-coat-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-coat-44.jpgcustom-itemoptacticalgear-pageprun62F540969.99Propper OCP IHWCU CoatPropper111Features
- Single-breasted
- Raglan sleeve front with a 5-button closure and pen slot
- Fold down collar with a fusible interlining
- Long sleeves with cuffs and one button, three buttonholes adjustable cuff tab
- Loop fields on front
- Two bellow style top opening upper sleeve pockets with eyelet drain hole
- 100% nylon elbow reinforcements
- Identification Friend or Foe tab covers with hook and loop fasteners on both sleeves
- Double-turned and cleaned finished hem]]>1https://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-coat-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-coat-58.jpgPropperhttps://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-trouser-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-trouser-44.jpgcustom-itemoptacticalgear-pageprun62F591669.99Propper OCP IHWCU TrouserPropper111Features
- Covered fly with button fly
- Seven belt loops
- Two side hanging pockets
- Two front side pleated cargo pockets with button closure flaps
- High end of cargo pockets at front of pocket rather than rear like ACU
- Two lower leg side pockets with button closure flaps
- Side bellow cargo pockets with eyelet drain holes
- Double needle seat patch with gusset
- 100% nylon knee reinforcements
- Nylon tape at leg hem
- Drawstring waistband
- Internal anti-chafing knit fabric at knees for added comfort]]>1https://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-trouser-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/propper-ocp-ihwcu-trouser-58.jpgPropperhttps://s.turbifycdn.com/aah/optacticalgear/opt-punisher-patch-32.jpgitem.optacticalgear-pagegrpa12CP5070923Punisher PatchOPT1112 inches by 2 inches, backed with hook side VELCRO Brand fastener. Unlicensed modified version of the original.1https://s.turbifycdn.com/aah/optacticalgear/opt-punisher-patch-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-punisher-patch-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/pvc-patches-60.jpgitem.optacticalgear-pagepaemPVC Patches1optmoinpvcpaoptomsepaoptmefoshinpoptmileshpvcspsyhotdogpvoptmasofpvcpoptpvcusflpaoptlapvcflpaoptgujoelopaoptgrlopvcpaoptnodepvcpaha4papahodeoptdulop1https://s.turbifycdn.com/aah/optacticalgear/pvc-patches-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/pvc-patches-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/quick-clot-combat-gauze-49.jpgitem.optacticalgear-pagebandages7041253.2446.99Quick Clot Combat GauzeQuick Clot Combat Gauze111•Easy to use and remove
•Flexible and pliable
•3 in x 4 yds (12 ft) roll The QuikClot family of products for hemostasis has been chosen by EMS, Law Enforcement, Military, and Healthcare Professionals to save lives every day. USES:
•Emergency Departments
•Trauma and Critical Care
•Orthopedics
•Podiatry Precautions:
•For external use only
•Sterility not guaranteed if package is damaged or opened
•Discard if package is damaged
•Single use only
•Do not reuse or re-sterilize
•Avoid contact with eyes Currently the choice of JSOC and approved by DoD for combat operations. There are no returns or exchanges on medical items.]]>1https://s.turbifycdn.com/aah/optacticalgear/quick-clot-combat-gauze-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/quick-clot-combat-gauze-59.jpgQuick Clot Combat Gauzehttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-afterburner-ramjet-micro-comp-and-barrel-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-afterburner-ramjet-micro-comp-and-barrel-62.jpgcustom-itemoptacticalgear-pagestweliandmo72-G19-IL-RN389.95Radian Weapons Afterburner + Ramjet Micro Comp and BarrelRadian Weapons111FEATURES
• 44% recoil reduction in combination with RAMJET (115g ammunition)
• Hardened 17-4 stainless steel
• Taper-lock screw interface; no Loctite, shims, or setscrews needed
• Angled front faces aid in holstering
• Available in black DLC
• No threads, legal for sale in all 50 states
• Makes length of G19 into G17 length, fitting all G17 holsters This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/radian-weapons-afterburner-ramjet-micro-comp-and-barrel-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-afterburner-ramjet-micro-comp-and-barrel-61.jpgRadian Weaponshttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-raptor-ambidextrous-charging-handle-ar15-m4-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-raptor-ambidextrous-charging-handle-ar15-m4-42.jpgcustom-itemoptacticalgear-pagem4arupreandp72-R000194.95Radian Weapons Raptor Ambidextrous Charging Handle AR15/M4 (R)Radian Weapons111This is the AR15/M4 variant and will not fit any AR10-patterned rifles ]]>1https://s.turbifycdn.com/aah/optacticalgear/radian-weapons-raptor-ambidextrous-charging-handle-ar15-m4-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-raptor-ambidextrous-charging-handle-ar15-m4-52.jpgRadian Weaponshttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-talon-ambidextrous-safety-selector-2-lever-kit-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-talon-ambidextrous-safety-selector-2-lever-kit-44.jpgcustom-itemoptacticalgear-pagem4arupgrades72-R002059.95Radian Weapons Talon Ambidextrous Safety Selector 2-Lever KitRadian Weapons111The Talon™ 45/90 ambidextrous safety selector is a modular design that can be installed as a standard 90° or as a 45° short throw by simply rotating the shaft 180° inside the lower receiver. Selector levers install using a precision machined dovetail interface with spring-loaded retention stud to lock the lever in place – no screws to come loose or break. The Talon is compatible with most semi-automatic AR15 & AR10/SR25-pattern rifles as well as MCX and MPX platforms.
• Designed & Manufactured in the USA
• 2-Lever Combo: Short + Long
• Levers Machined from Billet aircraft grade aluminum w Milspec Type 3 Hard Coat Anodized Finish or Cerakote
• Center Shaft Machined from Hardened Steel w/ Black Nitride Finish ]]>1https://s.turbifycdn.com/aah/optacticalgear/radian-weapons-talon-ambidextrous-safety-selector-2-lever-kit-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/radian-weapons-talon-ambidextrous-safety-selector-2-lever-kit-58.jpgRadian Weaponshttps://s.turbifycdn.com/aah/optacticalgear/radio-pouches-46.jpgitem.optacticalgear-pagemollepouchesRadio Pouches1fecorapocrprrserasipplacsmfl152wrataatanrepocrpradpohasteudbrssprnaflcocaresttwnepttofputdiupttrefecopttrespsymurachmkvesyhewhmorahigrgesidrprhsmuaccotamohsratamoblfogehewhmuatsmbtirapohsmomirapofispmurapomswlibarapomiwebarapo1https://s.turbifycdn.com/aah/optacticalgear/radio-pouches-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/radio-pouches-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/raid-xe-spec-sheet-11.jpglink.wiraxelowpo1https://s.turbifycdn.com/aah/optacticalgear/raid-xe-spec-sheet-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/raid-xe-spec-sheet-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/raine-bridger-panel-for-first-spear-strandhogg-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/raine-bridger-panel-for-first-spear-strandhogg-33.jpgcustom-itemoptacticalgear-pagecaac1XX054PANEL69.9959.99Raine Bridger Panel for First Spear TubesRaine Tactical Gear111• Adds back the MOLLE/PALS real-estate lost from using FirstSpear® Tubes™ (Bridges the Gap)
• Smooth quick release function
• Covers and protects FirstSpear® Tubes™ quick release hardware
• Increases service life of Tubes™ quick release hardware
• Increased protection from accidental opening of Tubes™ quick release hardware
• Attachment options compatible with MOLLE/PALS, 6/12™, and 6/9™ platforms
• Ambidextrous, works with left and right FirstSpear® Tubes™ cummerbunds
• Quick release pull cord extender for ease of donning & doffing with mounted dual stacked ammo and radio pouches Lifetime Warranty, Made in the USA 1 x individual Bridger Panel and accessory parts included. Additional panels sold separately. Vest sold separately. ]]>1https://s.turbifycdn.com/aah/optacticalgear/raine-bridger-panel-for-first-spear-strandhogg-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/raine-bridger-panel-for-first-spear-strandhogg-43.jpgRaine Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/ram-raised-angle-marker-40.jpgitem.optacticalgear-pagefigemi593110007330299.99RAM Raised Angle MarkerRaised Angle Marker IN STOCK!111NOTE: This item does not include any poles or similar hardware. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/ram-raised-angle-marker-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/ram-raised-angle-marker-50.jpgRaised Angle Marker IN STOCK!https://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-23.jpglink.hrfcodura1https://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-22.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-24.jpglink.hrfcora1https://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-ramp-modification-info-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-carrying-backpacks-weapon-cases-drag-bags-65.jpgitem.optacticalgear-pagebaRange / Gear Bags1shcorebaeogshootingbagemspamsacemdomammosactewetrpabymyfisphehutmahodeunca1https://s.turbifycdn.com/aah/optacticalgear/weapon-carrying-backpacks-weapon-cases-drag-bags-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-carrying-backpacks-weapon-cases-drag-bags-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/range-gear-70.jpgitem.optacticalgear-pageweaponsRange Gear1octaheprcosunandshtrtaargescmidsigargegachargepisigachargefatbaargesqrebagargewacaopgaeogshootingbagtrnoratrnorashcorebamadataoutmadatalamadavopomadaliposmmadalipomemadalipolamadawiposmmadawipomemadawipolamadaposmmadapomemadapolamadautormadacan20madacanlahpgstockcuffemdomammosacemspamsactwnebipov2hamisychwrlema412tasps1https://s.turbifycdn.com/aah/optacticalgear/range-gear-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/range-gear-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/range-supplies-35.jpgcustom-itemoptacticalgear-pageindexRange Supplies1otweclkiriteinrainbrtokitargetsshottimersrangegeartrnoratrnorabagesttrcotatrcasetrcotapi1demahashde1https://s.turbifycdn.com/aah/optacticalgear/range-supplies-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/range-supplies-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-dip-can-holster-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-dip-can-holster-44.jpgcustom-itemoptacticalgear-pagephflpdbapo126RTDIP9.99Raptor Dip Can HolsterRaptor Tactical111The Raptor Tactical Dip Can Holster is a simple, versatile way to store and protect your dip. It not only gives you quick access when needed but also has a sleek, lightweight design. Weight 1.85 oz. Clips easily into MOLLE/ PALS, or (up to) 1.75" belt systems Compatible with shredded beef jerky chew and other similar products Made in USA1https://s.turbifycdn.com/aah/optacticalgear/raptor-dip-can-holster-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-dip-can-holster-58.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-athena-antenna-relocation-pouch-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-athena-antenna-relocation-pouch-49.jpgcustom-itemoptacticalgear-pageradiopouches126RT-ANTENNAPOUCH32.2430.49Raptor Tactical Athena - Antenna Relocation PouchRaptor Tactical111-Weight: 0.70 oz
-Dimensions: 6.5" x 1.5" Made in the USA; Lifetime Warranty. Pouch Only, Antenna and Cables not included.]]>1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-athena-antenna-relocation-pouch-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-athena-antenna-relocation-pouch-63.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-birger-3-in-1-pouch-30.jpgcustom-itemoptacticalgear-pagecobamanpumeb126RT-BIRGER104.4899.99Raptor Tactical BIRGER 3 in 1 PouchRaptor Tactical111"BIRGER - in the Norse language means the Keeper" This item is a 3 in 1 pouch that can be worn as a dangler affixed to your gear via velcro hook, worn as a fanny pack with our attached waist strap, or slide onto any belt. This item has 2 rear chem-light holders, a rear molle channel, and a discreet rear pocket for sensitive items. This pouch also sports elastic loops on the underside for tourniquets, epi-pens, or other similarly sized items for easy access. The Center Compartment is the largest compartment with an interior divider made of netting material to allow separate storage of items, and a panel of velcro loop to affix blood type patches, call signs, or to avoid the scratching of equipment. This compartment is large enough to hold an M1911A1 MS Tactical Handgun and close easily. The front-most compartment is similarly designed to the center and fits 3 Double stacked 9mm magazines. And finally, The exterior panel of this pouch is affixed with our favorite honeycomb cut velcro loop, perfect to rock any number of patches, and two retainer loops made of laminated Cordura for any number of uses. Dimensions: 9" long, 5" tall, and 2.5" wide, empty. 1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-birger-3-in-1-pouch-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-birger-3-in-1-pouch-40.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-dump-pouch-with-chemlight-holder-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-dump-pouch-with-chemlight-holder-35.jpgcustom-itemoptacticalgear-pagedupoevba126RT-DP45.05Raptor Tactical Dump Pouch with ChemLight holder - Short ModelRaptor Tactical111• Collar with double drawcord for optimal maintenance of content.
• Stiffening made of stainless steel ensures optimal maintenance of shape when unfolded.
•Can be stowed by either rolling the pouch up while still retaining access to chemlights, or folded up for smallest profile
• 500D Cordura material with Mil-spec mesh bottom to allow dirt and water to drain out
• Mounting system compatible with MOLLE and up to 2-inch wide belts via the belt sleeve
• Perfect for your empty pods, tubes, or mags.
• Holds up to 9 M4 magazines
• Weight: 0.28 lbs Made in the USA, Lifetime Warranty. ]]>1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-dump-pouch-with-chemlight-holder-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-dump-pouch-with-chemlight-holder-45.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-headset-cable-hider-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-headset-cable-hider-41.jpgcustom-itemoptacticalgear-pagehepr126RTHCH15Raptor Tactical Headset Cable HiderRaptor Tactical111OPT Note: Be sure that your headset will work with the Headset Cable Hider. It is compatible with most Peltor-style headbands and 3M Peltor ARC Adapters Headset not included]]>1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-headset-cable-hider-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-headset-cable-hider-54.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-marvn-rucksack-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-marvn-rucksack-16.jpgcustom-itemoptacticalgear-page72hourpacks126MAR270Raptor Tactical MARVN RucksackRaptor Tactical111Product Features:
• Made of 500D Cordura
• Weight: 3.07 lbs
• Size: 13" x 6" x 20.5"
• Padded Shoulder Straps
• Chest Strap
• Webbing Handle
• Removable Spring Steel Frame
• MOLLE Webbing
• Top Flap Pouch
• Quick Access Zipper Top
• Interior MOLLE Panel
• Cinch Closure ]]>1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-marvn-rucksack-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-marvn-rucksack-30.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-micro-hand-warmer-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-micro-hand-warmer-21.jpgcustom-itemoptacticalgear-pageglovesRAPMICRO120109.95Raptor Tactical Micro Hand WarmerRaptor Tactical111Features:
- Quick Heat: Thanks to its advanced materials and insulation, this hand warmer heats up quickly, providing instant relief from the cold.
- Versatile Design: The hand warmer is designed with versatility in mind. It can be easily attached to a belt, backpack, or tactical gear, making it readily accessible when needed.
- Highly Pack-able and Lightweight: this hand warmer is very easy to pack down and will fit into a cargo pocket without excess bulk. The advanced materials allow it to be extremely warm without all the fluff and bulk of traditional hand warmers.
- Durable and Long-lasting: The combination of Quattro Assault, Radiance, and Alpha Direct ensures that this hand warmer is built to withstand heavy use and harsh conditions, promising long-lasting durability. Materials: Quattro Assault: The exterior of the Raptor Tactical Micro Hand Warmer is constructed using Quattro Assault, a rugged and abrasion-resistant fabric. This material is specially engineered to withstand the harshest conditions, making it perfect for tactical applications. It ensures that your hand warmer can endure the rigors of outdoor adventures, whether you're hiking through rough terrain or navigating demanding tactical scenarios. Radiance Insulation: Beneath the Quattro Assault exterior, the hand warmer features Radiance insulation, which is renowned for its exceptional heat-retaining properties. Radiance insulation efficiently traps and retains body heat, keeping your hands warm even in freezing temperatures. This means you can stay comfortable and focused on the task at hand without worrying about the cold. Alpha Direct Lining: The interior of the hand warmer is lined with Alpha Direct, a high-performance fleece material. Alpha Direct offers an incredible combination of warmth and moisture management. It wicks away sweat and moisture from your hands, ensuring that you stay dry and comfortable during prolonged use. Additionally, Alpha Direct is known for its lightweight and breathable properties, ensuring that you don't feel weighed down while on the move. Made in the USA This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-micro-hand-warmer-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-micro-hand-warmer-35.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-odin-mk-iii-belt-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-odin-mk-iii-belt-50.jpgcustom-itemoptacticalgear-pagemowebe126RTODIN3116.55Raptor Tactical Odin MK III BeltRaptor Tactical111• Regular Model: 1 layer of rigger webbing, flexible like a standard rigger belt.
• 3-Gun Model: 2 layers of rigger webbing, more rigid for holding a larger load out of gear, recommended model for most users. SIZE: size should be determined by measuring with your waist with pants on, measure around the belt loops. Do Not Use Jeans Size. SMALL: 30.5-33.5"
MEDIUM: 34-36.5"
LARGE: 37-40"
EXTRA LARGE: 40-43" Outer belt: 1 3/4" wide
Inner belt: 1 1/2" wide Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/raptor-odin-mk-iii-belt-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-odin-mk-iii-belt-60.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-sentinel-skull-crusher-gen-2-0-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-sentinel-skull-crusher-gen-2-0-61.jpgcustom-itemoptacticalgear-pagenvgmoso126SENTINEL219.99209.99Raptor Tactical Sentinel Skull Crusher GEN 2.0Raptor Tactical111demovideo7• One-size fits all
• Side rail mounting holes compatible with MOE rails by MAGPUL
• Internal cables fitting
• Compatible with all base plates available on the market
• Molle-loop back panel
• Super ergonomic ]]>1https://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-sentinel-skull-crusher-gen-2-0-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/raptor-tactical-sentinel-skull-crusher-gen-2-0-75.jpgRaptor Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-copia-magazine-carrier-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-copia-magazine-carrier-46.jpgcustom-itemoptacticalgear-pageracohoandac108DS940U39.99Raven Concealment Copia Pistol Mag Carrier - Single and DoubleRaven Concealment111-Glock 9mm/40/357
-M&P 9mm/40 Double Stack
-Sig 226
-Beretta M9/92/96
-HK P30
-HK P2000
-XDm 9/40
-Styer 9/40
-Beretta PX4
-CZ-75
-FNP 9
-FNX 9
-FNS 9
-Baby Eagle
-Browning HiPower
-XD9/40
-SW-99
-Walther P99
-Walther PPQ
-SW 4006 And many more! Mounting loops:
-Tall model includes standard OWB Belt Loops, 1.5-inch width
-Short model includes new shorter Closed Loops, 1.5-inch width. Made in the USA. Unconditional Lifetime Warranty. USA and APO Addresses only. No International shipping.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-copia-magazine-carrier-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-copia-magazine-carrier-56.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-belt-claw-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-belt-claw-46.jpgcustom-itemoptacticalgear-pageeibakitandac108CLAW14.99Raven Concealment Eidolon Belt ClawRaven Concealment111-Right-Hand: made for use with Right-Hand holster (pictured)
-Left-Hand: made for use with Left-Hand holster. This accessory is specifically made to work with the Eidolon Holster only. Claw and mounting screws only, all other parts sold separately. Made in the USA. Unconditional Lifetime Warranty. USA and APO Addresses only. No International shipping.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-belt-claw-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-belt-claw-60.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-system-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-system-58.jpgcustom-itemoptacticalgear-pageeibakitandac108EGXXXX99.99Raven Concealment Eidolon Holster - Full KitRaven Concealment111Holster Kit Only. No other parts or items included. The Eidolon is the culmination of over three years of design and development. It is designed to be the most refined and functional inside-the-waistband holster on the market. At the core of the Eidolon is the holster shell. The shell is precisely fitted to the weapon on the inside and is smooth on the outside to work in conjunction with the body, belt, and clothing -in nearly any carry position- to maximize comfort and concealment. At the same time, the shell provides attachment points for a host of accessories to allow the user to tailor the holster for their specific carry needs. The holster shells feature an innovative, adjustable retention feature that isolates the tension solely on the front of the trigger guard. This provides for an extremely clean “feel” when drawing and holstering - unlike other companies’ adjustable retention holsters which simply compress the holster body along the entire trigger guard and/or frame, resulting in a mushy feel as the pistol drags against the inside of the holster. All Eidolon holster shells are fully compatible with most extended controls, factory and after-market sights of any height (including suppressor sights), any type of RDS mounted behind the ejection port, and most extended/threaded barrels. Full Kit
-The Eidolon Full Kit gives you all the accessories needed to optimize your holster for either AIWB or IWB carry on nearly any body type. The Eidolon Full kit is a tuckable, versatile, and comprehensive IWB/AIWB holster package that can be used with one or both belt attachments and give you hundreds of potential configuration options. The Full Kit includes: -One holster shell of your specification
-One pair of belt attachments of your choice
-One Tall Spacer for mounting the belt attachment below the trigger guard
-One 8-hole Extension Wing
-One 10-hole Extension Wing
-One Short Spacer for mounting the Extension Wing below the trigger guard, angled up toward the belt line.
-One set of Belt Claws
-One Holster Wedge for right or left hand configurations
-All needed hardware and full instruction manual Shell Models
-The Glock 26/19/Universal model has a pass-through open bottom design and will fit any Gen 3-5. Glock 9mm/.40cal double stack pistol. The holster shell itself is equal in length to a Glock 19 pistol.
-The Glock 17 model has a closed bottom design equal in length to a Glock 17 pistol, but will fit any Glock 26/27/19/23/17/22 Gen 3-5.
-NOTE: Both models feature a tall body shield on the inboard side (body-facing side) and a short shield on the outboard side of the holster. Included Accessories
-Tuckable Overhook Set: Choose between Overhooks for 1.5" or 1.75" belts. Can be used as a pair or individually mounted to the holster shell or the Offset Wings (also included). Overhooks offer two ride height positons 5/8” up or down, and approximately 15 degrees of cant adjustment, forward or back. Made in the USA. Unconditional lifetime warranty. USA and APO Addresses only. No International shipping. ]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-system-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-system-68.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-iwb-basic-kit-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-iwb-basic-kit-48.jpgcustom-itemoptacticalgear-pageeibakitandac108EGXX69.99Raven Concealment Eidolon Holster - IWB Basic KitRaven Concealment111litoeipaHolster Kit Only. No other parts or items included. The Eidolon from Raven Concealment Systems is the culmination of over three years of design and development. Eidolon is designed to be the most refined and functional Inside the Waistband holster on the market. At the core of the Eidolon system is the holster shell. The shell is precisely fitted to the weapon on the inside and is designed to be smooth on the outside and work with the body, belt and clothing in any carry position to maximize comfort and concealment. At the same time the shell provides attachment points for a host of accessories to allow the user to tailor the system for their specific carry needs. The holster shells feature an innovative adjustable retention feature that isolates the tension on only the front of the trigger guard. This provides for an extremely clean feel when drawing and holstering with minimal adjustment - unlike other adjustable retention holsters that grossly squeeze the entire trigger guard and/or frame and result in a mushy feel as the pistol drags against the inside of the holster. All holster shells are fully compatible with most extended controls, any brand or size sights, any type of MRDS mounted behind the ejection port and most extended/threaded barrels. Our “Basic” Inside-the-Waistband Eidolon kit is excellent for IWB carry between 3 and 5 o’clock for a right handed shooter (reverse for lefties). Accessories are sold separately to aid in Appendix carry and other mounting options for greater concealment. The Basic IWB kit is a tuckable, compact IWB system that can be used with one or both belt attachments and give you scores of cant and ride height adjustments. The Basic IWB Kit includes:
-One holster ambi shell of your specification
-One pair of 1.5" Overhook belt attachments
-One Tall Spacer for mounting the belt attachment below the trigger guard
-All needed hardware and full instruction manual Models: All Models are Ambidextrous
-The Glock 26/19/Universal model has a pass-through open bottom design and will fit any Gen 3-5. Glock 9mm/.40cal pistol. The holster shell itself is equal in length to a Glock 19 pistol.
-The Glock 17 model has a closed bottom design equal in length to a Glock 17 pistol, but will fit any Glock 26/27/19/23/17/22 Gen 3-5. Body Shield:
The Ambidextrous Short body shield is cut to clear the hand completely but yet still help prevent clothing from entering the mouth of the holster and provide a visual and tactile guide for re-holstering the weapon. Color: Black Made in the USA. Unconditional Lifetime Warranty. USA and APO Addresses only. No International shipping.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-iwb-basic-kit-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-holster-iwb-basic-kit-62.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-overhooks-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-overhooks-57.jpgcustom-itemoptacticalgear-pageeibakitandac1081XX03OH24.99Raven Concealment Eidolon Tuckable OverhooksRaven Concealment111-Two Overhook struts in your choice of 1.5" or 1.75" belt size
-One Tall Spacer (for mounting the strut below the trigger guard)
-All needed hardware and instructions Made in the USA. Unconditional Lifetime Warranty. USA and APO Addresses only. No International shipping. ]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-overhooks-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-overhooks-71.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-soft-loops-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-soft-loops-49.jpgcustom-itemoptacticalgear-pageeibakitandac10830435TA34.99Raven Concealment Eidolon Tuckable Soft Loops - Infinite Ride Height AdjustmentRaven Concealment111These Soft Loops allow for infinite ride height adjustment, meaning you can adjust the height of the holster to the exact right spot for best concealment, speed and comfort. Can be used on multiple Raven Concealment products. Tuckable Soft Loops can be used as a pair or individually mounted to the holster shell or Offset Wings. The polymer struts provide two ride height positions 5/8” up or down and approximately 15 degrees of cant adjustment forward or back. Soft Loops are adjustable and will fit 1.25”, 1.5” and 1.75” belts. The soft loop itself mounts in a slot to allow infinite ride height adjustment within the slot envelope. The loop itself can be rotated to allow infinite cant adjustments forward and back. Once tightened down, little nibs in the strut face lock the loop in place and prevent movement. The Tuckable Soft Loop Set includes:
-Two Soft Loop straps
-Two polymer struts
-One Tall Spacer (for mounting the strut below the trigger guard)
-All needed hardware and instructions Made in the USA. Unconditional Lifetime Warranty. USA and APO Addresses only. No International shipping.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-soft-loops-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-eidolon-tuckable-soft-loops-59.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-freya-magwell-r-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-freya-magwell-r-46.jpgcustom-itemoptacticalgear-pagestweliandmo108FREYA94.99Raven Concealment Freya Mag Well (R)Raven Concealment111See Chart for magazine capability. NOTE: 10-Round Glock Magazines will NOT fit. Magazine Well and mounting hardware only. Made in the USA. Unconditional Lifetime Warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-freya-magwell-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-freya-magwell-r-56.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-ar-mag-carrier-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-ar-mag-carrier-48.jpgcustom-itemoptacticalgear-pageracohoandac108ARSMCU49.99Raven Concealment Lictor AR Mag CarrierRaven Concealment111The Lictor M4 is ambidextrous, and works with rounds-forward and rounds-rearward magazine orientation. It has a slight "funnel top" to aid in guiding the magazine into the carrier. The Lictor M4 magazine carriers work with all common-issue AR-15/M-4 magazines (GI, PMag, Tango Down ARC, Lancer, etc). The design securely holds fully loaded magazines without the need for any retention screws, which are notorious for backing off gradually and falling out. The belt clip on the Lictor M4 allows the shooter to quickly don and doff the magazine carrier one-handed. The belt clip can be removed from the pouch, exposing mounting holes which are compatible with a variety of after-market belt attachments and MOLLE/PALS mounting adaptors. This provides end-users with an easy way adapt the carrier to a variety of applications on their body, a rifle stock, inside a bag, a vehicle, etc. This magazine carrier is equally suited for low-vis/CCW roles (like under a sport coat or untucked shirt) and overt roles, like being mounted on a war belt or plate carrier. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-ar-mag-carrier-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-ar-mag-carrier-61.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-g9-double-pistol-mag-carrier-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-g9-double-pistol-mag-carrier-45.jpgcustom-itemoptacticalgear-pagebemopipo108G9LPD49.99Raven Concealment Lictor G9 - Double Pistol Mag CarrierRaven Concealment111The Lictor G9 magazine carrier is ambidextrous and has relief cuts on the outboard face in order to facilitate rapid magazine access whether worn on the waistline or high up on a vest or plate carrier. The Lictor G9 magazine carrier is designed to accept mil-spec magazines from all of the “Big 3” modern service pistols (Glock 17/19/45, Sig M17/M18, and Beretta M9), and also happens to fit a variety of other popular commercial-market 9mm/.40 caliber pistols with similar magazine dimensions (such as the CZ P07, CZ-75, Beretta APX, Beretta PX4, Walther PPQ, and Springfield XD and XDM). The design securely holds two fully loaded magazines, and offers adjustable retention that can be dialed down for daily CCW or dialed way up for overt use on armor carriers without the need for flaps or bungies. The belt clip on the Lictor G9 allows the shooter to quickly don and doff the magazine carrier one-handed. The belt clip can be removed from the carrier, exposing mounting holes which are compatible with a variety of after-market belt attachments and MOLLE/PALS mounting adaptors. This provides end-users with an easy way adapt the carrier to a variety of applications on their body, inside a bag, a vehicle, etc. This magazine carrier is equally suited for low-vis/CCW roles (like under a sport coat or untucked shirt) and overt roles, like being mounted on a war belt or plate carrier. Made in the USA. 1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-g9-double-pistol-mag-carrier-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-lictor-g9-double-pistol-mag-carrier-58.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-holster-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-holster-59.jpgcustom-itemoptacticalgear-pageracohoandac108PX49.99Raven Concealment Perun HolsterRaven Concealment111Each holster includes three pair of 1.5” belt loops, which allows the end-user to configure the ambidextrous holster body for left-handed or right-handed use, with either a 0-degree or 10-degree cant. Retention in the Perun is crisp, defined, and consistent, thanks to innovative design features inside the holster body. Unlike other holsters that use the traditional “screw through a rubber grommet” style of retention, the Perun’s retention will not back off after repeated drawing and re-holstering. The Perun is compatible with most slide-mounted red-dot optics (like the Aimpoint T-1, Trijicon RMR, etc.) and accommodates suppressor-height front sights up to .350” tall. It is also fully compatible with the RCS Balor optic mount. The Glock Perun is compatible with generation 3-5 Glock pistol and all small frame 9mm, .40S&W, and .357sig Glocks.
Not compatible with large frame glocks like the Glock 21. The muzzle-end of the holster is rounded for comfort, yet has an opening sufficient to accommodate most common after-market extended and threaded barrels (with thread protectors). The opening at the muzzle is also specifically designed to allow foreign objects (like spent casings) to drop out the bottom so that nothing can block your pistol from being safely re-holstered. The ambidextrous holster body has both inboard and outboard full-height body shields. These body shields offer some protection for your pistol from sweat, as well as protecting your skin and cover garments (especially the thin material used for linings in sport coats and suit jackets) from being abraded by the serrations on the rear of the slide. They also enhance safety by helping keep cover garments and other foreign objects from falling into the mouth of the holster while you have your pistol drawn, and aid in proper, safe muzzle orientation during re-holstering. The holster is injection molded from a proprietary, extremely high-strength polymer blend that is significantly more durable than Kydex or Boltaron. Like all RCS products, it is made in the USA, and is backed by our lifetime warranty. Types:
• Glock 19
• Glock 17
• Sig P-320 Fullsize/M17/X5
• Sig P-320C/X-Carry/M18
• Glock 48 (Compatible with Victory First V43)
• Glock 43 and 43X
• M&P Shield *Legacy Phantom belt attachments are NOT compatible with the Perun holster. Made in the USA. Unconditional Lifetime Warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-holster-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-holster-72.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-lc-light-compatible-holster-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-lc-light-compatible-holster-55.jpgcustom-itemoptacticalgear-pageracohoandac108PXLC59.99Raven Concealment Perun LC Light Compatible HolsterRaven Concealment111Not compatible with large frame glocks like the Glock 21. The muzzle-end of the holster is rounded for comfort, yet has an opening sufficient to accommodate most common after-market extended and threaded barrels (with thread protectors). The opening at the muzzle is also specifically designed to allow foreign objects (like spent casings) to drop out the bottom so that nothing can block your pistol from being safely re-holstered. The ambidextrous holster body has both inboard and outboard full-height body shields. These body shields offer some protection for your pistol from sweat, as well as protecting your skin and cover garments (especially the thin material used for linings in sport coats and suit jackets) from being abraded by the serrations on the rear of the slide. They also enhance safety by helping keep cover garments and other foreign objects from falling into the mouth of the holster while you have your pistol drawn, and aid in proper, safe muzzle orientation during re-holstering. The holster is injection molded from a proprietary, extremely high-strength polymer blend that is significantly more durable than Kydex or Boltaron. Like all RCS products, it is made in the USA, and is backed by our lifetime warranty. Types:
• Sig P320F/M17/X5 with Surefire X300U
• Glock 19, 23, 32, 38, 45 , 19X with XC1-A/B
• Standard Frame Glock with Surefire X300U (A and B models), will fit up to Glock 34 length pistols including most "Roland Special" configurations
• Standard Frame Glock with Streamlight TLR1 HL, will fit up to Glock 34 length pistols including most "Roland Special" configurations *Legacy Phantom belt attachments are NOT compatible with the Perun holster. Made in the USA. Unconditional Lifetime Warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-lc-light-compatible-holster-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-lc-light-compatible-holster-68.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-qms-adaptor-kit-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-qms-adaptor-kit-43.jpgcustom-itemoptacticalgear-pageracohoandac108PXQMSSMP29.99Raven Concealment Perun QMS Adaptor KitRaven Concealment111Designed for Perun Holster models only. Not compatible with older model Raven Concealment Holsters and Carriers. NOTE: Quick Mount Straps require some break-in before they snap open and closed easily. Made in the USA. Unconditional Lifetime Warranty. QMS Adaptor Kit only; holster sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-qms-adaptor-kit-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-perun-qms-adaptor-kit-56.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-holsters-and-accessories-60.jpgcustom-itemoptacticalgear-pageholstersRaven Concealment Systems Holsters and Accessories1racopehoracopelclicoracopeqmsadkeibakitandacracova2hofukracova2kitforacova2hoadkracova3licohracoliarmagcracocomacaracosykapima1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-holsters-and-accessories-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-holsters-and-accessories-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-systems-kari-pistol-magazine-carrier-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-systems-kari-pistol-magazine-carrier-18.jpgcustom-itemoptacticalgear-pageracohoandac108G9ACBK49.99Raven Concealment Systems Kari Pistol Magazine CarrierRaven Concealment1111https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-systems-kari-pistol-magazine-carrier-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-systems-kari-pistol-magazine-carrier-31.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-topstop-ar-upper-receiver-cover-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-topstop-ar-upper-receiver-cover-61.jpgcustom-itemoptacticalgear-pagem4arupreandp108TOPSTP14.99Raven Concealment TopStop AR Upper Receiver CoverRaven Concealment111The TopStop cover is designed to snap on most AR15 or M4 type upper receivers when they are detached from the lower receiver. The TopStop completely seals the upper reciever preventing fouling from getting in or out and it stops the bolt carrier group and charging handle from sliding out as the upper is moved around. The TopStop is made out of super tough polymer and is impervious to most solvents and chemicals. This product is perfect for storing or transporting your spare upper recievers, especially in low-profile bags where the rifle must be broken down to fit. Made in the USA. Unconditional Lifetime Warranty.1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-topstop-ar-upper-receiver-cover-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-topstop-ar-upper-receiver-cover-75.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-advanced-kit-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-advanced-kit-48.jpgcustom-itemoptacticalgear-pageracohoandac108VG2ADV49.99Raven Concealment Vanguard 2 Holster - Advanced KitRaven Concealment111Types:
-IWB Overhooks: Includes both 1.5-inch and 1.75-inch width Overhooks for quick attach and detachment from the belt.
-Soft Loop and Strut: adjustable for 1.25-inch, 1.5-inch and 1.75-inch width belts. Soft loop has infinite height adjustment for more precise ride height fit and can easily attach/detach from the belt. Please note that the VG2 Advanced kit is not compatible with the Basic Kit Strut or the Lanyard option. VG2 CLAWs are only compatibe with the model of VG2 shell specified. For example, a Glock VG2 CLAW will NOT fit a M&P VG2 holster shell. Please be aware, we do not advise attempting to re-holster the weapon while the VG2 is inside your clothing. You should remove the VG2 and install it on the weapon outside of your waistband. USA and APO Addresses only. No International shipping.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-advanced-kit-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-advanced-kit-61.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-full-kit-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-full-kit-64.jpgcustom-itemoptacticalgear-pageracohoandac108VG2FULL39.99Raven Concealment Vanguard 2 Holster - Full KitRaven Concealment111Please be aware, we do not advise attempting to re-holster the weapon while the VG2 is inside your clothing. You should remove the VG2 and install it on the weapon outside of your waistband. Made in the USA. Unconditional Lifetime Warranty. NOTE - This item will NOT work with a Glock 42 or M&P Shield. USA and APO Addresses only. No International shipping.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-full-kit-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-holster-full-kit-77.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-kit-for-sig-p365-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-kit-for-sig-p365-43.jpgcustom-itemoptacticalgear-pageracohoandac108VG2P365BKOH39.99Raven Concealment Vanguard 2 Kit for Sig P365Raven Concealment111Please be aware, we do not advise attempting to re-holster the weapon while the VG2 is inside your clothing. You should remove the VG2 and install it on the weapon outside of your waistband, which is easily done using the over-hook clip. Made in the USA. Unconditional Lifetime Warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-kit-for-sig-p365-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-2-kit-for-sig-p365-56.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-3-light-compatible-holster-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-3-light-compatible-holster-46.jpgcustom-itemoptacticalgear-pageracohoandac108VG354.99Raven Concealment Vanguard 3 - Light Compatible HolsterRaven Concealment111RCS has physically verified the fit of the X300U A and B on the following pistols. As a general rule, any Pistol + X300U A/B combination will fit as long as the distance between the muzzle end of the gun and the bezel end of the light is ¾” or more. Compatible pistol models:
Glock:
19/23/32, 17/22/31, 20/21/21sf, 29/30/30s/30sf, 37, 38
Smith&Wesson:
M&P Fullsize 9mm/.40cal, M&P45 Midsize, M&P45 Compact
Sig:
P226R/MK-25/P226 Navy, P228R, P229R, P220R, P320 Compact, P250, SP2022
H&K:
VP9 9mm/.40cal, P30, P2000, HK45, USP 9mm/.40cal (w/ aftermarket rail), USP Compact 9mm/.40cal (w/ aftermarket rail), USP45 (w/ aftermarket rail), USP45 Compact (w/ aftermarket rail)
Springfield Armory:
XD 9/49/45 4”bbl., XDm 9/40/45 4.5”bbl., XDm 9/40/45 3.8”bbl., XD MOD2 4”bbl.
FN:
FNP/X-45, FNP/X-9/40, FNS 9/40, FN Five Seven (w/ square trigger guard)
Beretta:
PX4 Storm 9mm, PX4 Storm .45cal
CZ:
P-07, P-01, CZ-75 SP-01 Phantom
Ruger:
SR-9, P95
Walther:
PPQ Gen 1&2 4”bbl., PPQ .45cal 4”bbl.
Steyr:
M9A1
1911 Pistols:
4.25” w/ rail, 4” w/ rail USA and APO Addresses only. No International shipping. NOTE - Thread Locker is needed on the mounting screws in order to maintain secure lock-up of mounting hardware and avoid loosening over time. Sur-Lok threadlocker is included with the holster.]]>1https://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-3-light-compatible-holster-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/raven-concealment-vanguard-3-light-compatible-holster-59.jpgRaven Concealmenthttps://s.turbifycdn.com/aah/optacticalgear/rds-red-dot-sights-and-mounts-34.jpgcustom-itemoptacticalgear-pageopticsRDS Red Dot Sights, Magnifiers, and Mounts1sigsaro1xmmr1sigsaro1xmmraidurdsreddoaimit22moadoaiparioppavsbaorc1ait2moaraimimomk2arexpibaruntafamimoruntafaftcaimuntafacosemountafaqdleeohwsexreotechexps3runtafariruntafaftc4xmai3xmanomoreog33manomoreog43manomoreog45manomoreog33mareog43mareog45maruntafaftcommhrfconceptsamcgesuprt12seoknarcohirimoardeofopmobaardeofopbaplonehucohe11https://s.turbifycdn.com/aah/optacticalgear/rds-red-dot-sights-and-mounts-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/rds-red-dot-sights-and-mounts-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/dead-man-s-hand-shooting-deck-28.jpgcustom-itemoptacticalgear-pagetargets110RFDMHSD19.9918.49RE Factor Dead Mans Hand Shooting DeckRE Factor111demovideo1Designed to work with RE Factor IQ Targets, the Dead Man’s Hand Shooting Deck is the perfect way for shooters to learn how to “think before you shoot.” The deck features 52 different shooting drills that teach the shooter to recognize their target(s) before firing. The deck allows shooters to progress from simple drills (for beginners) to more advanced drills as they continue through the deck. Advanced shooters can also performed these drills with shooting timers for added stress. Each deck comes with an instruction guide, and metal case for easy storage in a range bag. 1https://s.turbifycdn.com/aah/optacticalgear/dead-man-s-hand-shooting-deck-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/dead-man-s-hand-shooting-deck-35.jpgRE Factorhttps://s.turbifycdn.com/aah/optacticalgear/re-factor-essentials-target-30.jpgcustom-itemoptacticalgear-pagetargets11021372.5RE Factor Essentials TargetRE Factor111Unlimited amount of shooting combinations
Designed to maximize range time
Made in the USA
This product is designed to be used specifically with RE Factor's Essentials Shooting Guide. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/re-factor-essentials-target-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/re-factor-essentials-target-40.jpgRE Factorhttps://s.turbifycdn.com/aah/optacticalgear/re-factor-iq-target-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/re-factor-iq-target-49.jpgcustom-itemoptacticalgear-pagetargets110RFTGTIQ2.5RE Factor IQ TargetRE Factor111• Measures: 23" x 35"
• Unlimited amount of shooting combinations
• Pistol shapes measure 3″
• Rifle shapes measure 5″ This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/re-factor-iq-target-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/re-factor-iq-target-63.jpgRE Factorhttps://s.turbifycdn.com/aah/optacticalgear/recondo-lrrp-vietnam-1960-s-51.jpgcustom-itemoptacticalgear-pagegearloadoutsRecondo / LRRP Vietnam 1960's1STABO harness
Rifle
SOI
FA kit
2 canteens
18 magazines
Swiss rope
Ground sheet
Map
Davron tablets
Knife
Mirror
Compass
Water purification
D-rings
Ruck
Towel
Poncho
Gloves (heavy)
Notebook
Snivel drugs Source: "Recondo: LRRPs in the 101st Airborne", Larry Chambers, (current edition 2003), Presidio Press]]>1https://s.turbifycdn.com/aah/optacticalgear/recondo-lrrp-vietnam-1960-s-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/recondo-lrrp-vietnam-1960-s-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/recovery-handler-user-guide-21.jpglink.spsyreha1https://s.turbifycdn.com/aah/optacticalgear/recovery-handler-user-guide-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/recovery-handler-user-guide-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/retention-lanyards-71.jpgitem.optacticalgear-pagebeltsRetention Lanyards1215geoprelaz215geoprelast3perela21https://s.turbifycdn.com/aah/optacticalgear/retention-lanyards-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/retention-lanyards-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/rigger-s-belts-trouser-belts-64.jpgitem.optacticalgear-pagebeltsRigger's Belts / Trouser Belts / Duty Belts1arhribevitacobefispasgunbea215geulribehsgidutybeltmegeleviaebemegeleshbemategunbeeloblintrbemoveeainbeforopgfisplionebeb1https://s.turbifycdn.com/aah/optacticalgear/rigger-s-belts-trouser-belts-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/rigger-s-belts-trouser-belts-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-45.jpgitem.optacticalgear-pagefigemiRite In The Rain / Data Books1riinradolosniperdatabookusmosndabotrnoratrnoraussnte215geopnoriinrawomeperiinrablinalriinraallwet1riinraallwetriinrashponoriinrahipponriinrafiribiriinraloleshriinratarecariinra25mezeriinra91al25riinra25meze2riinra25meze11https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-m16a2-m16a4-40.jpgitem.optacticalgear-pageriteinrain69912523.95Rite in the Rain 25 Meter Zeroing Target M16A2/M16A4Rite in the Rain111Soldiers have asked for it and now you have it! Zeroing target for the M16A2/M16A4 weapon printed on heavier “Rite in the Rain” tagstock. Shoot at it, get it wet, and write on it without worries. The tough sheets will survive the range and protect your valuable data. 8 1/2” x 11” Desert Tan sheets, sold in packs of 100. (2 lbs / pack)1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-m16a2-m16a4-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-m16a2-m16a4-49.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-mil-multipurpose-100-pack-24.jpgcustom-itemoptacticalgear-pageriteinrain69913023.95Rite In The Rain 25 Multipurpose Meter Zeroing Target - True-MILRite in the Rain111ALL-WEATHER PAPER Designed to zero mutliple platforms including military Laser/Illuminators. COLOR: Tan
SHEET SIZE: 8.5" x 11"
SHEETS: 100
WEIGHT: 100# heavyweight
INK COLOR: Black
IMPRINT: Multipurpose MIL 25 Meter Zeroing Target (front), blank (back)
WEAPONS: Applies to a variety of platforms, to be used with milliradian-adjusted optics and systems FEATURES
REFERENCE: Increment and direction of adjustment for common aiming devices
DESIGN: True-MIL grid is 12.5% more accurate than current military specs, developed by US Military Marksmanship experts
MANUFACTURED: U.S.A.]]>1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-mil-multipurpose-100-pack-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-mil-multipurpose-100-pack-31.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-9126-all-weather-25-meter-zeroing-target-m4-pistol-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-9126-all-weather-25-meter-zeroing-target-m4-pistol-45.jpgcustom-itemoptacticalgear-pagetargets69912623.95Rite in the Rain 9126 All-Weather 25 Meter Zeroing Target M4/PistolRite in the Rain111 These targets are the new style Army zeroing target with Minute of Angle adjustment and designed to make it easier to zero different optics and sighting systems in one format. Short Range and Pistol Marksmanship target displayed on the front, and Graphic Training Aid/Offset Tool on back including information referencing M885A1 and M885 ammunition. Printed on waterproof heavy-duty 100# Rite in the Rain sheets, size 8 1/2" x 11". These tough sheets will survive the range! Tan sheets. Sold in packs of 100. 1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-9126-all-weather-25-meter-zeroing-target-m4-pistol-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-9126-all-weather-25-meter-zeroing-target-m4-pistol-58.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-all-weather-pen-metal-40.jpgitem.optacticalgear-pageriteinrain699716.95Rite in the Rain All Weather Pen - MetalRite in the Rain111Pencils work great on "Rite in the Rain". For those times when you need a pen, use the All-weather Pen. The ideal ball point pen for use outdoors, with its pressurized ink cartridge and permanent ink. Writes underwater and upside down, and it will write in all weather conditions, even temperatures as low as - 50 degrees F, fine point. Ink color: Black.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-all-weather-pen-metal-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-all-weather-pen-metal-49.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-dope-logbook-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-dope-logbook-45.jpgcustom-itemoptacticalgear-pageriteinrain69D7469.95Rite in the Rain DOPE LogbookRite in the Rain111Specifications: COVER
COLOR: Black
MATERIAL: Polydura, 19 gauge
REFERENCE: Wind effect chart, MIL and MOA rulers, conversion charts, imperial and metric rulers BINDING
STYLE: Wire-O
PROPERTIES: Rust-resistant
FINISH: Rounded corners ALL-WEATHER PAPER
COLOR: Gray
SHEET SIZE: 4" x 6"
PAGES: 104 pages / 52 sheets
WEIGHT: 20# Rite in the Rain
PERFORATED: No PAGE PATTERN
Pattern: D.O.P.E. Form (front), Universal (back)
INK COLOR: Dark gray
NUMBERED: No
TITLE PAGE: Yes ISBN: 978-1-60134-282-9 SIZE: 4" x 6.25" x .375"
WEIGHT: 0.21 lbs]]>1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-dope-logbook-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-dope-logbook-58.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-field-ring-binder-44.jpgitem.optacticalgear-pageriteinrain69920014.95Rite in the Rain Field Ring BinderRite in the Rain111These are the perfect companion for the tactical loose leaf sheets. Durable poly cover protects your field notes. Overall size is 5 5/8" x 7 3/4". A Tough nylon zippered cover is now available.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-field-ring-binder-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-field-ring-binder-53.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-hip-pocket-notebook-41.jpgitem.optacticalgear-pageriteinrain699465.95Rite in the Rain Hip Pocket NotebookRite in the Rain111 4" x 6" spiral bound with Universal pattern. 50 sheets. Useful reference material is also printed on the back and inside covers.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-hip-pocket-notebook-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-hip-pocket-notebook-50.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-loose-leaf-sheets-41.jpgitem.optacticalgear-pageriteinrain6998215.95Rite in the Rain Loose Leaf SheetsRite in the Rain111Loose Leaf Sheets have an oval six-hole punch to fit in a variety of binders. 4 5/8" x7". The Universal Grid sheets are great for notes and sector sketches. 100 sheets/pack. Binder not included.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-loose-leaf-sheets-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-loose-leaf-sheets-50.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-moa-multipurpose-25.jpgcustom-itemoptacticalgear-pageriteinrain69912923.95Rite In The Rain Multipurpose 25 Meter Zeroing Target - True-MOARite in the Rain111ALL-WEATHER PAPER COLOR: Tan
SHEET SIZE: 8.5" x 11"
SHEETS: 100
WEIGHT: 100# heavyweight
INK COLOR: Black
IMPRINT: Multipurpose MOA 25 Meter Zeroing Target (front), blank (back)
WEAPONS: Applies to a variety of platforms, to be used with milliradian-adjusted optics and systems FEATURES
REFERENCE: Increment and direction of adjustment for common aiming devices
DESIGN: True-MOA grid is 12.5% more accurate than current military specs, developed by US Military Marksmanship experts
MANUFACTURED: U.S.A.]]>1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-moa-multipurpose-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-25-meter-zeroing-target-true-moa-multipurpose-32.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-shirt-pocket-notebook-41.jpgitem.optacticalgear-pageriteinrain699354.95Rite in the Rain Shirt Pocket NotebookRite in the Rain1113" x 5" spiral bound with Universal pattern. 50 sheets. Universal grid ruled, useful information printed on the inside covers.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-shirt-pocket-notebook-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-shirt-pocket-notebook-50.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-field-book-44.jpgitem.optacticalgear-pageriteinrain6998016.95Rite in the Rain Tactical Field BookRite in the Rain111All-Weather Tactical Field Books are 4 5/8" x 7 1/4". Pages have the Universal page pattern. Perforated sheets with universal grid pattern. Field-Flex cover, 160 pages including 16 pages of valuable tactical reference information. A Tough nylon zippered cover is now available.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-field-book-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-field-book-53.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-memo-book-41.jpgitem.optacticalgear-pageriteinrain699649.95Rite in the Rain Tactical Memo BooksRite in the Rain1113 1/2" x 6". Pages have the Universal page pattern. Field-Flex cover, 120 pages. Pages have universal grid pattern, useful information on the inside covers.1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-memo-book-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-memo-book-50.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-reference-cards-41.jpgitem.optacticalgear-pageriteinrain699200-R11.95Rite in the Rain Tactical Reference Cards Rite in the Rain111The 4 5/8" x 7" Tactical Reference Cards are printed on sturdy Polydura sheets that fit into the Tactical Field Binders (.18 lbs/set). Card sets are available in Green or Tan and include 16 pages (8 card set) of reference material, including: · Tactical Missions Graphics · Classes of Supply · Sector Sketch Example · Evaluate a Casualty / First Aid · Attack Helicopter Capabilities · Call for Fire · Enemy Unit Symbols · Sector Sketch Preparation · Range Card Example · U.S.M.C. Troop Leading Steps · NBC-4 Report · Immediate CAS Report · 9 Line Medical Evac. Request · Friendly Unit Symbols · Standard Range Card Preparation · Troop Leading Procedures · Mortar/Artillery Capabilities · NBC-1 Report · Spot Report/Salute1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-reference-cards-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-tactical-reference-cards-50.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-work-ready-mechanical-pencil-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-work-ready-mechanical-pencil-17.jpgcustom-itemoptacticalgear-pageriteinrain69BK1516.95Rite in the Rain Work-Ready Mechanical PencilRite in the Rain111The #15 Pencil is built to be tough. From lead to eraser and everything in between, its durability makes it a worthy addition to any tool belt. Uses 1.3mm lead - one pack of 12 leads included, refills sold separately1https://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-work-ready-mechanical-pencil-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/rite-in-the-rain-work-ready-mechanical-pencil-30.jpgRite in the Rainhttps://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-fighter-t-shirt-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-fighter-t-shirt-45.jpgcustom-itemoptacticalgear-pagetshirts131TREXTS25Road Sqdn T-Rex Wing Fighter T-ShirtRoad Sqdn111 The item speaks for itself, a simply incredible design... Printed on a comfortable Gildan Softstyle 100% Cotton T-Shirt. Regular Fit.1https://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-fighter-t-shirt-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-fighter-t-shirt-58.jpgRoad Sqdnhttps://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-sticker-38.jpgcustom-itemoptacticalgear-pagestickers131TREXSK6Road Sqdn T-Rex Wing StickerRoad Sqdn111Features:
-Long-lasting printed vinyl sticker
-5" x 4.61"]]>1https://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-sticker-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/road-sqdn-t-rex-wing-sticker-47.jpgRoad Sqdnhttps://s.turbifycdn.com/aah/optacticalgear/roger-s-rangers-1789-44.jpgcustom-itemoptacticalgear-pagegearloadoutsRoger's Rangers 178911Basic Load -Musket (clean as a whistle) -Hatchet (scoured) -Sixty rounds powder and ball ROGER'S RANGERS STANDING ORDERS: 1. Don’t forget nothing. 2. Have your musket clean as a whistle, hatchet scoured, sixty rounds powder and ball, and be ready to march at a minute’s warning. 3. When you are on the march, act the way you would if you were sneaking up on a deer. See the enemy first. 4. Tell the truth about what you see and what you do. There is an army depending on us for correct information. You can lie all you please when you tell other folks about the rangers, but don’t never lie to a ranger or officer. 5. Don’t never take a chance you don’t have to. 6. When we’re on march we march single file, far enough apart so no one shot can go through two men. 7. If we strike swamps, or soft ground, we spread out abreast, so it’s hard to track us. 8. When we march, we keep moving till dark, so as to give the enemy the least possible chance at us. 9. When we camp, half the party stays awake while the other half sleeps. 10. If we take prisoners, we keep ‘em separate till we have time to examine them, so they can’t cook up a story between ‘em. 11. Don’t ever march home the same way. Take a different route so you won’t be ambushed. 12. No matter whether we travel in big parties or little ones, each party has to keep a scout 20 yards ahead, 20 yards on each flank, and 20 yards in the rear, so the main body can’t be surprised and wiped out. 13. Every night you’ll be told where to meet if surrounded by a superior force. 14. Don’t sit down to eat without posting sentries. 15. Don’t sleep beyond dawn. Dawn’s when the French and Indians attack. 16. Don’t cross a river at a regular ford. 17. If somebody’s trailing you, make a circle, come back onto your own tracks, and ambush the folks that aim to ambush you. 18. Don’t stand up when the enemy’s coming against you. Kneel down, lie down, hide behind a tree. 19. Let the enemy come till he’s almost close enough to touch. Then let him have it and jump out and finish him up with your hatchet. Source: SH 21-76, Ranger Handbook.]]>1https://s.turbifycdn.com/aah/optacticalgear/roger-s-rangers-1789-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/roger-s-rangers-1789-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-skeletonized-mag-retention-smr-system-42.jpgcustom-itemoptacticalgear-page1ssprsmrbeadssprhoexgrtcThis system can be adapted to quick-attach GRT pouches to PALS (MOLLE) webbing or Belts.1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-skeletonized-mag-retention-smr-system-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-skeletonized-mag-retention-smr-system-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-holster-extender-grt-compatible-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-holster-extender-grt-compatible-53.jpgcustom-itemoptacticalgear-pageholsters80HE-0002207.4111litogeretr1The newly designed hole pattern makes the Holster Extender compatible with Safariland, Blackhawk and G-Code holsters. With the included GRT-Belt, spacers, and screw kit, you will be able to get the standoff you need to make your preferred holster function properly. With a push of a button the Holster Extender gives the shooter three set drop positions to set their holster. (0", 1.5", 3") This distance can be critical for clearing the holster when wearing bulkier gear. Please note that selecting a color option from the drop down list corresponds to BOTH the GRT Belt Adapter as well as the Holster Extender. Black color features Black GRT Belt Mount and Grey Holster Extender. Made in the USA. GRT Belt Mount Included. ]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-holster-extender-grt-compatible-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-holster-extender-grt-compatible-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-m-ax-mount-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-m-ax-mount-52.jpgcustom-itemoptacticalgear-pageheliandac80MX002OC154.5111litosukminwhM-Ax Mount Only. Tailcap and Light Head sold separately. Mounts to the Ops-Core, Team Wendy, and Galvion Helmets For those that require a powerful helmet mounted flashlight during search operations, you will appreciate the maximum range of motion of the Multi-Axis Mount. Aim the light where you need it…done. Dubbed the M-Ax Mount, this compact assembly mounts to the Ops-Core, Team Wendy and Galvion Helmets and takes the flashlight up and above the helmet rail, nesting it in a low profile position. Features:
• Mounts to the Ops-Core, Team Wendy, and Galvion Helmets
• Positions the flashlight up and above the helmet rail
• Lightweight, low profile design
• Small assembly with multi-axis range of motion
• Compatible with all SureFire® 3V and M300 components
• Compatible with all B.E. Meyers® KIJI components (newer gen models)
• Mount body holds 1 x CR123A Battery (not included) ]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-m-ax-mount-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-m-ax-mount-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-manta-strobe-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-manta-stobe-r-42.jpgcustom-itemoptacticalgear-pageheliandac80MS-00XX219111• New stronger Hybrid Tailcap is a select mix of robust materials to optimize performance and increase reliability throughout the spectrum of an operator's environmental demands.
• Includes the Manta Strobe Webbing Adapter
• Zero overt light AD
• 100% user confidence in Infrared Mode with Vibrating feedback
• Intuitive One-handed operation
• Multiple Infrared and Overt LEDs generate an overlapping and omnidirectional light emission
• Curved base specifically for helmets
• Lightest weight and lowest profile in its power class - 2.12 oz. with battery
• Tool-less battery change out, 3V CR-123
• Downward (”Low”) facing Infrared Emitter (positive IFF for close in work with minimal glare)
• Upward (“High”) facing Infrared Emitters (multiple emitters delivering a peak IR signal for maximum distance)
• IPX8 = Manufacturer Rated – Waterproof 150’, Zero water penetration in Main Housing or Partitioned Battery Compartment
• Primary Overt LED/s are visible beyond the FAR105.19 requirement (3 Statute Miles) Made in the USA. Battery Sold Separately. THIS ITEM CAN SHIP TO APO ADDRESSES. It cannot ship international. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-manta-stobe-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-manta-stobe-r-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-navboard-fliplite-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-navboard-fliplite-18.jpgcustom-itemoptacticalgear-pageradiopouchesXXNBFL0288.8111Features:
• Offering enhanced durability and performance
• Molded with impact modified Nylon
• Case agnostic - fits smart devices up to 3.5” W x 6.75” L x 0.6875” with or without case
• Enables users to utilize their preferred case
• Adjustable friction hinge
• Silicone smart device retention straps featuring internal ribbing to prevent the straps from peeling off the user’s smart device
• Bungee lock auto-stows out of the way and does not interfere while using a smart device
• Attaches to 4 x 2 MOLLE/PALS field via two mounting straps
• Rapid donning / doffing
• Integrated belly band slots ]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-navboard-fliplite-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-navboard-fliplite-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-pull-tabs-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-pull-tabs-65.jpgcustom-itemoptacticalgear-pagemagpoup80PT-D601XX8.25111Bungees not included (made to use your current pouch bungees). Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-pull-tabs-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-pull-tabs-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-v-lite-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-v-lite-54.jpgcustom-itemoptacticalgear-pageheliandac80VL-X012V44.75111New programmable features to customized your V-Lite! The V-LiteTM is a versatile personal lighting/identification marker. A simple and intuitive alternative to chemical light sticks. One button to cycle through the preset functions, keeps it simple. Fully encapsulated to ruggedize the electronics, the flexible silicone body not only protects the good stuff inside but also conforms to curved surfaces. Mounting is made simple with the V-LiteTM sleeve, providing the operator with a Velcro-backed attachment system. Weighing in at a mere 0.8 ounces, it’s an unnoticeable addition to your helmet during routine operations and low-profile enough to reduce snag hazards during airborne operations. Use it in the field, at home or abroad; or slip it into PALS webbing. Programmable Settings: 5 settings available to allow the user to customize V-Lite functions. You can now choose constant or blink settings, multiple brightness settings, or a combination of these. Colors: Green, Red, IR Run-time: 120+ Hours (continuous)
* Run-times vary depending on frequency of use and duration of "ON" cycles
* Battery is not replaceable
Includes Plastic V-Lite sleeve with Velcro backing and Lanyard THIS ITEM CAN SHIP TO APO ADDRESSES. It cannot ship international. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-v-lite-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-v-lite-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-blocs-1-quart-canteen-nalgene-gp-pouch-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-blocs-1-quart-canteen-nalgene-gp-pouch-59.jpgitem.optacticalgear-pagewabopo77B1QCNGP3935.49S.O. Tech BLoCS 1 Quart Canteen/ Nalgene/ GP Pouch S.O. Tech111Pouch only, sorry we can't get you the grenades, mags etc... Colors: Coyote, Ranger Green, Multicam(+$5)1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-blocs-1-quart-canteen-nalgene-gp-pouch-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-blocs-1-quart-canteen-nalgene-gp-pouch-73.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-extended-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-extended-62.jpgitem.optacticalgear-pagecobamanpumeb77SGB-X155139.99S.O. Tech Go Bag ExtendedS.O. Tech111The only thing worse than getting shot out of the sky or hit by an IED is knowing that you now have to get your kit and get the hell out of the area. Our Go-Bag was designed for Helicopter crews and Humvee personnel, so that in the event of a crisis, they could grab the bag on the way out of the vehicle. It fits perfectly in the spaces that exist in a Helicopter or Humvee, which are too small for a ruck, but could be a great storage site for an E & E bag. The options for this bag are endless. The Medics fit a roll-up stretcher in it, the Spec Op shooters use it for E & E kits, and when you're not shooting and moving, it's a great Bail-Out-Bag for your car, home or gym. Concealed Carry Device Bag
The tubular design gives a civilian look and masks large devices. Extended version is 3" longer and can be used as a concealed device bag. This extended version of the Go-Bag was designed as a covert carry option for the shooters who need a device close by, while still being low profile. This is the perfect system for 17.5" devices and the upper and lower components of a similar dev ice. This is perfect for contractor work where the principal understands the need for such devices, but the situation dictates a low profile signature. The outside has two pouches where you can store and assortment of mission related items. The inside has room for a Cordura® covered foam divider, the SO TECH Go Bag Insert (SGBI), sold separately - for a broken down device, or any other kit your mission dictates. NOTE: Coyote color is now the same as Tan 499, a slightly more gray color that is made to better blend with Multicam.]]>1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-extended-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-extended-75.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-61.jpgitem.optacticalgear-pagecobamanpumeb77SGB-NP160144.99S.O. Tech Go-BagS.O. Tech111- A main compartment with double linked zippers (dimensions: 20' x 8' x 8')
- Internal hydration reservoir slot (canteen not included)
- 4 zippered flat side pockets for small items or documents
- 3 larger zippered external pockets (dimensions: 5.5' x 5' x 3')
- MOLLE/PALS attachment webbing on both sides
- Padded contour single shoulder strap with quick-ditch side locking buckle
- Shoulder attachment points and carrying handles on each end
- Made in the U.S out of military grade cordura cloth down to the webbing and fasteners to the demanding specifications of SO Tech's high standard of quality. NOTE: Coyote color is now Coyote Brown / Tan 498 (MARPAT Brown).]]>1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-go-bag-74.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-go-bag-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-go-bag-73.jpgitem.optacticalgear-pagecobamanpumeb77MGB130119.99S.O. Tech Mission Go Bag A1S.O. Tech111• Classic go bag for all occasions
• Shoulder strap included
• 2 rows of MOLLE across front
• Compression straps on both sides
• Front Velcro for morale patch
• 2 compartments
• 4 large interior pockets
• Side flaps can tuck away inside for briefcase carry
• Non Slip material on back
• Material: 500D Cordura® Nylon
• Dimensions: 12.5"x 14"x 3"
• 1.4lbs
• Lifetime Warranty
• Mission Go Bag Front Flap (sold separately) available for additional organization options
• Made in the USA NOTE: Coyote color is now the same as Tan 499, a slightly more gray color that is made to better blend with Multicam. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-go-bag-82.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-go-bag-83.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-marker-panel-orange-39.jpgitem.optacticalgear-pagesukiandtoMMP-O5.954.95S.O. Tech Mission Marker Panel - OrangeS.O. Tech111This is NOT a VS-17 Panel. 2 ft x 1 ft blaze orange signaling panel. Great for survival, evacuation, escape/evade kits. Made in the USA Highly visible from long distances. Extremely useful in signalling aircraft, helicopters, or any type of search and rescue units in rugged terrain. Dimensions: 2' x 1'1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-marker-panel-orange-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-mission-marker-panel-orange-49.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/so-tech-recce-vest-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-recce-vest-37.jpgcustom-itemoptacticalgear-pagevests91RECCE-XX130119.99S.O. Tech Recce VestS.O. Tech111• 6 Fully adjustable straps
• Mesh support straps
• 5 Compartments (4 front pockets, 1 Rear pack)
• Dual closure options for smaller front pockets
• Lightweight design
• Elastic strap retention Dimensions:
• Rear Pack- 10" x 12" x 4.5"
• Large Front Pockets- 9.5" x 6" x 2.5"
• Smaller Front Pockets- 5" x 4" x 1.5" Material: 500D Cordura Nylon®, Elastic, Polymer Buckles, Heavy webbing, Made in the USA]]>1https://s.turbifycdn.com/aah/optacticalgear/so-tech-recce-vest-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-recce-vest-47.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-viper-flat-ifak-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-40.jpgitem.optacticalgear-pageinmedpoipo77VFIFAK9585.49S.O. Tech VIPER Flat IFAK - A1S.O. Tech111• Accommodates SOF-IFAK Medical Contents
• Ambidextrous deployment
• Flex-Tab MOLLE attachment system for attaching to MOLLE/PALS Webbing (Patented)
• Flat design for ultra-thin profile and minimal weight
• Folding and overlapping flaps provide maximum utility and versatility
• Quick closure for movement with cinch strap
• Cinch strap can allow for IFAK to be hung around neck for hands free use
• Approximately same thickness as standard plate carrier for low profile
• When worn on lower back provides lumbar support
• Rides snug in case and will not dispense without deliberate side force by operator
• Front 2 x 2 Velcro® field for cross patch
• Overall Dimensions (empty): 8" x 6.5" x 1"
• Material: 500D Cordura® Nylon
• Lifetime Warranty
• Made in the USA, Berry compliant Medical contents not included]]>1https://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-47.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-basic-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-basic-71.jpgcustom-itemoptacticalgear-pageinmedpoipo91VFIFAK-B-XXX8879.99S.O. Tech Viper Flat IFAK - A1 LES.O. Tech111• Slimmer more compact than the full size Viper Flat IFAK
• Ambidextrous deployment
• Flex-Tab MOLLE attachment system (Patented)
• Now compatible with duty / riggers belts carry
• Flat design for ultra-thin profile and minimal weight
• Folding and overlapping flaps provide maximum utility and versatility
• Quick closure for movement with cinch strap
• Cinch strap can allow for IFAK to be hung around neck for hands free use
• When worn on lower back provides lumbar support
• Rides snug and will not dispense without deliberate side force by operator
• Approximately same thickness as standard plate carrier for low profile
• Front 2 x 2 Velcro® field for cross patch
• Overall Dimensions (empty): 7.5" x 7" x 1"
• Material: 500D Cordura® Nylon
• Lifetime Warranty
• Made in the USA, Berry compliant]]>1https://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-basic-80.jpghttps://s.turbifycdn.com/aah/optacticalgear/so-tech-viper-flat-ifak-basic-81.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-arvn-pack-redux-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-arvn-pack-redux-44.jpgcustom-itemoptacticalgear-page72hourpacks77IRP-ARVN220S.O.Tech ARVN Pack ReduxS.O.Tech111• Updated 500D Nylon Cordura vs canvas
• Snap closure front 2 pockets for easier and faster access
• Hidden HDPE insert with foam backer for extra comfort
• Updated frame, from steel to modern laser cut Tegris
• Repositioned bottom shoulder strap ring to the side for extra comfort ]]>1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-arvn-pack-redux-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-arvn-pack-redux-58.jpgS.O.Techhttps://s.turbifycdn.com/aah/optacticalgear/safariland-6360-universal-ride-belt-loop-with-qls-22-receiver-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6360-universal-ride-belt-loop-with-qls-22-receiver-38.jpgcustom-itemoptacticalgear-pagesahoandac436070UBL-55-MS225039.99Safariland 6070 Mid-Ride Universal Ride Belt Loop with QLS 22 ReceiverSafariland111litocolegstThis item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. This Universal Mid Ride Belt Loop includes a QLS 22 Receiver to attach to a QLS 19 Fork. It is constructed from polymer materials and can be used by both right and left handed shooters. Designed to work in conjunction with the Safariland 6354DO ALS Optic Tactical Holster, sold separately. Universal Belt Loop features 2.25 inch wide belt slots. Features a small rectangular cut at the top for using a zip-tie to secure tighter against 1.75 or 1.5 inch width belts as needed.]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-6360-universal-ride-belt-loop-with-qls-22-receiver-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6360-universal-ride-belt-loop-with-qls-22-receiver-48.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-6075-low-ride-universal-ride-belt-loop-with-qls-22-receiver-37.jpgcustom-itemoptacticalgear-pagesahoandac436075UBL5039.99Safariland 6075 Low-Ride Universal Ride Belt Loop with QLS 22 ReceiverSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. This Universal Low-Ride Belt Loop provides 1.5 inches of drop down length and includes a QLS 22 Receiver to attach to a QLS 19 Fork. It is constructed from polymer materials and can be used by both right and left handed shooters. Designed to work in conjunction with the Safariland 6354DO ALS Optic Tactical Holster, sold separately. Universal Belt Loop features 2 inch wide belt slots. Features a small rectangular cut at the top for using a zip-tie to secure tighter against 1.75 or 1.5 inch width belts as needed. ]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-6075-low-ride-universal-ride-belt-loop-with-qls-22-receiver-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6075-low-ride-universal-ride-belt-loop-with-qls-22-receiver-46.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-6354do-available-soon-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6354do-31.jpgcustom-itemoptacticalgear-pagesahoandac436354DO-83-701-MS19182.5154.99Safariland 6354DO ALS Red Dot Holster with QLS 19 Fork Safariland111lito60miunriThis item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. NOTE: Depending on where your Micro Red Dot Sight is mounted to the slide of the pistol, you may be required to trim material from the holster in order to ensure proper fit and retention of the pistol. This usually applies if you have rear ironsight behind the red dot. This includes "Roland Special" configurations. The Safariland® 6354DO ALS® Red Dot Holster w/Tactical Lights features a Cordura® wrap that both limits the infrared signature and provides a unique finish. This holster has a compact profile for minimal interference with other equipment - perfect in a tactical environment. This Safariland 6354DO ALS® Optic Tactical Holster has a Safariland QLS 19 Locking Fork attached for use with a QLS22/22L Receiver Plate (sold separately). ALS retention is an open-top design that is drawn with a natural thumb only operation; no fingers in trigger guard area. This model can also be used in conjunction with the model 6006 ALS Guard for increased security. Safariland 6354DO ALS Optic Tactical Holster Features:
• ALS® (Automatic Locking System) secures weapon once holstered
• Simple straight up draw once release is deactivated
• Open-top design without SLS for quick retrieval of weapon
• For use with red dot optic-equipped weapons
• Cordura® nylon-wrap finish reduces Infrared (IR) Signature
• SafariLaminate™ thermal-molded construction protects handgun and sights
• QLS 19 Locking Fork (Requires QLS 22 Receiver Plate to mount to belts, sold separately)
• Suede lined to protect handgun's finish
• Cordura Colors: MultiCam® and Coyote Brown
• Available for Glock 19, 17, 22, 34, 35 weapons with tactical lights and the Glock 19 "Roland Special" Models: also compatible with Gen 5 Glock pistols EXCEPT the Glock 22/23 Gen 5
Weapon Light Models add $13.00
• Model 83: Glock 17, 22 (will Fit Glock 19 as well)
• Model 283: Glock 19, 23
• Model 2832: Glock 19, 19C, 23, 23C, w/ TLR-1, SureFire X200, X300, X300U; Inforce APL Gen 3, Insight XTI Procyon (NOTE: Gen 5 Glock 23 will NOT fit due to thicker slide width)
• Model 832: Glock 17, 22 w/ TLR-1 OR SureFire X200 X300, X300U (NOTE: Gen 5 Glock 22 will NOT fit due to thicker slide width)
• Model 6832: Glock 34, 35 w/ TLR-1 OR SureFire X200, X300, X300U, Will fit Roland Special Glock 19 with KKM Barrel/Compensator and SureFire X300 Ultra NOTE: Depending on where your Micro Red Dot Sight is mounted to the slide of the pistol, you may be required to trim material from the holster in order to ensure proper fit and retention of the pistol. This usually applies if you have rear ironsight behind the red dot. This is includes "Roland Special" configurations.]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-6354do-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6354do-38.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-6378-available-soon-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6378-31.jpgcustom-itemoptacticalgear-pagesahoandac1256378149.25104.99Safariland 6378USN ALS Low Signature HolsterSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The Model 6378USN features the Automatic Locking System (ALS®). Once the weapon is holstered, it locks into place, providing an extra measure of security from the standard open top holsters. A simple straight draw is possible once the ALS® is deactivated by your thumb while obtaining shooting grip. IDPA approved. The Model 6378USN features an all new injection molded paddle design that is highly concealable and rides close to the body with a slightly forward weapon cant. Additionally it features suede lining to help protect the gun's sights and finish. Its SafariLaminate™ structure with wraparound design provides the strongest design combination. Holster includes both Belt Slide and Paddle mounting options. Holster will also mount to the Safariland Mid-Ride Universal Belt Loop (sold separately). Features
-ALS® (Automatic Locking System) secures weapon once holstered; simple straight up draw once release is deactivated
-Reduces Infrared (IR) Signature Compact profile for minimal interference with other equipment
-ALS® retention is an open-top design that is drawn with a natural thumb only operation; no fingers in trigger guard area
-Genuine Safarilaminate™ thermal-molded construction with suede lining to help protect the guns finish
-Includes both Belt Slide and also Paddle mounting options OPT only sells specific models and colors of the 6378USN. Models:

(283) Glock 19, 19C, 23, 23C, 25, 32, 26, 27, 33, 28, 36 (2832) Glock 19, 19C, 23, 23C, w/ TLR-1, SF X200, X300, X300U; Inforce APL Gen 3, Inforce APL Compact Glock, Insight XTI Procyon This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-6378-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6378-38.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-model-6390-als-mid-ride-level-i-retention-duty-holster-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-model-6390-als-mid-ride-level-i-retention-duty-holster-45.jpgcustom-itemoptacticalgear-pagesahoandac43390151.5122Safariland 6390 ALS Mid-Ride Level I Retention Duty HolsterSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. This model features the STX Tactical finish, a thermoplastic alloy thermoformed around the firearm at close tolerances for an exact fit. This hard shell finish is renowned for its incredible strength and abrasion resistance. Exceptionally easy to clean and maintain. The Safariland® 6390 holster is a popular mid-ride duty holster with the added security of ALS® (Automatic Locking System), which provides Level I Retention™ without inhibiting the draw stroke. The ALS engages immediately upon holstering, but releases quickly and easily with a swipe of the thumb during the draw. Constructed from durable SafariLaminate™, the Model 6390 holster has a suede lining to protect your firearm’s finish. The mid-ride design carries comfortably and includes a removable Hood Guard to protect the thumb release. A variety of textures and finishes make it easy to match the 6390 holster to your duty belt, and adding the ALS Guard allows the user to upgrade the holster to Level II Retention. ALS "Chop Block" Guard is removable if not desired. Designed to mount on 2 inch duty belts. Works perfect with the Blue Force Gear, Velocity Systems, HSGI, Viking Tactics, and ATS War Belts. OPT only sells specific models and colors of the 6390. We may be able to do custom orders, please email us with your needs and we will get back to you about availability. For ordering purposes: SF=SureFire
CL=Classic
IT=Insight
SL=Streamlight Please note: The M3 and M6 are not the same as the M3X or M6X, do not assume cross compatibility of these lights. Modifying holsters with a heat gun works well, but will void manufacturer's warranty. Weapon Model Types: (83) Glock 17, 17C, 22, 22C, 31 (283) Glock 19, 19C, 23, 23C, 25, 32, 26, 27, 33, 28, 36 (832) Glock (All Gens) 17, 22 w/ ITI/SL M3, TLR-1, TLR1HL, SF X200, X300, X300U (+$13.50) (2832) Glock (All Gens) 19, 19C, 23, 23C, 25, 32, 32C w/ SF X200, X300, X300U, TLR-1, TLR-1 HL, M3, Insight XTI Procyon (+$13.50) (7742) Sig Sauer P220R, P226R, DASA/ DAK w/ ITI M3, TLR-1, TLR-1HL, SF X200, X300, X300U, Insight XTI Procyon, RETAINS WEAPON WITH OR WITHOUT LIGHT (+$13.50) (4502) Sig Sauer P320, P250 (9/40), w/ ITI M3, TLR-1, TLR-1HL, SF X200, X300, X300U (+$13.50) (450) Sig Sauer P320 P320 (9mm, 40) This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-model-6390-als-mid-ride-level-i-retention-duty-holster-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-model-6390-als-mid-ride-level-i-retention-duty-holster-55.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-6395rds-als-low-ride-duty-holster-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6395rds-als-low-ride-duty-holster-53.jpgcustom-itemoptacticalgear-pagesahoandac436390RDS188156.99Safariland 6390RDS ALS Red Dot Mid-Ride Duty HolsterSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The 6390RDS holster is specifically designed for firearms with red dot sights mounted to them.This open top holster features the Automatic Locking System (ALS®), an internal locking device that retains the weapon in all directions with no straps or snaps to manipulate. Once the weapon is holstered, it locks into place. The holster is completely operable with the thumb and once the ALS® is deactivated a simple straight up draw is used. Features a low-ride belt loop that rides close to the body, and has a suede lining to protect the gun's sights and finish. Compatible Optics: Other models/brands may work, but have not been tested
• Trijicon RMR
• Deltapoint Series
• JP JPoint
• Aimpoint ACRO (Clam Shell Cover may not close all the way; it can be removed if needed)
• Vortex Viper
• Burris Fastfire Features:
• ALS® (Automatic Locking System) secures weapon once holstered
• ALS Chop Block Guard to prevent unauthorized access to the ALS. The Guard can be removed if not desired
• Clam Shell cover designed to protect the red dot from water and debris. Cover pops open during the draw. Cover can be removed if not desired.
• SafariLaminate™ thermal-molded construction protects handgun and sights
• 6070 UBL Mid Ride Mount clears body armor and gear for an easier draw
• Suede lined to protect handgun's finish Models: Glock options compatible with Gen 1-5 Glock pistols EXCEPT the Glock 22/23 Gen 5
• Model 2832: Glock 19, 19C, 23, 23C, w/ TLR-1, TLR-1HL, SureFire X200, X300, X300U; Inforce APL Gen 3, Insight XTI Procyon (NOTE: Gen 5 Glock 23 will NOT fit due to thicker slide width)
• Model 832: Glock 17, 22 w/ TLR-1, TLR-1HL, SureFire X200, X300, X300U, X300V (NOTE: Gen 5 Glock 22 will NOT fit due to thicker slide width)
• Model 6832: Glock 34, 35 w/ TLR-1, TLR-1HL, SureFire X200, X300, X300U, X300V. Will fit "Roland Special" Glock 19 with KKM Barrel/Compensator and SureFire X300 Ultra weapon light
• Model 4502: Sig P320, P320RX w/ TLR-1, TLR-1HL, SureFire X300U, X300V
• Model 1582: STI Staccato P 4.4-inch w/ TLR-1, TLR-1HL, SureFire X300U, X300V (Can Fit Staccato C2 DUO with Light Attached, TEST BEFORE USE ON DUTY) Finish Options:
• STX Tactical finish: Dark Earth or Black models; hard shell finish that's easy to clean and maintain.
• Cordura finish: (Add $51.00) Multicam, Coyote Brown, Ranger Green, and Black models; reduces Infrared (IR) Signature. Note from OPT: We are currently stocking both the newer and older generation of this holster - the change being a slight change to the ALS lever, with the same functionality. If you are using an OT Defense Nub Mod, or are purchasing one in conjunction with the holster, leave a note on your order comments so we can ensure you have the proper Nub Mod for the holster]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-6395rds-als-low-ride-duty-holster-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-6395rds-als-low-ride-duty-holster-65.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-cubl-cantable-universal-belt-loop-32.jpgcustom-itemoptacticalgear-pagesahoandac436070CUBL26.520.99Safariland CUBL Cantable Universal Belt LoopSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The Cantable Belt Loop (CUBL) allows the user to choose the cant position on their holster based on their preference. Extremely adaptable, the CUBL integrates with Safariland UBL products and 3-hole patterned holsters. Features:
• Allows for forward and rearward cant including straight drop with most compatible duty holsters
• Mid-Ride Height
• For use with Safariland 3-hole patterned duty holster
• Passes Retention pull test
• QLS compatible
•2-inch belt loop width for better fit on 1.75-inch rigger belts / gun belts Color: black]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-cubl-cantable-universal-belt-loop-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-cubl-cantable-universal-belt-loop-41.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-holsters-and-accessories-76.jpgitem.optacticalgear-pageholstersSafariland Holsters and Accessories1sa63sa63alsloduh1safariland6378samo63alsmiltrnocomohoadtrnocomhalegel10ritqcahootdealsnubmootdelonubmodotdeslsnubmosacucaunbelosavuvebelosa63un2midrisa60lounribesaqls19duholsaqlqudureplsasilegstsaublmiunbelssprhoexgrtc1https://s.turbifycdn.com/aah/optacticalgear/safariland-holsters-and-accessories-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-holsters-and-accessories-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-qls-19-duty-holster-locking-fork-25.jpgcustom-itemoptacticalgear-pagesahoandac436004-1918.514.49Safariland QLS 19 Duty Locking ForkSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The QLS 19 Locking Fork mounts directly to the back of any Safariland® 2-hole pattern pouch or 3-hole pattern holster. The combination can then be connected to either the QLS 22 or QLS 22L Receiver Plate. Use with either of these receiver plates allows for quick transfer of holster between attachment points such as a belt loop, tactical leg shroud or other stable mounting platform. The QLS fork and plate combination passes the Level I Retention™ pull test. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-qls-19-duty-holster-locking-fork-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-qls-19-duty-holster-locking-fork-32.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-qls22-quick-duty-receiver-plate-25.jpgcustom-itemoptacticalgear-pagesahoandac436004-2223.518.49Safariland QLS 22 Quick Duty Receiver PlateSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The QLS 22 Receiver Plate is designed to accept the QLS 19 Locking Fork. Constructed of injection molded nylon, it screws onto mounting platforms such as a tactical leg shroud, belt loop, wall or any other stable location. The system (fork and plate) works with any Safariland® 2-hole pattern pouch or 3-hole pattern holster. Rearrange gear quickly and easily without the use of tools. The QLS fork and plate combination passes the Level I Retention™ pull test. QLS 19 Locking Fork sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-qls22-quick-duty-receiver-plate-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-qls22-quick-duty-receiver-plate-32.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-single-leg-strap-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-single-leg-strap-47.jpgcustom-itemoptacticalgear-pagesahoandac1253004-12822.4Safariland Single Leg StrapSafariland111lito60ublmimThis item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Single Leg Strap for use with the Safariland Universal Belt Loop (UBL) Mount to stabilize the holster and prevent torque when drawing the pistol. This is the same strap found on Safariland Leg Shrouds. Leg Strap only, accessories sold separately. ]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-single-leg-strap-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-single-leg-strap-60.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-ubl-mid-ride-universal-belt-loop-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-ubl-mid-ride-universal-belt-loop-47.jpgcustom-itemoptacticalgear-pagesahoandac436070UBL26.520.99Safariland UBL Mid-Ride Universal Belt LoopSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The 6070UBL Universal Belt Loop is contoured and angled to prevent pinching or pressure along the hip bone, locks onto the duty belt with belt slot design, and is compatible with any Safariland holster with the 3-hole pattern. This mount can be used in conjunction with Safariland 6354DO and 6378USN Model Holsters. 2 inch wide belt slots. Features a small rectangular cut at the top for using a zip-tie to secure tighter against 1.75 or 1.5 inch width belts as needed, or to use in conjunction with the P-2200 Belt Loop Insert. Includes screws and wrench for mounting.]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-ubl-mid-ride-universal-belt-loop-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-ubl-mid-ride-universal-belt-loop-60.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/safariland-vubl-vertical-belt-loop-32.jpgcustom-itemoptacticalgear-pagesahoandac43VUBL51.539.99Safariland VUBL Vertical Belt LoopSafariland111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. For added comfort and the ability to easily position a holster based on preference, Safariland is introducing the new Vertical Universal Belt Loop (VUBL) with a quick 3-position height adjustment. Compatible with any Safariland 3-hole patterned duty holster, the VUBL allows the user to quickly raise or lower their holster without any tools required. With the VUBL, a user can comfortably position their holster to sit in a Low-ride, Mid-ride or Hi-ride holster height position and will not pinch or add pressure to the hip bone. The VUBL passes the Retention™ pull test and locks onto any duty belt with a belt slot design. Features:
• For use with Safariland 3-hole patterned holsters
• Passes Retention pull test
• Quick 3-position height adjustment
• Adjustable for Cant/Angle of the Holster
• Fits belt width up to 2-inches]]>1https://s.turbifycdn.com/aah/optacticalgear/safariland-vubl-vertical-belt-loop-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/safariland-vubl-vertical-belt-loop-41.jpgSafarilandhttps://s.turbifycdn.com/aah/optacticalgear/salomon-footwear-143.jpgcustom-itemoptacticalgear-pagefootwearSalomon Footwear1saxafomidgtxsaxafomid20m2saspas2saspas2gtxsaxulfomidgtsaspcr6fosaxafogtxlowsaquprfogosaqu4dfosafoguar67cosaurjuulbo1https://s.turbifycdn.com/aah/optacticalgear/salomon-footwear-141.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-footwear-142.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-quest-4d-forces-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-quest-4d-forces-73.jpgcustom-itemoptacticalgear-pageassaultboots68381595259.95Salomon Quest 4D GTX Forces 2 ENSalomon111sizechart32• Weight: approx 665g / 23.5 oz (size dependent)
• Midsole Height: 29mm/17mm (12mm drop) Features:
• Anti-debris Mesh
• Full Grain Leather
• Medial protective pad
• High-cut profile for increased ankle support, stability and protection
• Gusseted Tongue: Material bridge connects tongue to the upper eliminating debris from entering the shoe.
• An abrasion resistant lining that allows for excellent breathability and quick drying.
• ISO 20344:2011: Puncture-resistant material added to the outsole prevents sharp objects from penetrating the bottom of the shoe.
• ISO 2419:2012: 2.0mm thick leather for increased durability.
• GORE-TEX® performance comfort footwear keeps your feet dry -from the outside as well as from the inside.
• Salomon's Contagrip® outsoles delivering optimal traction on varied surfaces
• Protective rubber heel cap
• Mud guard protective material all around the base of the shoe
• 4D advanced chassis for foot control and protection with active comfort
• Non-reflective materials
• breathable GORE-TEX water proofing THE CHOICE OF US ARMY SPECIAL OPERATIONS FORCES! Size Chart: See below for Link. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/salomon-quest-4d-forces-82.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-quest-4d-forces-83.jpgSalomonhttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-47.jpgcustom-itemoptacticalgear-pagesafo68L41591500159.99Salomon Speed Assault 2Salomon111• With lightweight, quick-drying materials and a welded construction, this shoe won’t weigh you down or stay wet for long. All-terrain grip
• Packed with strategic chevron lugs, the durable Contagrip® outsole ups the traction on any terrain. Ankle support
• The protective mid cut wraps the ankle for extra support and stability when moving fast in loose terrain. Mud Contagrip®
• Built for maximum grip on loose, soft, rugged, and uneven surfaces, Mud Contagrip® uses deep, sharp lugs made from a compound that focuses on adhesion. Welded upper
• Stitch-free upper construction provides a smooth, glove-like, fit and feel. Quicklace
• Minimalistic and strong lace for one-pull tightening. Easy-on, easy-off. Chevron lugs
• Lug design with deep penetration and multi-directional grip, improving traction on soft surfaces like mud or loose dirt. EnergyCell
• A high performance EVA foam that provides shock attenuation. Anti-debris Mesh
• Tight mesh that prevents debris from being trapped between your foot and the footbed. Lycra®
• Stretch material provides a secure, comfortable fit. Non-reflective materials
• Built to be discrete and non-reflective for Tactical use. Ripstop fabric
• Woven fabrics, often made of nylon, with reinforcement to resist tearing, ripping and abrasion. Single layer Mesh
• A single layer of Mesh, close to the foot, for maximum feel. Textile lining
• A soft, breathable lining for extreme comfort. Gusseted tongue
• The tongue is connected to the upper on both sides, preventing debris from entering the shoe, and keeping the tongue centered. Lace pocket
• Provides easy storage for the Quicklace™ lacing system. Soft collar construction
• A soft collar improves comfort and creates a more ergonomic feel. Protective mudguard
• A wrap of leather, synthetic or rubber around the base of the foot that protects the lateral and medial sides of the foot. Molded OrthoLite® sockliner
• Molded to match the contours of your foot, this OrthoLite® insole provides superior cushioning, breathability and durability, to upgrade the comfort and performance of your shoe. Specs:
• Upper: Textile / Synthetic
• Drop: 6.5 in mm
• Heel stack height: 26.9 mm
• Forefoot stack height: 20.4 mm
• Weight: 320 g This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-60.jpgSalomonhttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-gtx-13.jpgcustom-itemoptacticalgear-pagesafo68L47440300180Salomon Speed Assault 2 - GTXSalomon111• With lightweight, quick-drying materials and a waterproof construction, this shoe won't weigh you down or get wet inside. ALL TERRAIN GRIP
• Packed with strategic chevron lugs, the durable Contragrip outsole ups the traction on any terrain. ANKLE SUPPORT
• The protective mid wrap cuts the ankle for extra support and stability when moving fast in loose terrain.
• Weight: 11.64 oz (330 g)
• Lacing system: Quicklace
• Waterproofness: GORE-TEX
• Lining: Textile
• Inlay sole: Textile
• Outsole: Rubber
• Upper: Textile / Synthetic]]>1https://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-gtx-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-assault-2-gtx-21.jpgSalomonhttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-cross-6-forces-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-cross-6-forces-47.jpgcustom-itemoptacticalgear-pagesafo68L47161200144.95Salomon Speed Cross 6 ForcesSalomon111Grip
An updated outsole means these Speedcross shed the mud quicker and deliver an even better grip on wet surfaces. Fit
Featuring Sensifit construction for precise, optimal foothold, and classic Speedcross comfort. Comfort
If it isn’t broke, don’t mess with it. Featuring the same level of classic, reassuring Speedcross comfort, with an EnergyCell+ midsole compound and welded, foot-hugging upper
Features OUTSOLE: Mud Contagrip®
Built for maximum grip on loose, soft, rugged, and uneven surfaces, Mud Contagrip® uses deep, sharp lugs made from a compound that focuses on adhesion. MIDSOLE: EnergyCell™+
EnergyCell™+ is a high-rebound midsole compound that provides exceptional energy return along with substantial cushioning and durability. SUSTAINABILITY: Recycled material
Materials made from recycled products such as PET bottles or material waste UPPER MATERIAL: Anti-debris Mesh
Tight mesh that prevents debris from being trapped between your foot and the footbed. UPPER MATERIAL: Ripstop fabric
Woven fabrics, often made of nylon, with reinforcement to resist tearing, ripping and abrasion. LACING SYSTEM: Quicklace™
Minimalistic and strong lace for one-pull tightening. Easy-on, easy-off. Details
Drop: 10 in mm
Heel stack height: 32 mm
Forefoot stack height: 22 mm
Weight: 262 g (9.24 ounces)
Waterproofness: None This Item is Excluded from Limited Sale Coupon Codes ]]>1https://s.turbifycdn.com/aah/optacticalgear/salomon-speed-cross-6-forces-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-speed-cross-6-forces-60.jpgSalomonhttps://s.turbifycdn.com/aah/optacticalgear/salomon-x-ultra-forces-mid-gtx-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-x-ultra-forces-mid-gtx-17.jpgcustom-itemoptacticalgear-pagesafo68L47194900189.95Salomon X Ultra Forces Mid GTXSalomon111sizechart5Features:
Agility: Drawing on our trail-running expertise, this shoe feels light and agile, even on unpredictable terrain. Stability: The Advanced Chassis™ targets articulations on the outer foot to optimize stability without limiting mobility. All-Terrain Grip: An All-Terrain Contagrip® outsole grabs the ground, even when wet or slippery, providing excellent control. CHASSIS: Advanced Chassis™ is a molded insert embedded in the outsole. Providing strong lateral support and reassuring protection, it also delivers optimal mobility and flexibility. UPPER CONSTRUCTION: Active Support; These mobile wings help hold the foot in place and accompany its movement, adapting to its shape and volume. OUTSOLE: Chevron lugs; Lug design with deep penetration and multi-directional grip, improving traction on soft surfaces like mud or loose dirt. LACING SYSTEM: Quicklace™; Minimalistic and strong lace for one-pull tightening. Easy-on, easy-off. MEMBRANE: GORE-TEX keeps your feet dry -from the outside as well as from the inside. Inlay sole: Textile Lining: Textile Outsole: Rubber Upper: Leather / Synthetic Drop: 11 in mm Heel stack height: 32 mm Forefoot stack height: 21 mm Weight: 420 g Lacing system: Regular laces Waterproofness: GORE-TEX See below for link to Size Chart. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/salomon-x-ultra-forces-mid-gtx-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-x-ultra-forces-mid-gtx-30.jpgSalomonhttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-gtx-low-cut-2020-model-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-gtx-low-cut-2020-model-45.jpgcustom-itemoptacticalgear-pageassaultboots68L409216179.95Salomon XA FORCES GTX Low CutSalomon111sizechart13New Model is now TAA Compliant and features Puncture and Oil/Slip Resistant soles, with Anti-static to meet ISO 20347:2012 Standards. The Salomon XA FORCES GTX is a lightweight, all conditions tactical shoe for moving fast on duty or on mission. Based on Salomon's iconic XA PRO 3D, this Forces model is more durable in every way, and has a beefier outsole. Features:
• Weight: 477g | 16,8 oz (SIZE US 9)
• Stack Height: 21mm/11mm (10mm drop)
• Contagrip MD Outsole Construction
• Midsole: Dual density midsole - EnergyCell
• Chassis: 3D Advanced Chassis
• Upper Material: Anti-debris Mesh, Non-reflective materials. PU coated leather, Single layer Mesh, Waterproof materials
• Upper Construction: Gusseted tongue, Lace pocket, Protective toecap, SensiFit
• Lining Material: Mesh and textile lining
• GORE-TEX breathable water-proof liner
• Quicklace System See below for link to Size Chart. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-gtx-low-cut-2020-model-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-gtx-low-cut-2020-model-55.jpgSalomonhttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-2020-model-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-2020-model-40.jpgcustom-itemoptacticalgear-pageassaultboots68L40978200199.95Salomon XA Forces Mid - Regular and Wide SizesSalomon111Now TAA Compliant and features Puncture and Oil/Slip Resistant soles, with Anti-static to meet ISO 20347:2012 Standards. Salomon XA Forces Mid is a breathable and lightweight duty boot designed for moving fast on target. Based on Salomon's iconic XA PRO 3D MID, this model is more durable and effective than its predecessor with improved materials and features. Improvements:
• Stronger upper materials
• Wider toe box
• Triple and double needle stitching for greater durability
• Revised instep for fast roping and climbing
• Single-layer construction reducing the overlapping of material
• More durable outsole with an extra layer and additional rubber with deeper lugs Features:
• Breathable Anti-debris mesh
• Non-reflective materials
• Stealth design & printings
• Highly abrasion resistant textile
• Protective rubber toe cap
• Mud guard
• Medial protective pad
• Quick Lace one-pull tightening. Easy-on, easy-off
• Heel foam
• Lace pocket "Garage"
• Gusseted tongue
• OrthoLite footbed See below for link to Size Chart. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-2020-model-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-2020-model-50.jpgSalomonhttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-gtx-2020-model-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-gtx-2020-model-57.jpgcustom-itemoptacticalgear-pageassaultboots68L40921800219.95Salomon XA Forces Mid GTX - Regular and Wide SizesSalomon111Now TAA Compliant and features Puncture and Oil/Slip Resistant soles, with Anti-static to meet ISO 20347:2012 Standards. Salomon XA GTX Forces Mid GTX is a GORE-TEX Waterproof and lightweight duty boot designed for moving fast on target. Based on Salomon's iconic XA PRO 3D MID, this model is more durable and effective than its predecessor with improved materials and features. Improvements:
• Stronger upper materials
• Wider toe box
• Triple and double needle stitching for greater durability
• Revised instep for fast roping and climbing
• Single-layer construction reducing the overlapping of material
• More durable outsole with an extra layer and additional rubber with deeper lugs Features:
• Waterproof and breathable GORE-TEX membrane
• Anti-debris mesh
• Non-reflective materials
• Stealth design & printings
• Highly abrasion resistant textile
• Protective rubber toe cap
• Mud guard
• Medial protective pad
• Quick Lace one-pull tightening. Easy-on, easy-off
• Heel foam
• Lace pocket "Garage"
• Gusseted tongue
• OrthoLite footbed See below for link to Size Chart. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-gtx-2020-model-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/salomon-xa-forces-mid-gtx-2020-model-67.jpgSalomonhttps://s.turbifycdn.com/aah/optacticalgear/sawyer-micro-squeeze-water-filtration-system-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/sawyer-micro-squeeze-water-filtration-system-76.jpgcustom-itemoptacticalgear-pagenalgene131SP212932.9529.95Sawyer Micro Squeeze Water Filtration SystemSawyer Products111Bottom Line Up Front: The advantage of this model filter is you can squeeze water through it faster than gravity models. Enjoy clean and safe drinking water wherever you roam with the ultra-compact, lightweight, reusable Sawyer Micro Squeeze Water Filtration System — from backcountry adventures to everyday office work and from domestic and international travel to emergency prepping. With a total field weight of 2 ounces, this tiny filter fits in the palm of your hand. While small in size, the powerful Micro Squeeze removes 99.99999% of bacteria (salmonella, cholera, and E. coli) and 99.9999% of protozoa (cryptosporidium and giardia) — exceeding EPA recommendations for removal rates. The Micro Squeeze also filters out 100% of microplastics. Attach the Micro Squeeze to the included drinking pouch, use the included straw to drink directly from your water source, connect it to hydration pack tubing (sold separately), or screw it onto standard disposable bottles (28mm thread). Made of a strong, soft material, the included 32-ounce (1-liter) Squeeze Pouch features a redesigned gusset for easy filling and stability. Perfect for adding to your disaster preparedness kit to ensure access to clean water during emergencies, the Micro Squeeze is great for removing harmful pathogens from residential water when boil alerts are issued. The Micro Squeeze 0.1 micron absolute filter houses a cluster of micro-fibrous tubes which use similar technology found in medical dialysis. As water passes through the side walls of the tubes, harmful bacteria and protozoa are trapped on the outer walls so you can be confident your water is safe to drink. The Sawyer Micro Squeeze Water Filter is rated up to 100,000 gallons. Each Micro Squeeze comes with a 32-ounce reusable squeeze pouch, drinking straw, cleaning coupling, spare gasket, and cleaning plunger. Sawyer individually tests each and every Micro Squeeze three times to performance standards before packaging. Specifications
- Longevity: up to 100,000 Gallons
- Filter Material: Hollow Fiber Membrane
- Removes: Bacteria, Protozoa, and Cysts, including E. Coli, giardia, vibrio cholerea, Salmonella typhi, and microplastics
- Weight: 2 oz ]]>1https://s.turbifycdn.com/aah/optacticalgear/sawyer-micro-squeeze-water-filtration-system-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/sawyer-micro-squeeze-water-filtration-system-78.jpgSawyer Productshttps://s.turbifycdn.com/aah/optacticalgear/sawyer-mini-water-filtration-system-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/sawyer-mini-water-filtration-system-54.jpgcustom-itemoptacticalgear-pagenalgene131SP10724.9522.95Sawyer Mini Water Filtration System Sawyer Products111• Ideal for outdoor recreation, hiking, camping, scouting, domestic and international travel and emergency preparedness
• The MINI removes 99.99999% of all bacteria, such as salmonella, cholera, leptospirosis, and E.coli; removes 99.9999% of all protozoa, such as giardia and cryptosporidium
• High performance filter fits in the palm of your hand, weighs 2 ounces and filters up to 100,000 gallons (30 times more than comparable filters)
• Attaches to included drinking pouch, standard disposable bottles (28 mm thread), hydration packs, or use the straw to drink directly from your water source Kit Includes:
• 1 – Sawyer MINI Water Filter with Tip Cap
• 1 – 16 oz Reusable Squeeze Pouch
• 1 – 7″ Drinking Straw
• 1 – Cleaning Plunger (Syringe)
• Cleaning and Maintenance Instructions ]]>1https://s.turbifycdn.com/aah/optacticalgear/sawyer-mini-water-filtration-system-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/sawyer-mini-water-filtration-system-67.jpgSawyer Productshttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4395.jpglink.sudufusclipr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4187.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4188.jpghttps://s.turbifycdn.com/aah/optacticalgear/scout-light-pro-youtube-video-11.jpglink.susclipro10l1https://s.turbifycdn.com/aah/optacticalgear/scout-light-pro-youtube-video-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/scout-light-pro-youtube-video-10.jpgsearch.searchpage.1link.1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-placard-v3-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-placard-v3-17.jpgcustom-itemoptacticalgear-pagemaveclqacoXX001-003-0555Shaw Concepts ARC Placard V3Shaw Concepts111litoshcoramePLEASE NOTE: CALIBER INSERTS ARE SOLD SEPARATELY The ARC Placard V3 is the latest version of the ARC Placard series which is Shaw Concept's take on bridging the gap between traditional MOLLE magazine pouches and placards. At the inception of the ARC Placard the industry was filled with double stack styled placards that couldn’t be slimmed down so we decided to design a single pocket placard that could be run slick or built up. Each edition we’ve sought to evolve the product and this version is no different. The ARC Placard V3 is a single pocket placard meant to integrate into the front of Plate Carriers and Chest Rigs that allows users to build out their set ups according to their mission and weapon systems. The V3’s key improvement is its expanding main pocket. Most placards on the market can only run three 5.56 magazines or two .308 magazines, but this expanding pocket allows the placard to take up to four 5.56 magazines or three .308 magazines. Having an additional 25 to 30 rounds in your prime real estate is a significant improvement that few placards on the market currently offers. The V3 is available with four Elastic Magazine Inserts: our Quadruple 556, our Triple 556, a Triple 308 and our Quintuple 9mm Insert. The ARC Placard V3 features MOLLE along the sides and bottom which allow for additional pouches to be attached to real estate that would otherwise be empty on other placards out there. This allows users to attach Pistol Magazine Pouches, Tourniquet Pouches or the sort to the sides and bottom if desired. The placard continues to allow First Spear Tube™ Integration directly to the sides of the placard but now also allows 1" Hardware to be integrated so the placard can connect to Chest Rig Harnesses. The placard also features a hook Velcro® backing and adjustable height & hardware straps on top that will allow it to work with most carriers available on the market currently. Features: -Expandable Main Pocket capable of holding up to four M4 - STANAG (5.56x45mm) Pattern Magazines or three AR10 (7.62x51mm) Pattern Magazines. -Hook & Loop Velcro® Pocket for Multi-Caliber Inserts -MOLLE/PALS Front (6 Rows x 3 Columns) -MOLLE/PALS Sides for additional pouches -MOLLE/PALS Bottom for additional pouches -Side Webbing for First Spear Tubes™ and 1" Hardware -Adjustable Placard Height w/Velcro® OneWrap Straps and swappable 1" hardware -9.25" x 5" Hook Backing -Includes two lengths of Shock Cord for Pocket Expansion -Cordura Laminate Construction Proudly made in the USA / Berry Compliant]]>1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-placard-v3-22.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-placard-v3-23.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-shoulder-pads-v2-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-shoulder-pads-v2-16.jpgcustom-itemoptacticalgear-pagecaac1XX001-00555Shaw Concepts ARC Shoulder Pads V2Shaw Concepts111Features:
• 3/8" Close Cell Foam Padding
• Mil-Spec Spacer Mesh
• Spacer Mesh Lined Neck Protection
• Internal OneWrap Velcro Anchors to lock in position and cables
• Side Ports for Side Armor Mounted with 1" Straps
• 2" Internal channel fits most plate carriers on the market
• Weight: Less than 3 Oz Made in the USA / Berry Compliant Magazines, Gear and other accessories not included]]>1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-shoulder-pads-v2-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-arc-shoulder-pads-v2-30.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-double-elastic-pistol-dep-pouch-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-double-elastic-pistol-dep-pouch-16.jpgcustom-itemoptacticalgear-pagepimapoXX001-03826Shaw Concepts Double Elastic Pistol (DEP) PouchShaw Concepts111Features:
• Doubled Up Mil-Spec Elastic for Tight Mag Retention
• HANK Lined Inner for Friction & Retention
• Loops for Shockcord Retention if Desired
• 3" Deep Coverage to Allow Sufficient Grasp of the Magazine
• MOLLE / PALS Mounting
• Weight: 0.8 Oz Made in the USA / Berry Compliant Magazines, Gear and other accessories not included. The DEP can accept shock cord retention and pull tabs - not included.]]>1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-double-elastic-pistol-dep-pouch-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-double-elastic-pistol-dep-pouch-30.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-flex-v2-pouch-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-flex-v2-pouch-27.jpgcustom-itemoptacticalgear-pageoptopmapoXX001-01438Shaw Concepts FLEX V2 PouchShaw Concepts111(Not included) for occasions such as Airborne or Amphibious Operations or just simple personal preference. On top of all that the pouch is constructed of Squadron B52 Laminate which consists of two 500D Cordura sheets laminated together which are then laser cut with perfect accuracy and consistency. This material helps keeps the weight down while keeping the pouch extremely durable. The mounting straps are designed to attach to standard Molle/PALS as well as half sized Molle found on shooter belts across the market. Features:
• Doubled Up Mil-Spec Elastic Retention
• HANK Friction Retention
• Shockcord Loop Built In (Shockcord not included)
• Molle/PALS for Stacking a Pistol Pouch
• Molle/PALS & Belt Compatible
• B52 Laminate Construction
• Weight: 1.5 oz Made in the USA / Berry Compliant Magazines not included]]>1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-flex-v2-pouch-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-flex-v2-pouch-41.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-plate-carrier-panel-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-plate-carrier-panel-16.jpgcustom-itemoptacticalgear-pageassaultpacksXX001-003155Shaw Concepts Plate Carrier PanelShaw Concepts111Features:
• Tegris Thermoplastic Base w/6x6 MOLLE Mounting Slots
• Mounting real-estate on both sides
• Laminate Wrapped Carry Handle
• Flanking 'Mounting' Squares for Compression Straps
• Quick Adjust Shoulder Straps for use on a Plate Carrier or on its own.
• Soft Durable Stretch Fabric & Close Cell Foam Shoulder Pads
• Weight: 12 Oz (Entire Kit) Made in the USA / Berry Compliant Magazines, Gear and other accessories not included]]>1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-plate-carrier-panel-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-plate-carrier-panel-30.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-ram-elastic-inserts-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-ram-elastic-inserts-11.jpgcustom-itemoptacticalgear-pagemaveclqacoXX001-003-05-0340Shaw Concepts RAM Elastic InsertsShaw Concepts111litoshcoarcpPLEASE NOTE: ARC PLACARD V3 SOLD SEPARATELY The RAM (Reinforced Ammunition Management) Elastic Insert is Shaw Concepts' update to the antiquated Elastic Inserts found across the market. This design was born from two problems: one was the lack of any suitable AK magazine placards out there that addressed the issue of the locking lugs tearing up pouches. and the second was users wishing to have an easier time re-indexing magazines into elastic cells that lay completely flat when empty. To solve these issues Shaw Concepts came up with a way to get Tegris Thermoplastic strips to line the side edges of each magazine cell so as to allow a magazine's rough lugs or pressure points to slide in and out without damaging the elastic that provides the magazine retention. This also helps keep the mouth of the elastic cell partially open at all times. This effectively offers the benefits of Kydex inserts without the impracticality of a pouch that is completely open. The RAM Elastic Insert works in our ARC Placard V3 and other placards that are Hook & Loop Velcro lined and that are wide enough to accept the various caliber sizes Shaw Concepts offers. This product is not compatible with the Spiritus Systems Microfight or Haley Strategic Micro Rig. Compatibility Guide: TRIPLE 556 RAM: Fits USGI 556 Magazines such as Issued Metal Mags and Polymer Mags including the Gen 3 PMAG. TRIPLE 308 RAM: Fits most 7.62x51mm Mags used by M110s as well as SCAR-H Mags. Features: -Tegris Thermoplastic Walls for snag-less insertion / extraction of magazines -Protected stitching for durability -Strong 4" Elastic for a tight grip on magazines -VelcroŽ Hook & Loop for plugging into compatible placards -Weighs less than 4 ounces -Berry Compliant Construction]]>1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-ram-elastic-inserts-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-ram-elastic-inserts-17.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-reup-bandolier-24.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-reup-bandolier-22.jpgcustom-itemoptacticalgear-pageammopouchesXX001-03845Shaw Concepts ReUp BandolierShaw Concepts111Features:
• Three to Four Magazine Retention & Protection
• Two Flanking Slim General Pockets
• Buckled Waist / Cross Body Band
• Shockcord w/Cord Loc for Rolling Up Tight
• Cordura & YKK Construction
• Weight: 7 Oz
Note: Some magazines may not fit the Cells such as 25 round 308 P-Mags from Magpul. Most 20 round 308 mags will fit. Most 30 round 556 STANAG mags will fit the 556 Cells as long as they lack a base plate extension. Made in the USA / Berry Compliant Magazines, Gear and other accessories not included]]>1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-reup-bandolier-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-reup-bandolier-35.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-side-kick-v2-holster-pad-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-side-kick-v2-holster-pad-11.jpgcustom-itemoptacticalgear-pageholstersXX001-045-00150Shaw Concepts Side Kick V2 Holster PadShaw Concepts111 The ground breaking quality of life improvement Sidekick is back in its Version 2 form, now compatible with many more holster systems out there. Longevity and Comfort are a prime focus in all Shaw Concepts products and the Side Kick is no different. Carrying a two pound death brick on your hip is easy but can wear down your side after a few hours or even days in the field. This is where the Side Kick comes in. The Side Kick is the solution to comfortably carrying your Side Arm and mounting other items we may desire to carry next to said Holster. The Side Kick mounts to any holster system that has an isolated bottom screw post to piggyback off of. The Side Kick will work with the Safariland Mid Ride UBL, Safariland Low Ride UBL, True North Concepts MHA, the Guardian Warrior Solutions Bang Hanger and much more. The Side Kick uses Close Cell Foam and Spacer Mesh for padding and comfort and features two columns of MOLLE slots on both 'wings' of the pad. A 1" Thigh Strap is included that features a durable side release buckle and an elastic section for stretch. Features: -1/4" Close Cell Foam Padding -MOLLE Slots for PALS Pouches -1" Thigh Strap w/Elastic Comfort Stretch -35" Max Thigh Circumference -Reversible for Right and Left Hand Users -Mounts to UBLs, MHAs, QLSs and More -Included a Screw for Safariland Pattern Holsters and two Flanged Sleeve Bearings -Constructed of Cordura, Cordura Laminate and other Mil-Spec Materials Weight: 2.5 Oz Made in the USA / Berry Compliant1https://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-side-kick-v2-holster-pad-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/shaw-concepts-side-kick-v2-holster-pad-17.jpgShaw Conceptshttps://s.turbifycdn.com/aah/optacticalgear/shemaghs-veils-scarfs-bandanas-face-paint-57.jpgitem.optacticalgear-pageunclShemaghs / Veils / Camouflage / Face Paint1onehucoheonehucopashemaghfaceveilscarfvesybagistcafapast1misychwrcafocatacrprcoasgh1https://s.turbifycdn.com/aah/optacticalgear/shemaghs-veils-scarfs-bandanas-face-paint-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/shemaghs-veils-scarfs-bandanas-face-paint-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/shingles-open-top-mag-pouches-45.jpgitem.optacticalgear-pageammopouchesShingles / Open Top Mag Pouches, and Accessories1magpoupspsyjspoplbipapov2fastmaggen3luanpohsgen2ritahstamapohstaltmohspododetav2hspotav2hspotamagpomhsxtadorimaphstashshcoflv2pofecosielarblfogetesim4blfogetedom4blfogetetrm4es5sikytamages5dokytamages5trkymagpoes5sikymimages5trkymimages5sikyshmages5dokyshmages5trkyshmagfispmurapofispspreinkiatstrm4magshcrprmasof3atssctrshpoblfogetesrmaitwfahemo1https://s.turbifycdn.com/aah/optacticalgear/shingles-open-top-mag-pouches-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/shingles-open-top-mag-pouches-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/t-shirts-pt-shorts-52.jpgitem.optacticalgear-pageunclShirts and Sweaters1optgrlothodebehotjowabllahovesyborushvesyboruloslhodetophattehoderesilotemjsoadg3toptmasoftoptmaintrosqtwifitnonofatoptbeinlitoptoriginalteeoptacetoteeoptdotatfitoptsilotliweoptbuwalotli1https://s.turbifycdn.com/aah/optacticalgear/t-shirts-pt-shorts-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/t-shirts-pt-shorts-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/shorts-58.jpgitem.optacticalgear-pageunclShorts1pljashwogesirapamjsoadtrrushmjsopeshoptmainrapaoptsfrapasnloptmasofrapaoptsfrapa1https://s.turbifycdn.com/aah/optacticalgear/shorts-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/shorts-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/shot-timers-wind-meters-62.jpgitem.optacticalgear-pageweaponsShot Timers and Chronographs1pacltiiiiavsgaxec1proch1https://s.turbifycdn.com/aah/optacticalgear/shot-timers-wind-meters-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/shot-timers-wind-meters-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/shotgun-smg-crew-served-mg-pouches-33.jpgcustom-itemoptacticalgear-pageammopouchesShotgun, SMG, Belted Ammo, Pouches1es6roshcaes4roshcahsexpitahsmo2qtutpo1https://s.turbifycdn.com/aah/optacticalgear/shotgun-smg-crew-served-mg-pouches-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/shotgun-smg-crew-served-mg-pouches-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/side-armor-plates-37.jpgcustom-itemoptacticalgear-pagearmorSide Armor Plates1hep1leiiiasthespthstalpl1https://s.turbifycdn.com/aah/optacticalgear/side-armor-plates-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/side-armor-plates-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4t-pro-1x20-mm-r-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4t-pro-1x20-mm-r-16.jpgcustom-itemoptacticalgear-pagerdsreddotsiaSIGSOR4410719.99549.99Sig Sauer ROMEO4T-PRO 1x20 mm (R)Sig Sauer111Features
- Designed, built and tested for hard, professional use
- Engineered lens coatings for elite performance in bright light or NV
- Top mounted activation with NV Override control
- Quad Ballistic Circle Dot
- Durable half-inch hex mount
- 9 Daytime settings, 3 NV settings
- 3 mounting heights come standard in the box
- Includes clear flip-backs, opaque front flip back, and ARD Kill-Flash
- 50,000 hr runtime with CR2032 Battery and MOTAC Specifications
- MAGNIFICATION: 1x
- OBJECTIVE LENS DIAMETER (MM): 20 mm
- ADJUSTMENT INCREMENTS: 0.5 MOA
- TOTAL ELEVATION TRAVEL: 100 MOA
- TOTAL WINDAGE TRAVEL: 100MOA
- OVERALL LENGTH: 67.5 mm
- OVERALL WIDTH: 50 mm
- HEIGHT: 62.5 mm
- WEIGHT: 6.3 oz (with absolute cowitness mount, both clear flip-back lenses, and battery installed)
- RETICLE: Quad Ballistic Circle Red Dot
- CENTER DOT SIZE: 2 MOA
- WATERPROOFING: IPX-8
- BATTERY: (1) CR2032
- RUN TIME: 50000 hrs
- ILLUMINATION SETTINGS: 9 Daytime / 3 NV
- MOUNT TYPE: Half Inch Hex Mount (fits Aimpoint T2 pattern footprint) - Assembled in USA]]>1https://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4t-pro-1x20-mm-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4t-pro-1x20-mm-r-30.jpgSig Sauerhttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4xt-pro-1x20-mm-r-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4xt-pro-1x20-mm-r-16.jpgcustom-itemoptacticalgear-pagerdsreddotsiaSIGSOR4401759.99579.99Sig Sauer ROMEO4XT-PRO 1x20 mm (R)Sig Sauer111Specifications
- MAGNIFICATION: 20 mm
- OBJECTIVE LENS DIAMETER (MM): 20 mm
- ADJUSTMENT INCREMENTS: 0.5 MOA
- TOTAL ELEVATION TRAVEL: 100 MOA
- TOTAL WINDAGE TRAVEL: 100 MOA
- OVERALL LENGTH: 77 mm
- OVERALL WIDTH: 63 mm
- HEIGHT: 56 mm
- WEIGHT: 7.4 oz (with absolute cowitness mount, both clear flip-back lenses, and battery installed) WEIGHS 5.1 oz WITH BATTERY - MOUNT ONLY
- RETICLE: Ballistic Circle Dot
- RETICLE COLOR: Red
- CENTER DOT SIZE: 2 MOA
- WATERPROOFING: IPX-8
- BATTERY: (1) AAA
- RUN TIME: 50000 hrs
- ILLUMINATION SETTINGS: 9 Daytime / 3 NV
- MOUNT TYPE: Half Inch Hex Mount (fits Aimpoint T2 pattern footprint) - Assembled in USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4xt-pro-1x20-mm-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/sig-sauer-romeo4xt-pro-1x20-mm-r-30.jpgSig Sauerhttps://s.turbifycdn.com/aah/optacticalgear/single-point-slings-44.jpgitem.optacticalgear-pagetagslingsSingle Point Slings1hastd3slmamsduqdslge215gemusiposemurswesl215gesc2insi11https://s.turbifycdn.com/aah/optacticalgear/single-point-slings-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/single-point-slings-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/sitka-mlx-jacket-mdwi-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/sitka-mlx-jacket-mdwi-38.jpgcustom-itemoptacticalgear-pagejavesw18030077300225Sitka MLX Jacket - MDWi - Polartec AlphaSitka111Ships to USA and APO Addresses Only. No International Shipping. The BLUF: This is an excellent mid or outer layer for active use, with the Polartec Alpha fleece providing great warmth, Aerolite outer layer protecting against wind and light rain/snow, and yet noticeably more breathable versus similar jackets when your body temp rises. An insulated jacket that is worn in a stand-alone manner or as a midlayer in conjunction with a wet weather protective jacket when conducting Special Reconnaissance tasks. Features:
• Wet Weather Jacket Compatible – allowing the jacket to be functionally worn as insulation with a Wet Weather Protective Jacket
• Full Zip Centre Front Closure – enhancing ventilation when mobile and the ease of donning and doffing
• Left Chest Zip Pocket – allowing for the secure carriage of mission essential items
• Lower Torso Hand Zip Pockets – allowing for the convenient and secure carriage of mission essential items Materials:
• Polartec Alpha® 4004 Breathable Insulation
• Brookwood AEROLITE™ H600™ 30d Nylon Ripstop with DWR Weight: 12 oz (Large size) TAA Trade Compliant. Sizing:
• Small: Chest: 36 - 38" / Sleeve: 33"
• Medium: Chest: 39 - 41" / Sleeve: 34"
• Large: Chest: 42 - 45" / Sleeve: 35"
• X-Large: Chest: 46 - 49" / Sleeve: 36"
• XXL: Chest: 50 - 53" / Sleeve: 37"]]>1https://s.turbifycdn.com/aah/optacticalgear/sitka-mlx-jacket-mdwi-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/sitka-mlx-jacket-mdwi-48.jpgSitkahttps://s.turbifycdn.com/aah/optacticalgear/sitka-wwp-jacket-mdw-waterproof-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/sitka-wwp-jacket-mdw-waterproof-47.jpgcustom-itemoptacticalgear-pageinoulal718050251950699Sitka WWP Jacket - MDW - WaterproofSitka111Ships to USA and APO Addresses Only. No International Shipping. A waterproof, breathable and durable jacket shell, that is worn when conducting full spectrum combat operations in a wet weather environement. Features:
• Fixed Adjustable Hood – allowing for the option of a hood when static
• Internal Left Chest Zip Pocket – allowing for the secure carriage of mission essential items
• Upper Torso Zip Pockets – allowing for the secure and convenient carriage of mission essential items
• Upper Arm Zip Pockets – allowing for the convenient carriage of mission essential items
• Underarm Zip Vents – enhancing ventilation when worn with Personal Protective Equipment and/or Load Carriage Equipment.
• Upper Arm Loop (4”x4.5”) – allowing for the application of IR reflective and electronic IFF devices
• Adjustable Hem Closure – allowing jacket to be cinched up when static during cold weather conditions
• Internal ID Label – mitigating confusion when issued as a uniform item
• GORE® GQST Military (Storm Rated)
• Multicam Print SKUs meet NIR Compliance Standards Materials:
• GORE® GTX 3L 40d Nylon Ripstop with DWR Weight: 23.5oz (L) USA Berry Compliant. Sizing:
• Small: Chest: 36 - 38" / Sleeve: 33"
• Medium: Chest: 39 - 41" / Sleeve: 34"
• Large: Chest: 42 - 45" / Sleeve: 35"
• X-Large: Chest: 46 - 49" / Sleeve: 36"
• XXL: Chest: 50 - 53" / Sleeve: 37" ]]>1https://s.turbifycdn.com/aah/optacticalgear/sitka-wwp-jacket-mdw-waterproof-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/sitka-wwp-jacket-mdw-waterproof-60.jpgSitkahttps://s.turbifycdn.com/aah/optacticalgear/size-chart-248.jpglink.datonoshli1https://s.turbifycdn.com/aah/optacticalgear/size-chart-224.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-225.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-250.jpglink.saqu4dfo1https://s.turbifycdn.com/aah/optacticalgear/size-chart-214.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-215.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-243.jpglink.datotamilicu1https://s.turbifycdn.com/aah/optacticalgear/size-chart-226.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-227.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-244.jpglink.datotaboexcu1https://s.turbifycdn.com/aah/optacticalgear/size-chart-212.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-213.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-242.jpglink.datotabofucu1https://s.turbifycdn.com/aah/optacticalgear/size-chart-218.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-219.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-241.jpglink.saxafogtxlow1https://s.turbifycdn.com/aah/optacticalgear/size-chart-222.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-223.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-245.jpglink.crprmoribe201https://s.turbifycdn.com/aah/optacticalgear/size-chart-232.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-233.jpglink.crprg3coshm81link.crprg3copam81link.ourefojaco1link.mjsoadtrrush1link.oureheiijaco1https://s.turbifycdn.com/aah/optacticalgear/size-chart-249.jpglink.datotaovexcu1https://s.turbifycdn.com/aah/optacticalgear/size-chart-216.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-217.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4396.jpglink.saxulfomidgt1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4189.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4190.jpglink.ourefehoco1https://s.turbifycdn.com/aah/optacticalgear/size-chart-246.jpglink.safoguar67co1https://s.turbifycdn.com/aah/optacticalgear/size-chart-234.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-235.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-240.jpglink.saurjuulbo1https://s.turbifycdn.com/aah/optacticalgear/size-chart-236.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-237.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-238.jpglink.datotabocu1https://s.turbifycdn.com/aah/optacticalgear/size-chart-220.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-221.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-247.jpglink.datotamicrli11https://s.turbifycdn.com/aah/optacticalgear/size-chart-228.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-229.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-239.jpglink.otbbojuarcob1https://s.turbifycdn.com/aah/optacticalgear/size-chart-230.jpghttps://s.turbifycdn.com/aah/optacticalgear/size-chart-231.jpghttps://s.turbifycdn.com/aah/optacticalgear/sizing-46.jpgitem.optacticalgear-pagewoelclitSizing Military Uniforms and Hats1Sizing for military uniforms explained: Military type uniforms have two sizes, one is the standard sizing (small, medium, large...), and the other is the length (short, regular and long). OPT offers uniforms in sizes small to extra large, and lengths of regular and long. TOPS: Sizes (based on chest): -Small: 33" - 37"
-Medium: 37" - 41"
-Large: 41" - 45"
-XLarge: 45" - 49" Lengths (based on height): -Regular: 67" - 71"
-Long: 71" - 75"
Regular works for most anyone over 64" BOTTOMS: Sizes (based on waist): -Small: 27" - 31"
-Medium: 31" - 35"
-Large: 35" - 39"
-XLarge: 39" - 43" Length (based on inseam): -Regular: 29.5" - 32.5"
-Long: 32.5" - 35.5" HATS Hats are sized based on the circumference of the head at the line above the ears where the hat rests. Size 6 7/8 = 21 1/2 inches
Size 7 (S) = 21 7/8 inches
Size 7 1/8 = 22 1/4 inches
Size 7 1/4 (M) = 22 5/8 inches
Size 7 3/8 = 23 inches
Size 7 1/2 (L) = 23 1/2 inches
Size 7 5/8 = 24 inches
Size 7 3/4 (XL) = 24 3/8 inches ]]>1https://s.turbifycdn.com/aah/optacticalgear/sizing-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/sizing-45.jpglink.crprg3fipa1https://s.turbifycdn.com/aah/optacticalgear/sizing-chart-16.jpglink.datotamicrli1https://s.turbifycdn.com/aah/optacticalgear/sizing-chart-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/sizing-chart-15.jpglink.crprlvsbavep1link.crprg3copa1https://s.turbifycdn.com/aah/optacticalgear/ballistic-date-sheet-12.jpglink.crpraiheta3h1https://s.turbifycdn.com/aah/optacticalgear/ballistic-date-sheet-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/ballistic-date-sheet-11.jpglink.crprg3cosh1link.pigfudetafal1link.pigfudetafde1https://s.turbifycdn.com/aah/optacticalgear/sizing-guide-42.jpglink.datohimicrcu1https://s.turbifycdn.com/aah/optacticalgear/sizing-guide-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/sizing-guide-38.jpglink.tareqrfsedeb1link.betrjuru1link.bemitrmicobo1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4399.jpglink.qameclsiri1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4195.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4196.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4397.jpglink.qamestedsiri1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4191.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4192.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4398.jpglink.qawolasiri1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4193.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4194.jpghttps://s.turbifycdn.com/aah/optacticalgear/sleeping-48.jpgitem.optacticalgear-pagefigemiSleeping Gear / Ponchos / Poncho Liners1hipegemosehpg812stsavesybasnjubag1https://s.turbifycdn.com/aah/optacticalgear/sleeping-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/sleeping-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/slings-33.jpgitem.optacticalgear-pageindexSling1twopointslingssiposlblfogevisawsramoslatslacwere1https://s.turbifycdn.com/aah/optacticalgear/slings-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/slings-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/sling-accessories-59.jpgitem.optacticalgear-pagetagslingsSling Accessories1spsyslreba4pblfogeulalgdefoslswhedupubuslswitwmashhookblfogeslslNote: many of these items are specifically designed to couple with slings made by the same manufacturers, most systems are NOT cross-compatible.1https://s.turbifycdn.com/aah/optacticalgear/sling-accessories-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/sling-accessories-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/slip2000-ewl-30-4-oz-bottle-30.jpgcustom-itemoptacticalgear-pageotweclki746035123.7219.99SLiP2000 EWL 30 - 4 oz. BottleSLiP2000111Lubrication Slip 2000 Lubricants use a unique formulation to penetrate into the smallest, tightest areas that oils do not go. This provides a long lasting protective coating that reduces friction and almost stops metal to metal wear. Slip 2000 gun lubricants form a barrier that will then protect all parts and will allow them to work smoother and last longer. Cleaning Slip 2000 lubricants penetrate powder residue, carbon, copper, lead, and plastic wad fouling. This allows it break contaminants free and flush away trapped dirt, grit and grime. What is left behind is a barrier that has bonded with the metal and will continue to lubricate and protect against corrosion. This barrier does not attract dust and will keep new firing residue from bonding to the metal. After your first complete cleaning with Slip 2000 you will see an amazing difference in the time and ease with which your next cleaning will take place. Preservation Slip 2000 lubricants provide a long lasting barrier on all metal parts and does not attract dirt or other abrasive contaminants. This barrier will displace moisture and prevent rusting. Our proprietary formulation was created to lubricate, clean, protect, and outlast any other product on the market today! We have done this without adding any oils, petroleum distillates or harmful PTFE type ingredients. Slip 2000 lubricants are developed with health, safety and the environment in mind. Our lubricants are formulated for multiple uses and extreme high performance requirements in all conditions. They will outperform all other lubricants in severe weather conditions, high humidity, rain, sleet, and snow working from -130 deg. F to +1250 deg F We recommend that you apply our lubricant to all metal parts and surfaces, not just the wear points. When applying our lubricant try to think of it as a metal treatment that will keep carbon and other buildup from sticking to the metal. Even when wiped away with a cloth, the lubrication and preservation properties will remain. Slip 2000 lubricants bond with the metal on contact, leaving a lubricating barrier that prevents carbon, residue, and other buildup from sticking. If you are unsure of how to lubricate your specific firearm, please follow the manufacturer's guidelines. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/slip2000-ewl-30-4-oz-bottle-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/slip2000-ewl-30-4-oz-bottle-40.jpgSLiP2000https://s.turbifycdn.com/aah/optacticalgear/slip2000-exteme-weapons-lubricant-ewl-1-oz-bottle-44.jpgcustom-itemoptacticalgear-pageotweclki746031711.219.49SLiP2000 Exteme Weapons Lubricant (EWL) - 1 oz. BottleSLiP2000111Description EWL was designed for use on chain guns and machine guns like the MP5 and the 249SAW. It contains a proprietary Anti wear agent that reduces friction and wear by 90-95%. SLiP2000 EWL is formulated to provide maximum performance in larger guns that may have issues with friction and heat while providing all the benefits of our regular lubricant. SLiP2000 EWL is a specially formulated synthetic liquid lubricant. Formulated with out the use of mineral oil or petroleum distillates SLiP2000 EWL has extremely high penetrating and (EP) antiwear properties. It also combines three essential functions in a single product. Specifically; Cleaning, Lubrication, and Preservation of handheld weapons, and weapons systems of both large and small caliber. This product will not separate, become sticky or dry out and leave any tacky residue behind. It will not attract and hold firing residue, dust or dirt particles like petroleum products. Lubrication SLiP2000 EWL has incorporated advanced technology additives to enhance film strength and antiwar properties. Penetrating the pores and bonding its self to the surface of the metal through physical absorption reducing surface tension thereby reducing friction between moving parts and minimizing wear and the build-up of wear related debris. SLiP2000 EWL will not dry out; attract dust or dirt particles like petroleum products. Even when surface is wiped dry to the touch SLiP2000 EWL is still present and lubricating the metal parts from within the pores of the weapon. This product does not require a liquid carrier to be present for protection. SLiP2000 EWL does not evaporate off because there are no carriers needed for continued protection. Cleaning SLiP2000 EWL provides additional protection through additives that in addition to the ability to penetrate between metal surfaces, it will also aid in the effective removal of built up dirt, lead, copper, carbon, corrosion particles and firing residues that can buildup and become abrasive to both recoil and gas operated mechanisms. Preservation After cleaning, a micro thin film of our enhanced preservative immediately bonds itself and forms a barrier film on the surface that displaces water and provides a corrosion resistant barrier against rust and dirt. It is designed to give protection against hydrogen sulfide (H2S), mild mineral acids, carbon dioxide (CO2), saltwater and brackish environments, musky water, chlorine and similar adverse environments and has passed the Salt Spray Corrosion (ASTM B-117) 150 Hour test. Additionally a barrier of protection is formed to protect against all other fouling of lead, carbon, copper and plastic wad. Applications SLiP2000 EWL is formulated to meet the complete requirements of cleaning, lubricating, and preserving both small and large caliber weapons in virtually all climate conditions. Apply to weapons metal surface liberally on first application. Allow to penetrate surface on first application approximately 5 to 10 min. Wipe excess lubricant from surface to leave a dry surface to the touch. This will also help when it comes to dirt not sticking to a dry weapon. As weapons are used and heat up the SLiP2000 will penetrate even deeper into the pores of the metal. On second cleaning these pores will fill in with additional Lubricant and a new protective barrier will be formed making the second cleaning much easier and faster. Specifications SLiP2000 EWL meets most and exceeds requirements of MIL SPEC: MIL-PRF-63460D (6) Kinematics Viscosity (ASTM D445) -59 degrees F...Pass Falex Load Carrying Capacity (ASTM D3233) +4500 lbs...Pass Corrosion Test (ASTM-B-117) 150 Hr...Pass Rust Resistance (ASTM D-665) Test A...Pass Test B...Pass Modified Test C...Pass]]>1https://s.turbifycdn.com/aah/optacticalgear/slip2000-exteme-weapons-lubricant-ewl-1-oz-bottle-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/slip2000-exteme-weapons-lubricant-ewl-1-oz-bottle-54.jpgSLiP2000https://s.turbifycdn.com/aah/optacticalgear/slip2000-extreme-tactical-cleaning-system-4oz-3-pack-available-soon-23.jpgcustom-itemoptacticalgear-pageotweclki746038742.0534.99SLiP2000 Extreme TACTICAL Cleaning System 4oz. 3 PackSLiP20001111 - 4oz. 725 Gun Cleaner
1 - 4oz. Carbon Killer Bore Cleaner Non-Toxic, Non-Hazardous synthetic cleaning solutions in one convenient bundle.]]>1https://s.turbifycdn.com/aah/optacticalgear/slip2000-extreme-tactical-cleaning-system-4oz-3-pack-available-soon-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/slip2000-extreme-tactical-cleaning-system-4oz-3-pack-available-soon-30.jpgSLiP2000https://s.turbifycdn.com/aah/optacticalgear/slip2000-extreme-weapons-lubricant-ewl-4-oz-bottle-38.jpgitem.optacticalgear-pageotweclki746032020.1316.99SLiP2000 Extreme Weapons Lubricant (EWL) - 4 oz. BottleSLiP2000111Description EWL was designed for use on chain guns and machine guns like the MP5 and the 249SAW. It contains a proprietary Anti wear agent that reduces friction and wear by 90-95%. SLiP2000� EWL is formulated to provide maximum performance in larger guns that may have issues with friction and heat while providing all the benefits of our regular lubricant. SLiP2000� EWL is a specially formulated synthetic liquid lubricant. Formulated with out the use of mineral oil or petroleum distillates SLiP2000� EWL has extremely high penetrating and (EP) antiwear properties. It also combines three essential functions in a single product. Specifically; Cleaning, Lubrication, and Preservation of handheld weapons, and weapons systems of both large and small caliber. This product will not separate, become sticky or dry out and leave any tacky residue behind. It will not attract and hold firing residue, dust or dirt particles like petroleum products. Lubrication SLiP2000� EWL has incorporated advanced technology additives to enhance film strength and antiwar properties. Penetrating the pores and bonding its self to the surface of the metal through physical absorption reducing surface tension thereby reducing friction between moving parts and minimizing wear and the build-up of wear related debris. SLiP2000� EWL will not dry out; attract dust or dirt particles like petroleum products. Even when surface is wiped dry to the touch SLiP2000� EWL is still present and lubricating the metal parts from within the pores of the weapon. This product does not require a liquid carrier to be present for protection. SLiP2000� EWL does not evaporate off because there are no carriers needed for continued protection. Cleaning SLiP2000� EWL provides additional protection through additives that in addition to the ability to penetrate between metal surfaces, it will also aid in the effective removal of built up dirt, lead, copper, carbon, corrosion particles and firing residues that can buildup and become abrasive to both recoil and gas operated mechanisms. Preservation After cleaning, a micro thin film of our enhanced preservative immediately bonds itself and forms a barrier film on the surface that displaces water and provides a corrosion resistant barrier against rust and dirt. It is designed to give protection against hydrogen sulfide (H2S), mild mineral acids, carbon dioxide (CO2), saltwater and brackish environments, musky water, chlorine and similar adverse environments and has passed the Salt Spray Corrosion (ASTM B-117) 150 Hour test. Additionally a barrier of protection is formed to protect against all other fouling of lead, carbon, copper and plastic wad. Applications SLiP2000� EWL is formulated to meet the complete requirements of cleaning, lubricating, and preserving both small and large caliber weapons in virtually all climate conditions. Apply to weapons metal surface liberally on first application. Allow to penetrate surface on first application approximately 5 to 10 min. Wipe excess lubricant from surface to leave a dry surface to the touch. This will also help when it comes to dirt not sticking to a dry weapon. As weapons are used and heat up the SLiP2000� will penetrate even deeper into the pores of the metal. On second cleaning these pores will fill in with additional Lubricant and a new protective barrier will be formed making the second cleaning much easier and faster. Specifications SLiP2000� EWL meets most and exceeds requirements of MIL SPEC: MIL-PRF-63460D (6) Kinematics Viscosity (ASTM D445) -59� F...Pass Falex Load Carrying Capacity (ASTM D3233) +4500 lbs...Pass Corrosion Test (ASTM-B-117) 150 Hr...Pass Rust Resistance (ASTM D-665) Test A...Pass Test B...Pass Modified Test C...Pass]]>1https://s.turbifycdn.com/aah/optacticalgear/slip2000-extreme-weapons-lubricant-ewl-4-oz-bottle-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/slip2000-extreme-weapons-lubricant-ewl-4-oz-bottle-48.jpgSLiP2000https://s.turbifycdn.com/aah/optacticalgear/slr-rifleworks-gb-7-pin-micro-gas-block-r-30.jpgcustom-itemoptacticalgear-pagem4arupreandpXXGB7-PIN42.99SLR Rifleworks GB-7 Pin Micro Gas Block for Hodge Defense Rails (R)SLR Rifleworks111This is the same low profile Gas Block used on Hodge Defense Rifles and ensures proper spacing on Hodge Defense Rails.
-Super High Quality gas blocks
-4140 Billet Steel
-Melonite QPQ Finish
-Set screws and roll pin included Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/slr-rifleworks-gb-7-pin-micro-gas-block-r-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/slr-rifleworks-gb-7-pin-micro-gas-block-r-37.jpgSLR Rifleworkshttps://s.turbifycdn.com/aah/optacticalgear/locking-d-ring-41.jpgitem.optacticalgear-pageveir55ha2643325_16.49SMC Force TAC-D Locking D-RingSMC Gear111• Strength: 31kN
• Weight: 65g Color: Matte Black]]>1https://s.turbifycdn.com/aah/optacticalgear/locking-d-ring-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/locking-d-ring-48.jpgSMC Gearhttps://s.turbifycdn.com/aah/optacticalgear/non-locking-d-ring-40.jpgitem.optacticalgear-pageveir55ha264336711.5SMC Force TAC-D Non-Locking D-RingSMC Gear111• Strength: 31kN
• Weight: 65g Color: Matte Black]]>1https://s.turbifycdn.com/aah/optacticalgear/non-locking-d-ring-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/non-locking-d-ring-47.jpgSMC Gearhttps://s.turbifycdn.com/aah/optacticalgear/goggles-sunglasses-76.jpgitem.optacticalgear-pagesugoSmith and ESS Eyeshields1esscrbaeyesscrbaeyrelesscrsubaeyesscrsufrkit1https://s.turbifycdn.com/aah/optacticalgear/goggles-sunglasses-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/goggles-sunglasses-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/snow-peak-long-titanium-spork-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/snow-peak-long-titanium-spork-12.jpgcustom-itemoptacticalgear-pagejetboil63SCT-01410.95Snow Peak Long Titanium SporkSnow Peak111Note from OPT: If you eat freeze dried meals on your outings, this spoon is what you want. It will keep your knuckles out of the bag and clean from food, which is a pain when you are in the backcountry or the field. The Long Titanium Spork is an extended lightweight utensil. Use the long spork for packaged meals and on your backcountry adventures. The spork is made of durable titanium and features an extended handle. To clean, place in dishwasher or use a sponge with mild soap and water then dry thoroughly before storage. Weight: 0.8 oz (22.6 g) Size: L 8.3" W 1.5" Material: Titanium Features
Lightweight Utensil for Everyday
Extended Handle for Freeze Dried Foods ]]>1https://s.turbifycdn.com/aah/optacticalgear/snow-peak-long-titanium-spork-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/snow-peak-long-titanium-spork-17.jpgSnow Peakhttps://s.turbifycdn.com/aah/optacticalgear/snow-peak-titanium-spork-39.jpgitem.optacticalgear-pagejetboil63SCT0049.95Snow Peak Titanium SporkSnow Peak111Twice the weight savings—not only is titanium light, but you need only carry a single utensil cutting the weight you carry even further. Titanium leaves no metallic smell or taste and will not rust. Dimensions: 1.625 x 6.5 inches Weight: 0.6 oz1https://s.turbifycdn.com/aah/optacticalgear/snow-peak-titanium-spork-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/snow-peak-titanium-spork-48.jpgSnow Peakhttps://s.turbifycdn.com/aah/optacticalgear/proforce-dri-sak-coyote-large-13-liter-39.jpgitem.optacticalgear-pagepacocobawaba6480DS01CB-LG3231.95Snugpak Dri-Sak - Coyote Large - 13 LiterSnugpak111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Store your sleeping bag, clothing, and any other items you want to keep dry in a Dri-Sak. No matter what size you choose or need we have a size that is sure to be right for your situation. they are seam tapes nylon with a TPU Film Lamination to ensure protection if your gear takes an unexpected dive into the water. Features: Durable and lightweight Nylon fabric w/ Waterproof Laminate Waterproof Taped seams Roll-top waterproof closure Durable buckle secures roll top D-Rings for securing if necessary Measures: 8.5 x 20.7 inches when layed flat Not designed for long term submersion; abrasion or cutting may compromise seal, top should be rolled three times minimum for a good seal.]]>1https://s.turbifycdn.com/aah/optacticalgear/proforce-dri-sak-coyote-large-13-liter-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-dri-sak-coyote-large-13-liter-46.jpgSnugpakhttps://s.turbifycdn.com/aah/optacticalgear/proforce-dri-sak-coyote-xlarge-20-liter-39.jpgitem.optacticalgear-pagepacocobawaba6480DS01CB-XG3635.95Snugpak Dri-Sak - Coyote XLarge - 20 LiterSnugpak111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Store your sleeping bag, clothing, and any other items you want to keep dry in a Dri-Sak. No matter what size you choose or need we have a size that is sure to be right for your situation. they are seam tapes nylon with a TPU Film Lamination to ensure protection if your gear takes an unexpected dive into the water. Features: Durable and lightweight Nylon fabric w/ Waterproof Laminate Waterproof Taped seams Roll-top waterproof closure Durable buckle secures roll top D-Rings for securing if necessary Measures: 9.75 x 24 inches when layed flat Not designed for long term submersion; abrasion or cutting may compromise seal, top should be rolled three times minimum for a good seal.]]>1https://s.turbifycdn.com/aah/optacticalgear/proforce-dri-sak-coyote-xlarge-20-liter-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-dri-sak-coyote-xlarge-20-liter-46.jpgSnugpakhttps://s.turbifycdn.com/aah/optacticalgear/proforce-dri-sak-coyote-xxlarge-35-liter-39.jpgitem.optacticalgear-pagepacocobawaba6480DS01CB-2X4039.95Snugpak Dri-Sak - Coyote XXLarge - 35 LiterSnugpak111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. Store your sleeping bag, clothing, and any other items you want to keep dry in a Dri-Sak. No matter what size you choose or need we have a size that is sure to be right for your situation. they are seam tapes nylon with a TPU Film Lamination to ensure protection if your gear takes an unexpected dive into the water. Features: Durable and lightweight Nylon fabric w/ Waterproof Laminate Waterproof Taped seams Roll-top waterproof closure Durable buckle secures roll top D-Rings for securing if necessary Measures: 11.7 x 27.5 inches when layed flat Not designed for long term submersion; abrasion or cutting may compromise seal, top should be rolled three times minimum for a good seal.]]>1https://s.turbifycdn.com/aah/optacticalgear/proforce-dri-sak-coyote-xxlarge-35-liter-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/proforce-dri-sak-coyote-xxlarge-35-liter-46.jpgSnugpakhttps://s.turbifycdn.com/aah/optacticalgear/snugpak-jungle-bag-right-hand-zip-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/snugpak-jungle-bag-right-hand-zip-71.jpgitem.optacticalgear-pagesleepingbags64922__79.95Snugpak Jungle Bag - Right Hand ZipSnugpak111This item can only ship to USA and APO addresses. It cannot ship International due to Dealer agreements. The Jungle Bag is an ideal sleeping bag for tropical conditions. Snugpak™ has engineered the Jungle Bag with a specific weight of Travelsoft Insulation to maximize the efficiency and needs of those individuals using it. Travelsoft Insulation was selected and chosen for its exceptional performance in hot and humid conditions. Not to mention with the outstanding design efforts of Snugpak's engineers and design team along with the Travelsoft Insulation allows the Jungle Bag to pack smaller than a coconut. Also with its square foot design and zipper placement the Jungle bag can be opened out into a blanket for more versatility when traveling, or just as a barrier between you and what you are about to lay on. Another great feature of the Jungle Bag is its concealed roll away mosquito netting which can be zipped over the face sealing the Jungle Bag giving you protection against mosquitoes, snakes, etc. Weight: 30 oz Length: 87 x 32 inches Temperature Rating: 45°F - 36°F]]>1https://s.turbifycdn.com/aah/optacticalgear/snugpak-jungle-bag-right-hand-zip-83.jpghttps://s.turbifycdn.com/aah/optacticalgear/snugpak-jungle-bag-right-hand-zip-84.jpgSnugpakhttps://s.turbifycdn.com/aah/optacticalgear/dyneema-soft-armor-34.jpgcustom-itemoptacticalgear-pagearmorSoft Armor Vests and Inserts1crprlvsandpavesykesoarplvesyleiikesofeco3acsisoavesyloabpovesyleiisoarcrprmotrarsemagrprcawilevesymbleiiso1https://s.turbifycdn.com/aah/optacticalgear/dyneema-soft-armor-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/dyneema-soft-armor-33.jpghttps://s.turbifycdn.com/aah/optacticalgear/softshells-hybrids-level-5-9-61.jpgitem.optacticalgear-pageouterwearSoftshell1topeinjaarpajaarmeourefehoco1https://s.turbifycdn.com/aah/optacticalgear/softshells-hybrids-level-5-9-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/softshells-hybrids-level-5-9-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/soil-eater-belt-mounted-tourniquet-holder-bmth-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/soil-eater-belt-mounted-tourniquet-holder-bmth-47.jpgcustom-itemoptacticalgear-pagetourniquetsXXBMTH25Soil Eater BMTH V2Soileater111BMTH Only. CAT Tourniquet, Marker and Decompression Needle are NOT included. Made in the USA. ]]>1https://s.turbifycdn.com/aah/optacticalgear/soil-eater-belt-mounted-tourniquet-holder-bmth-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/soil-eater-belt-mounted-tourniquet-holder-bmth-57.jpgSoileaterhttps://s.turbifycdn.com/aah/optacticalgear/soil-eater-bmth-v3-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/soil-eater-bmth-v3-35.jpgcustom-itemoptacticalgear-pagebeltpouchesXXBMTHV329.99Soil Eater BMTH V3 - Belt and MOLLESoileater111• Mil-Spec elastic & laser cut SQUADRON body, fully ambidextrous.
• Removable Hood.
• Reversible Mil-Spec IR (covert) / High-Vis cell (overt).
• 12" inches of one-wrap. (for Molle attachment or cut in half for mounting on belts). The Soileater Belt Mounted Tourniquet Holder V3 or BMTH V3 offers universal mounting options for the end user. The BMTH V3 offers half inch molle adjustments on the back, allowing it to be attached via molle / pals webbing on plate carriers, belts and backpacks, utilizing the included 12" inch one-wrap or utilizing a standard 4" malice clip (not included). The BMTH V3 can be attached to any belt system horizontally or vertically utilizing the reversible 1"inch wide one-wrap (included). This means it will work on all of the popular belts including; Ronin Tactics, Lead Devil and GBRS belts. It will also work with any size leather or nylon duty belt from 1" to 2.25"+, or your conceal carry belts. The removable hood can be installed on both sides of the BMTH V3 body, allowing you to run the decompression needle / sharpie / chem holder on the top or bottom (Horizontal) or left or right (Vertical). The hood protects the windlass retainer velcro from gathering dirt or mud when going prone, and protects it further from UV light. The hood can also be removed completely if not needed. Proudly made in the USA. BMTH V3 Only. Tourniquet and medical supplies sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/soil-eater-bmth-v3-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/soil-eater-bmth-v3-45.jpgSoileaterhttps://s.turbifycdn.com/aah/optacticalgear/turned-off-clearance-items-48.jpgitem.optacticalgear-pageownerssalesSOLD OUT1hodedejohathodegrmanhathodemubltrhavesyhatoptbecoenpolhodeau2uprerssprsmrmoadstcopotatafili7dom1blmalimovandopviblpipala1spsyshcolowptatafili402rssprduaralltjacrsuxcwerblsmhosmblphclhotatafilimupomiwechdemussprsmrskmarhispgeinhatcldatohimicrcldatotamicr1alwolopemidmcldatotabocugotothcusublin1lecofoslforplecolegsllecoreso20mmlecopesodatotaovexcudatonoshligotoclmawipastefama3pakhcldatotamilicldatotamicrcldatotabofucldatotaboexblbeicbotanwblmamalowprablasptrreblpxmlicaof12fr215gesc2insitatafilimupo1blhodealgdadSold Out Clearance and Discontinued Items. NO ITEMS ON THIS PAGE ARE AVAILABLE, IF YOU ARE ABLE TO ORDER SOMETHING FROM THIS PAGE, YOU WILL NOT RECEIVE IT.]]>1https://s.turbifycdn.com/aah/optacticalgear/turned-off-clearance-items-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/turned-off-clearance-items-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/215-gear-scorpion-2-integrated-single-point-sling-cobra-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/215-gear-scorpion-2-integrated-single-point-sling-cobra-56.jpgitem.optacticalgear-pagetuoffclit99215S2SPSC74.9950Sold Out 215 Gear Scorpion 2 Integrated Single Point Sling / Cobra215 Gear11This sling is an integrated version of our single point sling. We used super heavy shock cord to support the weight of your weapons system and used a Cobra Buckle for the quick detach feature. Attachment to your armor is simple, just route over each shoulder (over or under any shoulder attachment pads) and locate to one loop of MOLLE/PALS on each side of your back. Cobra Buckle has several inches of lateral travel to facilitate strong side/weak side shouldering of weapon. We also included a 550 cord adaptor to attach your weapon to, making a “soft” attachment system. This will eliminate any metal on metal noise found in most attachment systems. The sling attachment system also facilitates weaving the ends together to make a standard single point sling, for those times you are not wearing armor. Made with all high quality Mil-spec materials. Made in the U.S.A, Lifetime Warranty1https://s.turbifycdn.com/aah/optacticalgear/215-gear-scorpion-2-integrated-single-point-sling-cobra-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/215-gear-scorpion-2-integrated-single-point-sling-cobra-66.jpg215 Gearhttps://s.turbifycdn.com/aah/optacticalgear/altra-women-s-lone-peak-mid-mesh-3-5-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/altra-women-s-lone-peak-mid-mesh-3-5-38.jpgcustom-itemoptacticalgear-pagetuoffclit138AFW1755H16040Sold Out Altra Women's Lone Peak Mid Mesh 3.5Arc'Teryx11Technical Specs
Ideal Uses: Trail Running, Hiking, Fastpacking, Warm Weather Conditions
Cushioning: Moderate
Stack Height: 25 mm
Weight: 9.7 oz. / 275 g
Designed to Improve: Natural Foot Positioning, Walking Form, Toe Splay, Comfort
Platform: Fully Cushioned Zero Drop™ platform and FootShape™ toe box
Last: SD5-W
Midsole: Dual Layer EVA / A-Bound™
Outsole: DuraTread™ Rubber with TrailClaw™
Insole: 5 mm, Mountain Footbed
Upper: Abrasion-Resistant Mesh with Minimal Seams
Other Features: Sandwiched StoneGuard™ Rock Protection next to the foot; Natural Ride System, 4-Point GaiterTrap™ System, DuraTread™ Weight: 9.7 oz. / 275 g California Prop 65 Warning
WARNING: This product contains one or more chemicals known to the State of California to cause cancer, birth defects or other reproductive harm. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/altra-women-s-lone-peak-mid-mesh-3-5-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/altra-women-s-lone-peak-mid-mesh-3-5-50.jpgArc'Teryxhttps://s.turbifycdn.com/aah/optacticalgear/arc-teryx-alpha-lt-jacket-gen-2-level-6-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/arc-teryx-alpha-lt-jacket-crocodile-level-6-45.jpgitem.optacticalgear-pagetuoffclit296290649487Sold Out Arc'Teryx Alpha LT Jacket GEN 2 (Level 6)Arc'Teryx Alpha LT In Stock11GOVERNMENT SALES ONLY. YOU MUST PROVIDE YOUR OFFICIAL MILITARY, LAW ENFORCEMENT, OR GOV EMAIL ADDRESS DURING CHECK OUT IN ORDER TO PLACE AN ORDER FOR THIS ITEM. FAILURE TO PROVIDE OFFICIAL MIL/LE/GOV EMAIL CREDENTIALS WILL CAUSE DELAY AND POSSIBLE CANCELLATION OF YOUR ORDER. Shipment Policy – Authorized United States retailers, including authorized internet dealers, are not permitted to distribute, sell or ship this product outside the 50 United States of America Design:
Lightweight and packable waterproof, windproof/breathable jacket that is comfortable to wear during fast travel under inclement conditions. Next generation GORE-TEX® Pro fabric responds rapidly with a greatly enhanced rate of breathability to transfer moisture vapour away from the body and regulate temperature. Media ports, matte zippers and compatibility with insertion and extraction equipment add to the jacket's operational function. Features:
• N40p-X GORE-TEX® Pro fabric is fully waterproof and windproof, and highly breathable, engineered to maintain comfort during frequent work/rest cycles
• Articulation in the shoulders and elbows provides room for a full range of unrestricted motion
• #5 Vislon WaterTight™ centre zipper with back flap is tough and easy to operate
• WaterTight™ pit zippers vent heat rapidly
• StormHood™ blocks drafts, protects neck, fits over helmet; can be stowed using elastic hanger loop
• Two chest pockets work with load carriage equipment and have media ports to allow for internal routing of communications cables; internal chest pocket
• HemLock™ removable foam inserts keep the jacket hem from riding up under a harness and hipbelt Care:
• Machine wash in warm water.
• Double rinse.
• Do not use fabric softener.
• Tumble dry on medium heat.
• Do not iron. Weight: 10 g / 14.5 oz This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/arc-teryx-alpha-lt-jacket-crocodile-level-6-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/arc-teryx-alpha-lt-jacket-crocodile-level-6-52.jpgArc'Teryx Alpha LT In Stockhttps://s.turbifycdn.com/aah/optacticalgear/blowout-asp-tri-fold-restraints-black-pack-of-5-r-8.jpgcustom-itemoptacticalgear-pagetuoffclitblasptrreblp22.515Sold Out ASP Tri-Fold Restraints - Black - Pack of 5 (R)11Features
- Easily carried
- Rapidly applied
- Oversized loops
- Smooth pull
- Strap Length: 21.25"
- Strap Width: .5"
- Strap Thickness: .095" Imported These were found during a recent inventory. The pack held 10, but the others were used for training. This is a pack of 5 brand new ASP Tri-Folds. ]]>1https://s.turbifycdn.com/aah/optacticalgear/blowout-asp-tri-fold-restraints-black-pack-of-5-r-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/blowout-asp-tri-fold-restraints-black-pack-of-5-r-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/blowout-belleville-icwt-boots-tan-with-inserts-size-8-5-30.jpgcustom-itemoptacticalgear-pagetuoffclitblbeicbotanw89.9560Sold Out Belleville ICWT Boots - Tan - With Inserts - Size 8.5OPT11Features
- VANGUARD Running Shoe Sole Construction
- Upper Material - Desert Tan Leather Suede
- GORE-TEX
- Lining - OMAHA Moisture Wicking Lining
- Cushion Midsole - Polyurethane
- Outsole - Rubber, VIBRAM Sierra
- Polyurethane Removable Insert
- Height - 8" Standard US Military Height
- Comes with 2 pairs of insulated removable booties Made in the USA Issued, never worn, brand new condition. Minor scuffs from storage. ]]>1https://s.turbifycdn.com/aah/optacticalgear/blowout-belleville-icwt-boots-tan-with-inserts-size-8-5-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/blowout-belleville-icwt-boots-tan-with-inserts-size-8-5-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-hiker-micro-crew-cushion-1466-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-hiker-micro-crew-cushion-1466-11.jpgcustom-itemoptacticalgear-pagetuoffclitcldatohimicr2118.9Sold Out Darn Tough Hiker Micro Crew Cushion 146611Features Performance Fit: No slipping, no bunching, and no blisters. Fine Gauge Knitting: Unprecedented durability and our unique “put it on, forget it’s on” feel. Fast Action Wicking: Pulls moisture away from skin. Fast drying. All Weather Performance: Cool in the summer, warm in the winter. Naturally Antimicrobial: Repels bacteria and odor. Guaranteed For Life: No strings. No conditions. For life. Merino Wool: The ultimate fiber for breathability and comfort in all conditions. True Seamless™: Undetectable seam fusion for an ultra smooth, invisible feel. Specs Cushion: Mid-level cushion density under foot. A warm and ultra-comfortable choice when conditions demand it. Micro Crew Height: A shorter, more concise take on the traditional crew height. Peeks just above the top of a standard hiking boot. 61% Merino Wool, 36% Nylon, 3% Lycra® Spandex]]>1https://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-hiker-micro-crew-cushion-1466-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-hiker-micro-crew-cushion-1466-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/darn-tough-no-show-light-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/darn-tough-no-show-light-38.jpgcustom-itemoptacticalgear-pagetuoffclit1451437158Sold Out Darn Tough No Show LightDarn Tough11sizechart28Features Performance Fit: No slipping, no bunching, and no blisters. Fine Gauge Knitting: Unprecedented durability and our unique “put it on, forget it’s on” feel. Fast Action Wicking: Pulls moisture away from skin. Fast drying. All Weather Performance: Cool in the summer, warm in the winter. Naturally Antimicrobial: Repels bacteria and odor. Guaranteed For Life: No strings. No conditions. For life. Merino Wool: The ultimate fiber for breathability and comfort in all conditions. True Seamless™: Undetectable seam fusion for an ultra smooth, invisible feel. Specs Light: Built light, darn comfy and super strong—substantial construction for a lightweight, sure fit.� No-Show Height: The toughest sock you’ll never see. When your shoes are on this sock is gone. 52% Merino Wool, 44% Nylon, 4% Lycra® Spandex]]>1https://s.turbifycdn.com/aah/optacticalgear/darn-tough-no-show-light-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/darn-tough-no-show-light-48.jpgDarn Toughhttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-boot-cushion-8.jpgcustom-itemoptacticalgear-pagetuoffclitcldatotabocu2724.3Sold Out Darn Tough Tactical Boot Cushion 402111Features Performance Fit: No slipping, no bunching, and no blisters. Fine Gauge Knitting: Unprecedented durability and our unique “put it on, forget it’s on” feel. Fast Action Wicking: Pulls moisture away from skin. Fast drying. All Weather Performance: Cool in the summer, warm in the winter. Naturally Antimicrobial: Repels bacteria and odor. Guaranteed For Life: No strings. No conditions. For life. Merino Wool: The ultimate fiber for breathability and comfort in all conditions. True Seamless™: Undetectable seam fusion for an ultra smooth, invisible feel. Specs Cushion: Mid-level cushion density under foot. A warm and ultra-comfortable choice when conditions demand it. 62% Merino Wool 36% Nylon 2% Lycra® Spandex]]>1https://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-boot-cushion-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-boot-cushion-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-boot-extra-cushion-4033-8.jpgcustom-itemoptacticalgear-pagetuoffclitcldatotaboex2926.1Sold Out Darn Tough Tactical Boot Extra Cushion 403311Features Performance Fit: No slipping, no bunching, and no blisters. Fine Gauge Knitting: Unprecedented durability and our unique “put it on, forget it’s on” feel. Fast Action Wicking: Pulls moisture away from skin. Fast drying. All Weather Performance: Cool in the summer, warm in the winter. Naturally Antimicrobial: Repels bacteria and odor. Guaranteed For Life: No strings. No conditions. For life. Merino Wool: The ultimate fiber for breathability and comfort in all conditions. Specs Extra Cushion: Our thickest, burliest and highest density cushioning makes for a big, bad monster of a sock. 80% Merino Wool 19% Nylon 1% Lycra® Spandex]]>1https://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-boot-extra-cushion-4033-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-boot-extra-cushion-4033-12.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-boot-full-cushion-4022-8.jpgcustom-itemoptacticalgear-pagetuoffclitcldatotabofu2825.2Sold Out Darn Tough Tactical Boot Full Cushion 4022Darn Tough11Features Performance Fit: No slipping, no bunching, and no blisters. Fine Gauge Knitting: Unprecedented durability and our unique “put it on, forget it’s on” feel. F ast Action Wicking: Pulls moisture away from skin. Fast drying. All Weather Performance: Cool in the summer, warm in the winter. Naturally Antimicrobial: Repels bacteria and odor. Guaranteed For Life: No strings. No conditions. For life. Merino Wool: The ultimate fiber for breathability and comfort in all conditions. True Seamless™: Undetectable seam fusion for an ultra smooth, invisible feel. Specs Full Cushion: High density cushioning throughout the entire sock for full on comfort and performance. 64% Merino Wool 34% Nylon 2% Lycra® Spandex]]>1https://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-boot-full-cushion-4022-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-boot-full-cushion-4022-12.jpgDarn Toughhttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-micro-crew-light-4018-8.jpgcustom-itemoptacticalgear-pagetuoffclitcldatotamicr2118.9Sold Out Darn Tough Tactical Micro Crew Light 401811Features Performance Fit: No slipping, no bunching, and no blisters. Fine Gauge Knitting: Unprecedented durability and our unique “put it on, forget it’s on” feel. Fast Action Wicking: Pulls moisture away from skin. Fast drying. All Weather Performance: Cool in the summer, warm in the winter. Naturally Antimicrobial: Repels bacteria and odor. Guaranteed For Life: No strings. No conditions. For life. Merino Wool: The ultimate fiber for breathability and comfort in all conditions. True Seamless™: Undetectable seam fusion for an ultra smooth, invisible feel. Specs Light: Built light, darn comfy and super strong—substantial construction for a lightweight, sure fit.ť Micro Crew Height: A shorter, more concise take on the traditional crew height. Peeks just above the top of a standard hiking boot. 54% Merino Wool 44% Nylon 2% Lycra® Spandex See below for sizing chart.]]>1https://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-micro-crew-light-4018-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-micro-crew-light-4018-12.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-micro-crew-light-cushion-3001-8.jpgcustom-itemoptacticalgear-pagetuoffclitcldatotamicr12219.8Sold Out Darn Tough Tactical Micro Crew Light Cushion 300111Features Performance Fit: No slipping, no bunching, and no blisters. Fine Gauge Knitting: Unprecedented durability and our unique “put it on, forget it’s on” feel. Fast Action Wicking: Pulls moisture away from skin. Fast drying. All Weather Performance: Cool in the summer, warm in the winter. Naturally Antimicrobial: Repels bacteria and odor. Guaranteed For Life: No strings. No conditions. For life. Merino Wool: The ultimate fiber for breathability and comfort in all conditions. True Seamless™: Undetectable seam fusion for an ultra smooth, invisible feel. Specs Light Cushion: Light and strong with a thin layer of cushioning along base of foot. Our most versatile construction. Micro Crew Height: A shorter, more concise take on the traditional crew height. Peeks just above the top of a standard hiking boot. 49% Nylon 48% Merino Wool 3% Lycra® Spandex See below for sizing chart.]]>1https://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-micro-crew-light-cushion-3001-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-micro-crew-light-cushion-3001-12.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-mid-calf-light-cushion-3005-8.jpgcustom-itemoptacticalgear-pagetuoffclitcldatotamili2320.7Sold Out Darn Tough Tactical Mid-Calf Light Cushion 300511Features Performance Fit: No slipping, no bunching, and no blisters. Fine Gauge Knitting: Unprecedented durability and our unique “put it on, forget it’s on” feel. Fast Action Wicking: Pulls moisture away from skin. Fast drying. All Weather Performance: Cool in the summer, warm in the winter. Naturally Antimicrobial: Repels bacteria and odor. Guaranteed For Life: No strings. No conditions. For life. Merino Wool: The ultimate fiber for breathability and comfort in all conditions. True Seamless™: Undetectable seam fusion for an ultra smooth, invisible feel. Specs Light Cushion: Light and strong with a thin layer of cushioning along base of foot. Our most versatile construction. Mid-Calf Height: A go-to, working height that’s always ready to take on more. 56% Nylon 41% Merino Wool 3% Lycra® Spandex See below for sizing chart.]]>1https://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-mid-calf-light-cushion-3005-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/clearance-darn-tough-tactical-mid-calf-light-cushion-3005-12.jpghttps://s.turbifycdn.com/aah/optacticalgear/darn-tough-tactical-over-the-calf-extra-cushion-25.jpgcustom-itemoptacticalgear-pagetuoffclit145T40503015Sold Out Darn Tough Tactical Over-The-Calf Extra CushionDarn Tough11sizechart27Features Performance Fit: No slipping, no bunching, and no blisters. Fine Gauge Knitting: Unprecedented durability and our unique “put it on, forget it’s on” feel. Fast Action Wicking: Pulls moisture away from skin. Fast drying. All Weather Performance: Cool in the summer, warm in the winter. Naturally Antimicrobial: Repels bacteria and odor. Guaranteed For Life: No strings. No conditions. For life. Merino Wool: The ultimate fiber for breathability and comfort in all conditions. Specs Extra Cushion: Our thickest, burliest and highest density cushioning makes for a big, bad monster of a sock. Over the Calf Height: The name says it all. The ultimate height for keeping the outside—out. 79% Merino Wool 20% Nylon 1% Lycra® Spandex]]>1https://s.turbifycdn.com/aah/optacticalgear/darn-tough-tactical-over-the-calf-extra-cushion-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/darn-tough-tactical-over-the-calf-extra-cushion-32.jpgDarn Toughhttps://s.turbifycdn.com/aah/optacticalgear/good-to-go-classic-marinara-with-pasta-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/good-to-go-classic-marinara-with-pasta-38.jpgcustom-itemoptacticalgear-pagetuoffclit13210047.755Sold Out Good To-Go Classic Marinara with PastaGood To-Go11If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Italian Tomato Sauce with Brown Rice Pasta There is nothing more comforting than a steaming bowl of slow simmered marinara sauce over pasta. Our classic Italian tomato sauce is served with the best brown rice pasta we could find. Brown rice pasta that even wheat pasta enthusiasts love
Classic Italian herbs like basil, oregano and thyme flavor the traditional sauce
Gluten-free
Vegan
5-year shelf life Serving Sizes:
• Single: 3.5 oz
• Double: 7 oz (+$6.50) Nutritional info shown is from the 7 ounce package NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/good-to-go-classic-marinara-with-pasta-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/good-to-go-classic-marinara-with-pasta-50.jpgGood To-Gohttps://s.turbifycdn.com/aah/optacticalgear/good-to-go-thai-curry-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/good-to-go-thai-curry-38.jpgcustom-itemoptacticalgear-pagetuoffclit13210037.755Sold Out Good To-Go Thai CurryGood To-Go11If ordering 10+ meals, additional shipping fees may apply. This is to due to item's size. Spicy yellow coconut curry with vegetables and jasmine rice This spicy yellow coconut curry was our first meal to win the Backpacker Magazine Editors' Choice Award in 2014 and it’s still a favorite among Good To-Go loyalists. Loaded with broccoli, cauliflower, peas and green beans
Thai chiles give this dish the right amount of heat and provide immunity benefits
Coconut milk, lemongrass and tamarind contribute to the unique flavors
Fragrant jasmine rice completes the true Thai experience
Gluten-free
Pescatarian
5-year shelf life Serving Sizes:
• Single: 3.4 oz
• Double: 6.6 oz (+$6.50) Nutritional info shown is from the 6.6 ounce package NO RETURNS ON FOOD ITEMS]]>1https://s.turbifycdn.com/aah/optacticalgear/good-to-go-thai-curry-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/good-to-go-thai-curry-50.jpgGood To-Gohttps://s.turbifycdn.com/aah/optacticalgear/blowout-hodge-defense-alg-daniel-defense-14-5-p-w-upper-receiver-complete-r-7.jpgcustom-itemoptacticalgear-pagetuoffclitblhodealgdad13001100Sold Out Hodge Defense - ALG - Daniel Defense 14.5 P-W Upper Receiver - Complete (R)11Assembled by Jim Hodge of HDSI Hodge Defense AU2 Upper Receiver
• Forged Aluminum Lithium Upper Receiver with enhanced forgings
• Includes Bar Stock Forward Assist and Ejection Port Cover. ALG Defense EMR V2 13 inch Handguard
• Lightweight Design
• M-LOK compatible
• Machined Picatinny rail section at the muzzle end of the rail
• Includes2 integrated anti-rotational QD slots at the base of the rail at both 2 and 10 o'clock positions Daniel Defense Light Weight (LW) 5.56mm, 14.5", Mid-Length Gas System, 1:7 Twist
• Lightweight Design
• Cold Hammer Forged
• 4150 Chrome Moly Vanadium steel
• Mil-spec heavy phosphate coated
• Chrome lined with mid-length gas system Radian Raptor LT Charging Handle, Hodge Defense Branding
• Machined from 7075 aluminum
• MILSPEC Type III hard anodized
• Over-molded with high-strength, fiberglass reinforced polymer Mil-Spec Bolt Carrier Group
• There is nothing special about this BCG, it's a standard Mil-Spec BCG. SureFire SF3P-556-1/2-28 Flash Hider, Pinned and Welded
• Three-prong flash hider
• Typically reduces more than 99% muzzle flash
• Multiple bearing surfaces for accurate suppressor alignment
• U.S. mill-certified heat-treated stainless steel bar stock
• DLC-coated to resist erosion for consistent high performance
• Robust tines built to withstand the rigors of combat
• Carefully inspected for concentricity and alignmen
• Mounts any SureFire SOCOM Series Fast-Attach suppressor This was a side project I did with Jim Hodge working on creating lightweight uppers. This has only about 20 rounds through it.]]>1https://s.turbifycdn.com/aah/optacticalgear/blowout-hodge-defense-alg-daniel-defense-14-5-p-w-upper-receiver-complete-r-8.jpghttps://s.turbifycdn.com/aah/optacticalgear/blowout-hodge-defense-alg-daniel-defense-14-5-p-w-upper-receiver-complete-r-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-au-mod-2-upper-receiver-r-available-soon-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-au-mod-2-upper-receiver-r-available-soon-39.jpgcustom-itemoptacticalgear-pagetuoffclit119MOD2UPPER17001649.99Sold Out Hodge Defense AU-MOD 2 Upper Receiver (R)11• Forged Aluminum Lithium Upper Receiver with enhanced forgings, reverse compatible with mil-spec components. Includes Bar Stock Forward Assist and Ejection Port Cover.
• Cold Hammer Forged Barrel direct from FN made to meet Hodge Defense specs, Chrome Lined, Machine Gun Steel for extreme use and significantly increased barrel life, Micro Pinned Gas Block, 5.56 NATO Caliber. Includes Gas Tube.
• 7075-T6 Aluminum Wedge Lock Rail, precision fit Titanium Barrel Nut, M-LOK mounting compatibility along the 3, 6, and 9 o'clock positions Made in the USA, custom fitted by the man himself. NFA DISCLAIMER/WARNING: The non-pinned and welded clone URGI upper receiver does not meet the 16" minimum barrel length requirement, and requires registration and a tax stamp with the Bureau of Alcohol, Tobacco, Firearms and Explosives (BATFE) when assembled into a complete rifle. Additional state and local restrictions may apply. It is the sole responsibility of the buyer to comply with any and all applicable laws. NOTE: Upper does NOT include Bolt Carrier Group, Charging Handle, or Muzzle Device. ]]>1https://s.turbifycdn.com/aah/optacticalgear/hodge-defense-au-mod-2-upper-receiver-r-available-soon-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-au-mod-2-upper-receiver-r-available-soon-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-deer-john-hat-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-deer-john-hat-34.jpgcustom-itemoptacticalgear-pagetuoffclitHDJDHAT30Sold Out Hodge Defense Deer John Hat11 If you get it, you get it, small batch run of no nonsense gear... Adjustable strap back closure, ripstop material hat, with Hodge Defense logo embroidered on the front, and Shamrock embroidered on the rear. No button on top for comfort when using over the head ear protection. Ranger Green in color ripstop material. Logo is Green with Yellow Lettering.1https://s.turbifycdn.com/aah/optacticalgear/hodge-defense-deer-john-hat-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-deer-john-hat-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-gray-man-hat-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-gray-man-hat-34.jpgcustom-itemoptacticalgear-pagetuoffclitHDGRMNHAT30Sold Out Hodge Defense Gray Man Hat11If you get it, you get it, small batch run of no nonsense gear... Adjustable strap back closure, ripstop material hat, with Hodge Defense logo embroidered on the front, and Shamrock embroidered on the rear. No button on top for comfort when using over the head ear protection. Gray Ripstop material. Logo is White with Hodge Red Lettering.1https://s.turbifycdn.com/aah/optacticalgear/hodge-defense-gray-man-hat-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-gray-man-hat-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-multicam-black-trucker-hat-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-multicam-black-trucker-hat-34.jpgcustom-itemoptacticalgear-pagetuoffclitHDWATRPH30Sold Out Hodge Defense Multicam Black Trucker Hat11Hat Color: Multicam Black Ripstop, Dark Green Trucker Mesh Hodge Patch Options:
• White Hodge Logo Patch
• Beige Hodge Logo Patch Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/hodge-defense-multicam-black-trucker-hat-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/hodge-defense-multicam-black-trucker-hat-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/hsgi-hat-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/hsgi-hat-66.jpgitem.optacticalgear-pagetuoffclit39TBC28SOLD OUT HSGI HatHSGI11THIS ITEM IS NO LONGER STOCKED AND WILL BE DELETED FROM THE WEBSITE SOON. The HSGI® Tactical Baseball Cap is constructed with ripstop material and matching loop material. It features an adjustable Velcro® head strap to fit the small to x-large sizes. Features a 2” x 3.5" loop panel on the front, one 1" x 3" loop panel on the rear, one 1" x 1" loop panel on the crown; and an embroidered American flag at 3oclock and our logo embroidered onto the front loop panel.. Made entirely in the USA. ]]>1https://s.turbifycdn.com/aah/optacticalgear/hsgi-hat-79.jpghttps://s.turbifycdn.com/aah/optacticalgear/hsgi-hat-80.jpgHSGIhttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-foot-sleeve-for-plantar-fasciitis-relieves-heel-foot-pain-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-foot-sleeve-for-plantar-fasciitis-relieves-heel-foot-pain-35.jpgcustom-itemoptacticalgear-pagetuoffclit134LPF31.9928.99Sold Out Legend Compression Foot Sleeve for Plantar Fasciitis - PairLegend111https://s.turbifycdn.com/aah/optacticalgear/legend-compression-foot-sleeve-for-plantar-fasciitis-relieves-heel-foot-pain-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-foot-sleeve-for-plantar-fasciitis-relieves-heel-foot-pain-45.jpgLegendhttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-leg-sleeves-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-leg-sleeves-38.jpgcustom-itemoptacticalgear-pagetuoffclit134LCS44.9522Sold Out Legend Compression Leg SleevesLegend11Proudly Made in the USA. Color: Black]]>1https://s.turbifycdn.com/aah/optacticalgear/legend-compression-leg-sleeves-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-leg-sleeves-48.jpgLegendhttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-performance-socks-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-performance-socks-40.jpgcustom-itemoptacticalgear-pagetuoffclit134LPS49.9542.49Sold Out Legend Compression Performance SocksLegend11Proudly Made in the USA Color: Black]]>1https://s.turbifycdn.com/aah/optacticalgear/legend-compression-performance-socks-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-performance-socks-50.jpgLegendhttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-recovery-socks-20-30-mmhg-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-recovery-socks-20-30-mmhg-40.jpgcustom-itemoptacticalgear-pagetuoffclit134LRS49.9942.49Sold Out Legend Compression Recovery Socks 20-30 mmHgLegend11- Reduce post-exercise fatigue
- Decrease muscle soreness and injury
- Increase oxygen levels and blood circulation
- Shorter recovery cycle
- Speed muscle repair
- Reduction of lactic acid
- Reduced swelling
- Relieves shin splints, calf cramps, Achilles injury and pulled muscle
- Reduce muscle damage
- Seamless toe for comfort
- Quality spandex for ultimate stretch and comfort
- Great for travel LEGEND Compression Recovery Socks are designed for post-exercise recovery and travel. These legendary socks provide a higher level of graduated compression to reduce lactic acid, increase oxygen levels, improve blood flow and promote faster muscle recovery & performance. We recommend wearing a pair after a long run and all high impact activities to reduce soreness. They are ideal for traveling especially after team sports. With these compression recovery socks, you will find your legs and feet recover more quickly. The goal at LEGEND Compression Wear is to help extend the life of your legs so you can continue your sporting passion. Proudly Made in the USA Color: Black]]>1https://s.turbifycdn.com/aah/optacticalgear/legend-compression-recovery-socks-20-30-mmhg-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/legend-compression-recovery-socks-20-30-mmhg-50.jpgLegendhttps://s.turbifycdn.com/aah/optacticalgear/blowout-magpul-light-mount-v-block-and-rings-r-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/blowout-magpul-light-mount-v-block-and-rings-r-43.jpgcustom-itemoptacticalgear-pagetuoffclitblmalimovand18.9515Sold Out Magpul Light Mount V-Block and Rings (R)OPT11Brand new, in original packaging (old packaging). Inset photo is of actual item.]]>1https://s.turbifycdn.com/aah/optacticalgear/blowout-magpul-light-mount-v-block-and-rings-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/blowout-magpul-light-mount-v-block-and-rings-r-56.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/blowout-mayflower-mayflower-low-profile-armor-carrier-multicam-large-large-cummerbund-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/blowout-mayflower-mayflower-low-profile-armor-carrier-multicam-large-large-cummerbund-17.jpgcustom-itemoptacticalgear-pagetuoffclitblmamalowpra268175Sold Out Mayflower Mayflower Low Profile Armor Carrier - Multicam - Large - Large CummerbundOPT11This is the original version without a divided cummerbund The Mayflower Low-Profile Armor Carrier (LPAC) is designed to provide the wearer with a high degree of mobility while providing an acceptable amount of soft armor coverage, or both soft and hard armor coverage. The hard armor plates are contained in pockets attached to the outside of the soft armor carrier allowing the soft armor to mold to the wearers body for long duration mission comfort. The back side of the front panel features elastic retainers for routing wires. The Low-Profile Armor Carrier features webbing for use with Removable ITW-Nexus SwiftClip Buckles on the front of the vest to allow the individual to mount various Chest Rigs and Placards directly to the carrier. This configuration allows the individual to use the same loadout with or without armor or have multiple chest rigs configured for different mission requirements. The vest also includes a front kangaroo pouch that accepts our magazine inserts. The LPAC comes with a Low-Profile Elastic Cummerbund and features removable buckles to attach a groin/lap panel (sold separately). All materials and workmanship are 100% made in the USA. Features:
• Features 3D spacer mesh padding along the inner face of the plate pockets for comfort and ventilation
• Compatible with SwiftClip Chest Rigs and Placards (SwiftClips on the front are removable)
• Low-Profile Elastic Cummerbund for quick don/doff and secure fit while moving/fighting, also ensures no interference with duty belt access. Can be replaced with the Mayflower MOLLE Cummerbund (sold separately) for load and armor carriage
• Integrated Drag Handle
• MOLLE webbing along the lower rear portion of the carrier for attaching IFAK/Medical Kit and other mission essentials
• Stretchable shoulder pads made from soft Tweave material offer greater range of motion and less chafing along the neck line. Foam padding for comfort on the underside of the pad, with the ability to run wiring and tubes through the pad itself
• Material: 500D Cordura This vest is designed to fit proprietary soft armor inserts. Some other brands of soft armor may fit depending on size. Approximate dimensions of front and back panels: Large:
• Front Panel: Height Lowest part of the V portion of the neck = 14.5”, Height Tallest part of the V portion = 16”
• Front Panel Thinnest Width = 11", Widest Width = 24.5”
• Back Panel: Height = 17"
• Back Panel: Thinnest Width = 12.5", Widest Width = 24.5” PLEASE READ: This is the old style LPAC cummerbund. History: this carrier has been in our warehouse for a few years without a cummerbund, or shoulder pads; we special ordered the components to complete it so we could bring it to market. This carrier is 100% functional, and the price has been reduced due to the fact that it is the old design.]]>1https://s.turbifycdn.com/aah/optacticalgear/blowout-mayflower-mayflower-low-profile-armor-carrier-multicam-large-large-cummerbund-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/blowout-mayflower-mayflower-low-profile-armor-carrier-multicam-large-large-cummerbund-30.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/opt-berry-compliant-enhanced-poncho-liner-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-berry-compliant-enhanced-poncho-liner-46.jpgcustom-itemoptacticalgear-pageblah50OPTBCPL134.95119.95Sold Out OPT Berry Compliant Enhanced Poncho Liner11THE NEED:
A better Multicam Berry Compliant USGI Poncho Liner. THE SOLUTION:
OPT's owner approached Wild Things about making enhanced modifications to the time proven, simple design of the USGI Poncho Liner, while maintaining the size and styling of the liner to couple with USGI Ponchos. THE OUTCOME:
Incredible Woobie Goodness. The quality you expect from Wild Things products mixed with the experience based ingenuity you expect from OPT. An affordable, GENUINE Multicam USGI Poncho Liner; made with Soft 70 denier nylon treated with NanoSphere® DWR, quilted with 2 oz PrimaLoft synthetic insulation, multiple tie-downs along 4 sides. Tech Specs:
•Soft 70 denier Multicam nylon treated with NanoSphere® DWR for high level of water resistance
•Quilted with 2 oz PrimaLoft® synthetic insulation for greater warmth than issued poncho liners
•Multiple tie-downs along all 4 sides
•Weight (approximate): 2 lb 2 oz
•Dimensions: 90 x 65 inches
•Incredible Woobie Goodness
•Made in U.S.A.
•Berry Amendment Compliant THIS ITEM HAS BEEN COUCH TESTED EXTENSIVELY DURING NUMEROUS TV SHOW MARATHONS, AS WELL AS IN A FIELD ENVIRONMENT WITH A 100% PASS RATE ON THE INFANTRY FIELD AWESOMENESS PROTOCOL (I-FAP). All materials and workmanship are 100% made in the USA This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-berry-compliant-enhanced-poncho-liner-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-berry-compliant-enhanced-poncho-liner-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-multicam-black-vinyl-9.jpgcustom-itemoptacticalgear-pagetuoffclitopviblpipala117.9912Sold Out OPT-Spartan Village Blackbeard Pirate Patch - Large Size - Multicam - Black VinylOPT11Specs:
• 3 x 5 inch size
• Cordura material with matte vinyl background
• Velcro Hook backing Types:
• Black Vinyl background: visible spectrum only
• Black IR background: Infrared reflective Made in the USA. This was used on displays for trade shows and events. It has minor wear, but nothing affecting function.]]>1https://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-multicam-black-vinyl-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/opt-spartan-village-blackbeard-pirate-patch-large-size-multicam-black-vinyl-16.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/phlster-classic-holster-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-classic-holster-39.jpgcustom-itemoptacticalgear-pagetuoffclit101GL94CLS0179.9955Sold Out PHLster Classic HolsterPHLster11• Weight 0.25 lbs
• Dimensions 8 × 5.5 × 3 in Fit Options:
• Glock 26/27/33, 19/23/32, 17/22/31, 34/35
• Sig P320 No Hassle Warranty:
Phlster offers a no-hassle warranty policy. It doesn’t matter if you’re the original owner or if you acquired your gear second hand, if it’s broken, they’ll repair or replace the item. ]]>1https://s.turbifycdn.com/aah/optacticalgear/phlster-classic-holster-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/phlster-classic-holster-49.jpgPHLsterhttps://s.turbifycdn.com/aah/optacticalgear/re-factor-hitman-target-30.jpgcustom-itemoptacticalgear-pagetargets11025412.5 10 13.9 25 19.75 50 37.5 100 68SOLD OUT RE Factor Hitman TargetRE Factor11Metric and US/Imperial units of measure
Grid overlay system
Made in the USA These targets have a graded price scale:
10 Target: $1.39/piece
25 Targets: $0.79/piece
50 Targets: $0.75/piece
100 Targets: $0.68/piece Targets are normally in stock for quantities of 500 or less. If out of stock, lead time is approximately 1 week. UPS OR INTERNATIONAL SHIPPING OPTIONS ONLY. No $5 Flat Rate for this item. CONTACT US FOR SHIPPING COST IF ORDERING MORE THAN 100 TARGETS. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/re-factor-hitman-target-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/re-factor-hitman-target-37.jpgRE Factorhttps://s.turbifycdn.com/aah/optacticalgear/re-factor-kill-zone-target-28.jpgcustom-itemoptacticalgear-pagetargets110RFTGTKZ2.5 10 13.9 25 19.75 50 37.5 100 68SOLD OUT RE Factor Kill Zone TargetRE Factor11• Measures: 23" x 35"
• IPSC overlay
• Standard human anatomy overlay
• Made in the USA These targets have a graded price scale:
10 Target: $1.39/piece
25 Targets: $0.79/piece
50 Targets: $0.75/piece
100 Targets: $0.68/piece Targets are normally in stock for quantities of 500 or less. If out of stock, lead time is approximately 1 week. UPS OR INTERNATIONAL SHIPPING OPTIONS ONLY. No $5 Flat Rate for this item. CONTACT US FOR SHIPPING COST IF ORDERING MORE THAN 100 TARGETS. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/re-factor-kill-zone-target-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/re-factor-kill-zone-target-35.jpgRE Factorhttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-dust-e-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-dust-e-41.jpgcustom-itemoptacticalgear-pagetuoffclit80SMR-DE00116.1514.5411SMR sold separately. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-dust-e-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-dust-e-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-smr-skeletonized-magazine-retention-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-smr-skeletonized-magazine-retention-65.jpgcustom-itemoptacticalgear-pagetuoffclit80SMR-001XXX19.917.9111litogeretr2SMR mounting adapters and Base Plates sold separately. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-smr-skeletonized-magazine-retention-79.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-smr-skeletonized-magazine-retention-80.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-smr-molle-adapter-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-smr-molle-adapter-59.jpgcustom-itemoptacticalgear-pagetuoffclit80SMR-MA001XX18.316.47111 x Gear Retention Track only. SMR and other accessories sold separately. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/s-s-precision-smr-molle-adapter-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-s-precision-smr-molle-adapter-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-face-mask-3-pack-khaki-tan-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-face-mask-3-pack-khaki-tan-62.jpgcustom-itemoptacticalgear-pagetuoffclit77DPPTRCM7.955Sold Out S.O. Tech First Responder Face Cover with Reusable LinersS.O. Tech11Mask Sold Individually. Includes 4 Liner Inserts. A Face Covering and Carrier to Extend the lifespan of your liners/filters: S.O.Tech designed a Ripstop cotton face covering with a double ply pocket to hold a non-medically rated disposable liner. The pocket on the face cover can also hold some models of N-95 or surgical masks made by other manufacturers. These face coverings are washable and reusable. Features:
• Materials - Khaki 6.5 oz 100% Cotton Ripstop, and a non-woven fabric liner.
• Aluminum or brass nose contour piece sewn-in and 1/4 inch elastic behind the head loops that are one-size-fits most. Elastic may or may not contain latex.
• Ripstop cotton is machine washable, durable and quick drying. Filters can be machine washed 5+ times, but we encourage users to hand wash and dry filter inserts rotating them and changing filter inserts each time.
• Dimensions: 4in ht, 7.25in wd, .25in dp, 2 x 11 in elastic
• Double pleated and overlapped back entry slit
• Each mask comes with 4 liner inserts
• One-size-fits all
• Wash and dry masks between uses rotating them and changing filter inserts each time. Mask Sold Individually, Includes:
1 x Mask
4 x Filters DISCLAIMER: This face mask insert may be used when FDA cleared masks are unavailable. The manufacturer recommends against use in a surgical setting or where significant exposure to liquid bodily or other hazardous fluids may be expected. Due to the Nature of this item, it cannot be returned. All Sales are final. Warranty is covered by the manufacturer.]]>1https://s.turbifycdn.com/aah/optacticalgear/s-o-tech-face-mask-3-pack-khaki-tan-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/s-o-tech-face-mask-3-pack-khaki-tan-72.jpgS.O. Techhttps://s.turbifycdn.com/aah/optacticalgear/blowout-smartcarry-holster-small-black-30.jpgcustom-itemoptacticalgear-pagetuoffclitblsmhosmbl6045Sold Out SmartCarry Holster - Small - BlackOPT11This was bought as a concealed carry holster for a Glock 42. It was used for a few weeks back in 2014 for a cross country move that OPT's Owner made. Since then it has seen no use. Item is in great condition. Made for waist size 27-31 inches, but worked just fine for my 33 inch waist.]]>1https://s.turbifycdn.com/aah/optacticalgear/blowout-smartcarry-holster-small-black-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/blowout-smartcarry-holster-small-black-39.jpgOPThttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-helmet-bead-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-helmet-bead-41.jpgcustom-itemoptacticalgear-pageclfige65SHB53.49Sold Out Spartan Blades Helmet BeadSpartan Blades111-Fits a double strand of 550 para-cord and most accessory cords.
-0.200" Dia lumen (hole) through bead
-One bead only, no para-cord provided.
-Many of our customers asked for these to tie their own lanyards, so here they are. Lanyard (optional) (+$3.00) -OEM replacement for Spartan Knives (fits most knives)
-US made 550 7-Stand Nylon Parachute Cord
-Tied with a Lanyard Knot
-6" - 6.5" Length
-Available in: Black, Olive, and Khaki Item is One Single Bead]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-blades-helmet-bead-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-helmet-bead-51.jpgSpartan Bladeshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoulder-cover-low-profile-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoulder-cover-low-profile-46.jpgcustom-itemoptacticalgear-pagetuoffclit132SC-LP16.9515.25Sold Out Spiritus Systems Shoulder Cover - Low ProfileSpiritus Systems11NOTE: The Shoulder Cover is part of the LV119 Plate Carrier System. This item does not include a Front Plate Bag, Rear Plate Bag, Cummerbund, Placards, or any other accessories. Additional components are required for proper use. Some images shown with optional accessories, sold separately. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoulder-cover-low-profile-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoulder-cover-low-profile-56.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/superfeet-black-insole-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/superfeet-black-insole-38.jpgcustom-itemoptacticalgear-pagetuoffclit14434__54.99Sold Out Superfeet Black InsoleSuperfeet11FEATURES:
A. HEEL CUP: Accommodating heel cup to help stabilize and support the foot B. LOW ARCH SUPERFEET SHAPE: Low arch orthotic support helps stabilize the foot, reducing stress on feet, ankles, knees and back C. DURABLE CONSTRUCTION: Superfeet insoles keep their shape, delivering reliable support and comfort for up to 12 months or 500 miles, whichever comes first D. ORGANIC ODOR-CONTROL COATING: All natural coating helps eliminate odor-causing bacteria E. REINFORCED STABILIZER CAP: The base of the insole that supports the rearfoot and provides structure and stability to the foam layer F. HIGH DENSITY FOAM: Closed-cell foam provides a firm foundaton to support the foot for long-lasting comfort. ]]>1https://s.turbifycdn.com/aah/optacticalgear/superfeet-black-insole-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/superfeet-black-insole-48.jpgSuperfeethttps://s.turbifycdn.com/aah/optacticalgear/surefire-xc2-a-irc-weaponlight-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-xc2-a-irc-weaponlight-r-53.jpgcustom-itemoptacticalgear-pagetuoffclit103XC2AIRC449404Sold Out SureFire XC2-A-IRC WeaponLight (R)Surefire11THIS ITEM IS NO LONGER STOCKED AND WILL BE DELETED FROM THE WEBSITE SOON. REQUIRES NIGHT VISION EQUIPMENT FOR PROPER USE Meet Your New Night Light. SureFire's smallest, most lightweight dedicated infrared (IR) handgun light, the SureFire XC2-A-IRC features a recoil-proof LED that’s focused by a multi-faceted reflector to create a broad 850nm MaxVision Beam® perfect for enhancing the capability and the image quality of modern night vision to see clearly and farther into the dark. The XC2-A-IRC’s 845nm infrared laser stands out when viewed with night vision devices and, once zeroed, rarely needs re-zeroing thanks to adjustment screws that won’t back out from the effects of recoil. The XC2-A-IRC won’t weigh down your handgun, making it a crucial addition to concealed carry pistols among other applications. Its compact body is constructed of lightweight but strong aerospace aluminum with a Mil-Spec hard anodized finish, so the XC2-A-IRC is rugged enough for everyday carry. Ambidextrous switching provides both momentary-and constant-on activation for precision control. Features
- Lightweight and ultra-compact; great for concealed carry
- Two modes: infrared illuminator + laser or infrared laser only
- Securely attaches to most Universal-rail-equipped handguns
- Integrated ambidextrous momentary- and constant-on switching
- Front-loading AAA battery compartment accommodates one lithium battery for extended runtime
- Works with lithium, NiMH rechargeable or alkaline AAA batteries Gasket sealed; weatherproof; the XC2-A-IRC is IPX7 rated KEY ATTRIBUTES
- HIGH OUTPUT: 50 milliWatts (850 nM)
- HIGH RUNTIME: 4 hours
- BATTERIES: One AAA lithium (incl.)
- SWITCHING: Ambidextrous momentary-on / ambidextrous tactical toggle tap
- LENGTH: 2.5 in (6.3 cm)
- DISTANCE: >50 meters w/ PVS 31A
- LASER OUTPUT: <0.7 milliWatts (845 nM) Class I BODY
- CONSTRUCTION: Aluminum
- FINISH: Mil-Spec Hard Anodized
- WEIGHT W/ BATTERIES: 1.8 oz (51 g)
- BEZEL DIAMETER: .375 in (.95 cm)
- LIQUID INGRESS PROTECTION: IPX7 ITAR Restricted, No International Shipping. Continental USA Shipping Addresses Only. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-xc2-a-irc-weaponlight-r-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-xc2-a-irc-weaponlight-r-67.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-chest-deck-multicam-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-chest-deck-multicam-38.jpgcustom-itemoptacticalgear-pagetuoffclit113MSW0334.531.99Sold Out Tactical Tailor / MSW Cell Phone Holder Chest DeskTactical Tailor11This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/milsim-west-chest-deck-multicam-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/milsim-west-chest-deck-multicam-48.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-40mm-2rd-m203-panel-38.jpgcustom-itemoptacticalgear-pagetuoffclit8310063LW29.6527.28Sold Out Tactical Tailor Fight Light 40mm 2rd M203 PanelTactical Tailor11The 40mm 2rd M203 Panel will hold two rounds of 40mm ammunition. Extra long hook and loop secured flaps adjust for various types of rounds from HE to illumination. The panel attaches to any modular webbing with two short MALICE CLIPS® (included). Available in MultiCam®, Coyote Brown, Black, and Ranger Green. Dimensions: 5" tall x 3" wide x 1.5" deep1https://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-40mm-2rd-m203-panel-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-40mm-2rd-m203-panel-45.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-7-62-double-mag-pouch-46.jpgcustom-itemoptacticalgear-pagetuoffclit837623935.88Sold Out Tactical Tailor Fight Light 7.62 / 6.8 x 51 Double Mag PouchTactical Tailor11Our Double 7.62 or 6.8x51 Mag Pouch will carry two 20-round 7.62 or 6.8x51 magazines for rifles such as the SCAR Heavy, M-14, HK-91, FN FAL, XM7, XM250, or most 20-round 7.62 rifle magazines. The pouch closes with a hook and loop flap and features the same bungee cinch system as many of our other mag pouches to keep your magazines quiet. Attaches to any MOLLE/PALS style webbing with two long MALICE CLIPS® (included). Measurements: 5.5" x 2.5" x 3" 1https://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-7-62-double-mag-pouch-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-7-62-double-mag-pouch-53.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-multi-purpose-pouch-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-multi-purpose-pouch-62.jpgitem.optacticalgear-pagetuoffclit8310005LW42.539.1Sold Out Tactical Tailor Fight Light Multi-Purpose PouchTactical Tailor11Multi Purpose Pouch Designed to hold various medium sized items or one 10 round .50 cal Barrett® magazine. Large compartment with smaller front pouch for compass, handcuffs, etc. ront flap secures with quick release buckle. The Tactical Tailor Fight Light line of tactical gear features the same combat tested designs as our regular gear but in a 30% lighter, FR lined package! 1https://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-multi-purpose-pouch-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-multi-purpose-pouch-72.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-multi-tool-pouch-37.jpgitem.optacticalgear-pagetuoffclit8310070LW17.3515.96Sold Out Tactical Tailor Fight Light Multi-Tool PouchTactical Tailor11Our Multi-Tool Pouch is designed to hold regular size multi-tools or folding knives. The pouch can also hold one pistol magazine when security is more important than speed. The flap is secured by an adjustable Fastex buckle. Attaches to almost any MOLLE/PALS style gear with the included short MALICE CLIP. The Tactical Tailor Fight Light line of tactical gear features the same combat tested designs as our regular gear but in a 30% lighter, FR lined package! 1https://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-multi-tool-pouch-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-multi-tool-pouch-44.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-strobe-compass-pouch-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-strobe-compass-pouch-61.jpgitem.optacticalgear-pagetuoffclit831001617.516.1Sold Out Tactical Tailor Strobe/ Compass PouchTactical Tailor11Strobe/Compass Pouch will hold the new and old Military strobe lights or a compass. The pouch has a grommet hole in the top for tying in a dummy cord. The pouch is made from Cordura nylon and closes with an adjustable Fastex buckle. The pouch can be attached to almost any belt, vest or pack using our new MALICE Clip System. Each pouch comes with two clips. Available in Ranger Green, Olive Drab, Black, Coyote, or Multicam. Measures 5" x 2.75" x 1.25"1https://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-strobe-compass-pouch-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-strobe-compass-pouch-71.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-hat-24.jpgcustom-itemoptacticalgear-pagetuoffclit98velhat14.9913.49Sold Out Velocity Systems HatVelocity Systems11THIS ITEM IS NO LONGER STOCKED AND WILL BE DELETED FROM THE WEBSITE SOON. Represent the Velocity Systems Brand with the Velocity System Hat Available in 3 colors:
Black with grey mesh
Grey with white mesh
Brown with tan mesh]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-hat-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-hat-31.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/xmre-lite-case-of-12-frh-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/xmre-lite-case-of-12-frh-45.jpgcustom-itemoptacticalgear-pagetuoffclit95XMREC12H136.99104.99Sold Out XMRE LITE – CASE OF 12 FRHXMRE11UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. If ordering multiple boxes, additional shipping fees may apply. This is to due to item's size. NO RETURNS ON FOOD ITEMS The XMRE® Lite is freshly packed with 600 to 900 calories of the best components on the market. These lightweight and waterproof XMREs are the perfect option to meet the critical requirements of government institutions, medical facilities, educational institutions, municipal entities, Law Enforcement, public service entities, and emergency preparedness programs. EACH XMRE® LITE (XM700) CONTAINS:
Entree, 2-3 snack /side components and an accessory kit including utensils and napkin. Flameless ration heater (FRH) . All components are packed in high-density water and tamper proof clear outer bag and embossed with a lot number (pack date) on each bag and case. FEATURES
• 600 – 900 Cal per meal
• Fully cooked, ready to eat meals
• No water or refrigeration required
• Weightless configuration and design.
• Extended Shelf Life
• Lot number (pack date) printed on case COMPONENT DETAILS:
• Entrée: Variety of beef, Pork, tuna, chicken or vegetarian options (See notes 1 below)
• Snack A: 1 or 2 Varieties of snacks (corn nuggets, Bread items, chickpeas, or other snack(s)
• Snack B: 1 or 2 Varieties of Cookies, Pastries, fruit mixes, bars, side dishes or other snack(s)
• Accessory Kit Includes: Utensil(s)/Napkin
• Heater – Non-Toxic Safe-Tested Flameless Ration Heater included with each meal
*Note (1): Entrée will be made available in shelf stable pouch, bowl or tray STANDARD CONFIGURATION:
12 meals per case / 3-4 menu varieties per case Case Weight: 12 lbs FRH VERSION = HEATER INCLUDED UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. If ordering multiple boxes, additional shipping fees may apply. This is to due to item's size. NO RETURNS ON FOOD ITEMS This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/xmre-lite-case-of-12-frh-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/xmre-lite-case-of-12-frh-58.jpgXMREhttps://s.turbifycdn.com/aah/optacticalgear/solgw-223-wylde-precision-spr-grade-barrel-all-lengths-r-12.jpgcustom-itemoptacticalgear-pagem4arupreandpSOLPRECISION-SPR-223325308.75SOLGW .223 Wylde PRECISION SPR Grade Barrel - All Lengths (R)Sons Of Liberty Gun Works111.223 Wylde Chamber
416 Stainless Steel
SPR Profile
1/7 Twist
5/8×24 Threaded Muzzle
.750-inch; Gas Block Journal
Black Oxide Finish
3 Groove Polygonal Rifling
Made in the USA. Note from OPT: The 5/8×24 Threaded Muzzle will NOT work with regular 5.56 (1/2x28) Threaded Muzzle Devices. You will need a standard 7.62 Muzzle Device for this barrel. NFA NOTICE:
Once this barrel is assembled into a complete firearm, it becomes a regulated item by the National Firearms Act (NFA). Check with your local and state laws for any further regulatory requirements. The buyer is responsible for compliance of all NFA rules and applicable laws. ]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-223-wylde-precision-spr-grade-barrel-all-lengths-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-223-wylde-precision-spr-grade-barrel-all-lengths-r-21.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-a5-buffer-kit-r-12.jpgcustom-itemoptacticalgear-pagem4arupgradesSOLA5KIT150142.5SOLGW A5 Buffer Kit (R)Sons Of Liberty Gun Works111Contents
- L9 A5 Receiver Extension
- Sprinco Green Spring
- B5 Systems QD End plate
- FCD Castle Nut
- A5H2 Buffer (may be black or brass-colored) Made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-a5-buffer-kit-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-a5-buffer-kit-r-21.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-bcg-5-56mm-300blk-158-carpenter-hard-chrome-coating-r-11.jpgcustom-itemoptacticalgear-pagem4arupreandpSOLBCG556CGROME250237.5SOLGW BCG 5.56mm/300BLK 158 Carpenter Hard Chrome Coating (R)Sons Of Liberty Gun Works111Bolt:
- Precision machined from Carpenter Technology No. 158 chrome-nickel alloy
- Heat treated per mil-spec,
- Shot peened per ASTM B851/SAE AMS2430S,
- Vibratory tumbled
- Individual high pressure/proof (HP) test
- Full Auto test fired at assembly
- Individual magnetic particle inspection ASTM E1444/E1444M (MP)
- Markings deep laser engraved (SP=Shot Peened, HP=High Pressure Tested, MP=Magnetic Particle Inspection.) Extractor:
- Precision machined from 4340 tool steel alloy per SAE AMS6415T/AMS6484D (vs 4140)
- Heat treated
- Shot peen per ASTM B851/SAE AMS2430S Extractor Retaining Pin:
- Precision machined and ground S7 Tool Steel
- Heat treated per ASTM A681-08
- Shot peened per mil-spec print Extractor Spring:
- Tactical Springs/Sprinco 5 coil, ASTM Grade A401 Chrome Silicon wire stock
- Heat treated
- Stress relieved, Molybdenum-Disulfide infused
- Cryogenic processed (Hidden post winding)
- Mil-spec black insert/synthetic elastomer extractor buffer (nitrile-butadiene, shore hardness 80+/-5 durometer per MIL-PRF-6855) Ejector:
- S7 Tool Steel
- Heat treated per ASTM A681-08
- Shot peened per Mil-Spec
- Ejector Spring:
- Heat treated
- Mil Spec Gas Rings:
- Standard stainless steel per Mil-Spec X3 Carrier:
- Machined from AISI 8620 aircraft quality alloy per ASTM A108/A322-13
- Full auto profile
- Heat-treated
- Carburized/strain relieved, hard chrome bore
- Precision ground gas key interface
- Sons of Liberty Battle Flag logo deep laser engraved Gas Key:
- Machined from 4130 Chromoly steel alloy per ASTM A108/A322-13
- Heat-treated; hard chrome internal
- Permatex sealed
- Grade 8 hex screws torqued and staked Hidden per mil-spec Cam Pin:
- Precision machined 4340 Chromoly steel alloy per SAE AMS6415T/AMS6484D
- Heat-treated/processed per mil-spec
- Solid film lubricant applied and cured per mil-spec Firing Pin:
- Precision machined 8640 steel alloy
- Heat treated/processed per mil-spec
- Hard chrome plate Firing Pin Retaining Pin:
- Precision machined from 1038 carbon steel
- Heat-treated/processed per mil-spec Made in the USA]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-bcg-5-56mm-300blk-158-carpenter-hard-chrome-coating-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-bcg-5-56mm-300blk-158-carpenter-hard-chrome-coating-r-21.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-bcg-5-56mm-300blk-158-carpenter-phosphate-r-13.jpgcustom-itemoptacticalgear-pagem4arupreandpSOLBCG556199179SOLGW BCG 5.56mm/300BLK 158 Carpenter Phosphate (R)Sons Of Liberty Gun Works111- Bolt is precision machined from Carpenter Technology No. 158 chrome-nickel alloy
- Carrier is machined from AISI 8620 aircraft quality alloy
- Sons of Liberty Battle Flag logo deep laser engraved
- Manganese Phosphate Finish Made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-bcg-5-56mm-300blk-158-carpenter-phosphate-r-21.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-bcg-5-56mm-300blk-158-carpenter-phosphate-r-22.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-blaster-starter-kit-r-11.jpgcustom-itemoptacticalgear-pagem4arupgradesSOLBSK5754.15SOLGW Blaster Starter Kit (R)Sons Of Liberty Gun Works111Includes
- Pivot Pin
- Takedown Pin
- Takedown pin Springs (x2)
- QPQ Steel Takedown Pins (x3)
- Mil-Spec Cast Bolt Catch
- Bolt Catch Buffer
- Bolt Catch Spring
- Mag Catch
- Steel Mag Button
- Mag Catch Spring
- Mil-Spec Cast Safety Selector
- QPQ Steel Safety Detent
- Selector Spring
- Buffer Retainer Pin
- Buffer Retainer Spring Made in the USA]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-blaster-starter-kit-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-blaster-starter-kit-r-21.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-m4-89-broadsword-upper-5-56nato-combat-barrel-v2-l89-m-lok-handguard-r-12.jpgcustom-itemoptacticalgear-pagecoupregrSOLM4L8912751211.25SOLGW Broadsword L89 Upper - 5.56NATO (R)Sons Of Liberty Gun Works111litosobcg5151• BROADSWORD-89 Billet Upper Receiver
• 5.56NATO V2 Combat Barrel - Cold Hammer Forged
• Matches M4-89 handguard and rail
• 7075-T6 Billet aluminum construction
• Hardcoat anodized black finish
• A2 Flash Hider (not pinned/welded)
• M4 feedramp extension
• L89 Handguard
• Forged Mil-Spec 7075 aluminum upper receiver Mil-Spec MIL-A-8625F anodized finish
• No BCG or Charging Handle Included
• Made in the USA COMBAT BARREL V2 SPECS
• Material: 4150CMV
• Twist: 1:7
• Chamber:5.56mm NATO
• Gas Journal: .750-in with a deep dimple for secure gas block installation
• Finish: QPQ Both the 11.5 Inch and 14.5 Inch Variants are NOT pinned and welded. This is so the user can change the muzzle device if needed. All NFA laws apply. UPS Shipping Options ONLY, No $7.95 Flat Rate Shipping for this Item.]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-m4-89-broadsword-upper-5-56nato-combat-barrel-v2-l89-m-lok-handguard-r-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-m4-89-broadsword-upper-5-56nato-combat-barrel-v2-l89-m-lok-handguard-r-18.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-broadsword-m4-89-upper-223-wylde-precision-barrel-r-12.jpgcustom-itemoptacticalgear-pagecoupregrSOL-BSURG-223WYLDE12001140SOLGW Broadsword M89 Precision Upper - .223 Wylde (R)Sons Of Liberty Gun Works111litosobcg515• BROADSWORD-89 Billet Upper Receiver
• .223 Wylde PRECISION SPR Grade Barrel
• Matches M4-89 handguard and rail
• 7075-T6 Billet aluminum construction
• Hardcoat anodized black finish
• A2 Flash Hider
• .750 gas block, mid-length gas system
• M4 feedramp extension
• M89 Wedge Lock handguard
• Forged Mil-Spec 7075 aluminum upper receiver Mil-Spec MIL-A-8625F anodized finish
• No BCG or Charging Handle Included
• Made in the USA SPECS FOR THE .223 WYLDE PRECISION SPR GRADE BARREL
• .223 Wylde Chamber
• 416 Stainless Steel
• SPR Profile
• 1/7 Twist
• 5/8×24 Threaded Muzzle
• .750-inch; Gas Block Journal
• Black Oxide Finish
• 3 Groove Polygonal Rifling
• Made in the USA Note from OPT: The 5/8×24 Threaded Muzzle will NOT work with regular 5.56 (1/2x28) Threaded Muzzle Devices. You will need a standard 7.62 Muzzle Device for this barrel. The 14.5 Inch Variant is NOT pinned and welded. This is so the user can change the muzzle device if needed. All NFA laws apply. UPS Shipping Options ONLY, No $7.95 Flat Rate Shipping for this Item.]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-broadsword-m4-89-upper-223-wylde-precision-barrel-r-17.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-broadsword-m4-89-upper-223-wylde-precision-barrel-r-18.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-liberty-2-stage-trigger-l2s-r-9.jpgcustom-itemoptacticalgear-pagem4arupgradesSOLL2S150142.5SOLGW Liberty 2-Stage Trigger L2S (R)Sons Of Liberty Gun Works111• 4.5lb total pull weight with snappy reset
• DLC coated
• Liberty Bow with a radiused hybrid flat/curved shoe
• Clean break with full power springs
• Lifetime Warranty The Liberty 2 Stage trigger from SOLGW is our answer to the problem people have in deciding which 2 Stage trigger to use. The L2S has a hybrid straight/curved trigger shoe, with softly rounded edges on the trigger shoe, full power springs, and a clean crisp break. At 4.5 lbs pull weight, with a snappy reset and clearly distinguishable 2nd stage, the L2S is equally at home in a precision rifle or a short blaster. This precision machined, polished, and DLC-coated trigger is standard in SOLGW PRECISION Series rifles and is now available individually as well. If you’re looking for a quality 2-stage trigger with a Lifetime Warranty, at a reasonable price from a manufacturer you can trust, the L2S from SOLGW is your answer. *Includes a slave pin for easy trigger installation*]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-liberty-2-stage-trigger-l2s-r-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-liberty-2-stage-trigger-l2s-r-12.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-liberty-ambi-charging-handle-5-56-anodized-black-r-11.jpgcustom-itemoptacticalgear-pagem4arupreandpSOLLCH5569590.25SOLGW Liberty Ambi Charging Handle 5.56 - Anodized Black (R)Sons Of Liberty Gun Works111- Snag-free operation
- Rear lip creates a seal in the back of the upper receiver to interrupt gas during suppressed fire The LCH is machined from aircraft-grade 7075 and anodized to Mil-Spec Hard Coat Type III specifications. Made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-liberty-ambi-charging-handle-5-56-anodized-black-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-liberty-ambi-charging-handle-5-56-anodized-black-r-21.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-m89-drive-lock-rail-m-lok-r-11.jpgcustom-itemoptacticalgear-pageSOLM89325308.75SOLGW M89 Drive Lock Rail M-LOK (R)Sons Of Liberty Gun Works1111https://s.turbifycdn.com/aah/optacticalgear/solgw-m89-drive-lock-rail-m-lok-r-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-m89-drive-lock-rail-m-lok-r-19.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/olgw-m4-89-complete-upper-5-56nato-11-5-combat-barrel-10-5-m89-m-lok-handguard-a2-flash-hider-r-9.jpgcustom-itemoptacticalgear-pagecoupregrSOLM489UPPER115556900855SOLGW M89 Upper - 5.56NATO - 11.5 inch with A2 Flash Hider (R)Sons Of Liberty Gun Works111- Complete Upper Receiver
- 11.5" Combat Barrel
- 10.5" M89 Handguard
- A2 Flash Hider
- QPQ Finish Made in the USA, backed with a Lifetime Warranty. Does not include a BCG or Charging Handle. NFA DISCLAIMER/WARNING: This complete upper does not meet the 16" minimum barrel length requirement, and requires registration and a tax stamp with the Bureau of Alcohol, Tobacco, Firearms and Explosives (BATFE) when assembled into a complete rifle. Additional state and local restrictions may apply. It is the sole responsibility of the buyer to comply with any and all applicable laws.]]>1https://s.turbifycdn.com/aah/optacticalgear/olgw-m4-89-complete-upper-5-56nato-11-5-combat-barrel-10-5-m89-m-lok-handguard-a2-flash-hider-r-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/olgw-m4-89-complete-upper-5-56nato-11-5-combat-barrel-10-5-m89-m-lok-handguard-a2-flash-hider-r-16.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-m4-89-complete-upper-5-56nato-13-7-combat-barrel-13-m89-m-lok-handguard-nox-flash-hider-r-26.jpgcustom-itemoptacticalgear-pagecoupregrSOLM489UPPER1375561000950SOLGW M89 Upper - 5.56NATO - 13.7 inch with NOX Flash Hider (R)Sons Of Liberty Gun Works111- 5.56 NATO/ 223 Remington
- Complete Upper Receiver
- 13.7" Combat Barrel
- 13" M89 Handguard
- NOX Muzzle Device Pinned and Weld for 16" OAL
- QPQ Finish Made in the USA, backed with a Lifetime Warranty. Does not include a BCG or Charging Handle.]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-m4-89-complete-upper-5-56nato-13-7-combat-barrel-13-m89-m-lok-handguard-nox-flash-hider-r-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-m4-89-complete-upper-5-56nato-13-7-combat-barrel-13-m89-m-lok-handguard-nox-flash-hider-r-28.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-nox-muzzle-device-5-56-9-hole-neutral-version-r-20.jpgcustom-itemoptacticalgear-pagem4arupreandpSOLNOX9556125109SOLGW NOX Muzzle Device 5.56 9 Hole Neutral Version (R)Sons Of Liberty Gun Works111Features
- 5.56/223
- 1/2x28 threading
- 3 Prong Muzzle Device
- 9 gas ports
- Fits DAA Suppressor and Key Mount Devices
- 4140 Steel
- QPQ Finish Made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-nox-muzzle-device-5-56-9-hole-neutral-version-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-nox-muzzle-device-5-56-9-hole-neutral-version-r-30.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/solgw-stripped-forged-upper-r-11.jpgcustom-itemoptacticalgear-pagem4arupreandpSOLUPPERSTRIPPED150142.5SOLGW Stripped Forged Upper (R)Sons Of Liberty Gun Works111- Hardcoat Type III Ano with R5 Bright Dip
- 7075-T6 Aluminum
- Engraved T Marks
- Engraved Flag Logo on tang Made in the USA]]>1https://s.turbifycdn.com/aah/optacticalgear/solgw-stripped-forged-upper-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/solgw-stripped-forged-upper-r-21.jpgSons Of Liberty Gun Workshttps://s.turbifycdn.com/aah/optacticalgear/sord-hts-wrist-panel-40.jpgitem.optacticalgear-pagewrdoho76SAAC0210100103329.7SORD HTS Wrist PanelSORD111Wrist mounted folding commanders panel including map. Closes with a vecro strap. Large internal folding sleeve and a small swing away sleeve that is transparent on both sides. Twin adjustable wrist straps. Map section: 160mm x 120mm. Swing away section: 95mm x 60mm. Both sides will show different items if required. Colors: Coyote Brown, Multicam, Black, OD Green1https://s.turbifycdn.com/aah/optacticalgear/sord-hts-wrist-panel-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/sord-hts-wrist-panel-50.jpgSORDhttps://s.turbifycdn.com/aah/optacticalgear/sord-hydration-helmet-carrier-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/sord-hydration-helmet-carrier-70.jpgcustom-itemoptacticalgear-pageassaultpacks76SABP042010010255229.5SORD Hydration Helmet CarrierSORD111- 6 adjustable sinch straps, four with fastex buckles for quick access.
- Detachable shoulder straps
- 6 column wide.
- 3 columns deep.
- Cordura construction.
- Drainage grommet in bottom.
- Internal hydration bladder seperation sleeve.
- Internal small mesh admin pouch with VELCRO® Brand fastener closure.
- Zip extended on one side for RTF500 control panel access.
- Main compartment twin zipper pull, large YKK zip.
- Twin comms ports with VELCRO® Brand fastener lid covers.
- 4 plastic "D" loops for attachment of shoulder strap kit or lashing to gear.
- VELCRO® Brand fastener flag / IFF panel on front of beavertail 50mm.
- MOLLE panel behind beavertail.
- Double sided Multicam webbing.
- Tube tape carry handle.
- Fixed VELCRO® Brand fastener webbing tabs.
- Quick detach shoulder straps.
- Minimalistic approach for a streamline design. Helmet not included. ]]>1https://s.turbifycdn.com/aah/optacticalgear/sord-hydration-helmet-carrier-83.jpghttps://s.turbifycdn.com/aah/optacticalgear/sord-hydration-helmet-carrier-84.jpgSORDhttps://s.turbifycdn.com/aah/optacticalgear/sord-mff-chest-rig-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/sord-mff-chest-rig-71.jpgitem.optacticalgear-pagevests76SAPF0030101105045SORD MFF Chest RigSORD111Updated design. Now the Military Freefall (MFF) rig features a Hook and Loop sandwhich along the bottom for drop style pouches and also features duel fastex clips on either side which gives the operator more freedom when removing or putting on the MFF. The MFF is a high speed supplement platform has been designed to work over other webbing systems. Its small enough to cover just the upper chest of the user but big enough to hold supplement equipment. This is best suited to Lead Climbers, Military Free Fall parachutists or vehicle operators where a cluttered chest or belt order is'nt always suitable. Adjustable shoulder straps and a single adjustable waist strap allow the MFF to be worn over bulky clothing and armor. 1https://s.turbifycdn.com/aah/optacticalgear/sord-mff-chest-rig-84.jpghttps://s.turbifycdn.com/aah/optacticalgear/sord-mff-chest-rig-85.jpgSORDhttps://s.turbifycdn.com/aah/optacticalgear/sord-tactical-exploitation-dump-pouch-velcro-attach-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/sord-tactical-exploitation-dump-pouch-velcro-attach-45.jpgcustom-itemoptacticalgear-pagedupoevba76SAAC10103531.5SORD Tactical Exploitation Dump Pouch - Velcro AttachSORD111Works with armor carriers that have a velcro front flap or chest rigs with velcro hook backing. Features:
• Elastic draw cord closure for keeping dumped items secure
• Elastic stowage tabs for entry/exploitation tools, chemlights and ancillaries
• Pouch can be rolled and stowed when not in use]]>1https://s.turbifycdn.com/aah/optacticalgear/sord-tactical-exploitation-dump-pouch-velcro-attach-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/sord-tactical-exploitation-dump-pouch-velcro-attach-58.jpgSORDhttps://s.turbifycdn.com/aah/optacticalgear/sord-tourniquet-cover-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/sord-tourniquet-cover-available-soon-32.jpgcustom-itemoptacticalgear-pagetourniquets76SAAC0860100102522.5SORD Tourniquet CoverSORD111The SORD tourniquet cover is designed to be worn on the man. The pouch is easily released by a velcro tab at the top when pulled allows the cover to drop open and expose the tourniquet. The pouch holds both the SOFTT and the C-A-T tourniquet. Tourniquet not included. Attaches to any MOLLE/PALS webbing, 1 Column wide by 3 Rows long.1https://s.turbifycdn.com/aah/optacticalgear/sord-tourniquet-cover-available-soon-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/sord-tourniquet-cover-available-soon-39.jpgSORDhttps://s.turbifycdn.com/aah/optacticalgear/sord-weapon-retention-catch-40.jpgitem.optacticalgear-pagewere76SAAC0530100102522.5SORD Weapon Retention CatchSORD111The Weapon Retention Catch is deisgned to be mounted to your belt or rig and allow your long gun to be moved around to the side of your body when slung. It is then locked away with a VELCRO Brand fastener tab. When needed, a quick pull of the tab and the weapon is quickly and easily accessed. very useful for when fast-roping, airborne rappelling, handling detainees or just when you need your long gun locked away. Plastic insert can flex and compress, and is lighter than traditional aluminum insert. Weight: approx 0.35 lbs1https://s.turbifycdn.com/aah/optacticalgear/sord-weapon-retention-catch-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/sord-weapon-retention-catch-49.jpgSORDhttps://s.turbifycdn.com/aah/optacticalgear/source-convertube-kit-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-convertube-kit-43.jpgcustom-itemoptacticalgear-pagecaac7845043602003932Source Convertube KitSource Tactical Gear111• Tube length - 37 in
• Inner tube length (inserted into the bottle) - 13.75 in
• Storm push-pull drink valve
• Multiple Adapters for common bottle threads
• 2 Quick connect valves along the tubes allow the length of the tube to be extended or shortened easily.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-convertube-kit-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-convertube-kit-56.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-helix-valve-kit-39.jpgcustom-itemoptacticalgear-pagecaac7845095002001510.99Source Helix Valve KitSource Tactical Gear111• Cylindrical shape requires no special mouth orientation.
• Bite valve - Unique mechanism delivers full flow with just a soft bite.
• Retreat spring mechanism - Will not leak even under pressure or with prolonged use.
• Build-in bayonet style shut off.
• Omni directional operation.
• Integral lock - Integrated twist shut-off.
• Long wearing design.
• Dirt Shield™ – Valve cover
• Angled valve Color: Coyote This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-helix-valve-kit-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-helix-valve-kit-48.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-ilps-2l-3l-bladder-system-with-uta-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-ilps-2l-3l-bladder-system-with-uta-52.jpgcustom-itemoptacticalgear-pagecaac774504590XV24942Source ILPS 2L/3L Bladder System with UTASource Tactical Gear111• Horizontal bladder QMT™ Allow the drinking tube to be routed out of the ballistic plate pouch, without kinking the tube.
• Consistent thickness throughout the surface of the reservoir The system maintains its constant thickness even while being carried upright. Gravity isn't an issue and does not affect the bladder's shape.
• Hi-Flow Storm-Valve™ No-bite push-pull valve with integrated shut-o mechanism. Like drinking with a straw. Easy disassembly for cleaning. (U.S. Patent 6,622,988).
• Angled Valve Turned 360 degrees for perfect valve/mouth orientation. Allows tube to be 25cm shorter. Less excess tube bouncing around the chest!
• Dirt-Shield™ Protective Cover – No more dragging in the dirt! Keeps valve free of dirt and protected.
• QMT™ Additional In line SQCTM Quick Connector at the tube extremity, allows connection of filter, UTATM or other accessories with the push of a button.
• Cool Weave Cover Tube Insulates and blocks UV-light. Water stays cool and 3 bacteria free from first to last sip.
• Widepac™ Wide Opening Access Patented slide closure for easy draining and cleaning. Airtight seal.
• TASTE-FREE™ System Co-extruded PE film retains pure liquid taste with no plastic flavor. BPA and phthalate free.
• Grunge-Guard™ Technology Inhibits bacteria growth on reservoir and drinking tube surfaces for the life of the system. Technology utilized FDA-approved and EPA-registered anti-microbial agent.
• Easy Care & Low Maintenace For use with water, clean by simply rinsing the system and hanging it opened until dry. For use with energy drinks or sweetened liquids, follow the cleaning instructions in the attached care and maintenace booklet. Dimensions:
Length.....................14.1”/36 cm
Width.......................10.6”/27 cm
Max. Depth...............2.6”/6.7 cm Specs:
Liquid Capacity...........................3L / 100 oz
Cargo Capacity...........................NA
Weight (pack + reservoir)…….....0.38Kg / 0.84Lbs
Hydration System.......................WLP
Reservoir.....................................435 micron co-extruded Glass-Like™ PE
Valve...........................................Angled Storm-Valve™
Tube............................................Weave Covered. 94 cm / 37 Inch long Source Vagabond Systems reservoir systems are warranted for the life of the products. Tube color is Coyote. This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-ilps-2l-3l-bladder-system-with-uta-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-ilps-2l-3l-bladder-system-with-uta-65.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-kangaroo-1l-bladder-with-collapsible-canteen-pouch-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-kangaroo-1l-bladder-with-collapsible-canteen-pouch-66.jpgcustom-itemoptacticalgear-pagecaac784001510X018869.99Source kangaroo 1L Bladder with Collapsible Canteen PouchSource Tactical Gear111-Liquid Capacity: 1L/ 33oz
-Weight: 0.15kg/0.33lbs
-Reservoir: 435 micron co-extruded Glass-Like™ PE
-Valve: Angled Storm-Valve™
-Tube: IRR Tube Cover 94cm/37in long
-QMT™ - Source Quick Mate Technology hose fitting offers push button convenience.
-IRR tube cover.
-2 drinking valves: push/pull sport valve with integrated twist shut off; Storm “no bite” Hydration Valve with integrated twist shut off delivers 25% higher flow than bite designs.
-Dirt Shield™ valve cover.
-Kangaroo Bladder fits standard issue canteen pouches plus custom pouches from many manufacturers.
-Pouch can fit standard issue canteen.
-Slosh-Free.
-Free-standing when full, folds flat when empty. Weight: 320gr Height: 19.5 cm/ 7.67 inch Length: 17 cm/ 6.69 inch This item cannot be returned unless hydration bladder is in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-kangaroo-1l-bladder-with-collapsible-canteen-pouch-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-kangaroo-1l-bladder-with-collapsible-canteen-pouch-79.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-razor-3l-armor-mounted-hydration-pouch-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-razor-3l-armor-mounted-hydration-pouch-52.jpgcustom-itemoptacticalgear-pagemohypa77400149XXXX125104.99Source Razor 3L Armor Mounted Hydration PouchSource Tactical Gear111• MOLLE Compatible System Securely attaches to vests and packs with MOLLE/PALS attachments.
• VELCRO® Brand fastener Top Opening Offers quick and easy reservoir access for cleaning, draining or refilling.
• Cool Insulation Closed cell insulation keeps liquids cool for better absorption by the body.
• D-Ring Attachment Buckle For easy mounting on non-MOLLE items.
• Fast Disassembly Specially designed MOLLE attachment straps for quick on/off.
• Condensation Drain Port Drains condensation from the insulated reservoir sleeve.
• MOLLE/PAL Attachment Multiple MOLLE rows for attachment of pouches and pockets.
• ID tags VELCRO® Brand fastener strip holds ID tags.
• Adjustable Mounting Level Razor’s position on the vest can be easily altered for a customized fit.
To raise the positioning:
1) Thread both MOLLE straps through the first row of Razor webbing
2) Thread the remaining strap through the MOLLE loops on your vest.
• UTA™ Compatible The QMT™ quick connector can be paired with Our accessory UTA™ (sold separately) to refill the Razor from bottles, spigots, and mobile water carriers directly through the drinking tube without removing it from the back. Source Vagabond Systems reservoir systems are warranted for the life of the products. Source carriers and packs are covered by a limited four year limited warranty. Includes WLPS 3L Bladder System. This item cannot be returned unless hydration bladder is in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-razor-3l-armor-mounted-hydration-pouch-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-razor-3l-armor-mounted-hydration-pouch-65.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-replacement-tube-available-soon-24.jpgcustom-itemoptacticalgear-pagecaac78430841913.99Source Replacement TubeSource111Insulated UV-block weave cover. Compatible with Source QMT™ Quick Mate Technology accessories.1https://s.turbifycdn.com/aah/optacticalgear/source-replacement-tube-available-soon-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-replacement-tube-available-soon-31.jpgSourcehttps://s.turbifycdn.com/aah/optacticalgear/source-rider-3l-pack-armor-compatible-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-rider-3l-pack-armor-compatible-52.jpgcustom-itemoptacticalgear-pagemohypa77400169XXXX162136Source Rider 3L Pack (Armor Compatible)Source111• Tuck-Away Contoured Shoulder Straps Shoulder straps are patterned for comfort and are designed to fold into a back storage pocket when not in use.
• Adjustable Sternum Strap Adds carrying stability. Adjusts to fit a range of body types.
• Elastic Strap Retainers Secures dangling strap ends.
• Dual Function Can be worn backpack style or quickly converted for direct armor attachment or streamlined ruck insertion.
• X-QCA™ System Connects Rider securely to armor or rucks with no need for additional straps or hardware. Fits a wide variety of vest configurations.
• Easy Reservoir Access Rider’s design allows the bladder to be quickly removed and refilled while its carrier stays on the vest. The zippered wide opening is secured with VELCRO® Brand fastener plus an optional snap.
• Cool Insulation Closed cell insulation keeps liquids cool for better absorption by the body.
• Easy Dry Loop With the zippered front open and the WLPS™ closure removed, the pack hangs upside down for draining and quick drying.
• Condensation Drain Port Drains condensation from the insulated reservoir sleeve.
• Dual Tube Routing Top and side ports allow the drinking tube to be routed either over the shoulder or below the arm.
• Hi-Vis Option Back pocket holds an attached strip of high visibility reflective material for use in low light conditions. Ideal for PT.
• Storage Space External 1.5L zippered pocket provides quick access to small essentials.
• UTA™ Compatible Our UTA™ adaptor (sold separately) allows Rider to be refilled from bottles, spigots or mobile water units directly through the drinking tube. There’s no need to remove the system from your back! Dimensions
Length: 14.1”/36 cm
Width: 9.8”/25 cm
Max. Depth: 2.7”/7 cm
Weight (pack): 0.48Kg / 1.07Lbs Source Vagabond Systems reservoir systems are warranted for the life of the products. Source carriers and packs are covered by a limited four year limited warranty. Includes WLPS 3L Bladder System. This item cannot be returned unless hydration bladder is in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-rider-3l-pack-armor-compatible-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-rider-3l-pack-armor-compatible-65.jpgSourcehttps://s.turbifycdn.com/aah/optacticalgear/source-tube-brush-kit-44.jpgcustom-itemoptacticalgear-pagecaac782120100000A1613.99Source Tube Brush KitSource Tactical Gear111-Brush length: 102.5cm
-Brush weight: 6gr
-Brush material: Stainless steel spring handle with nylon fiber
-Packaged Size: 0.06"L x 0.9"W x 1.06"D This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-tube-brush-kit-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-tube-brush-kit-53.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-ultimate-m-c-3l-hydration-upgrade-kit-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-ultimate-m-c-3l-hydration-upgrade-kit-34.jpgcustom-itemoptacticalgear-pagecaac7843251902035847.99Source Ultimate M.C. 3L Hydration with Upgrade KitSource Tactical Gear111• FDA Approved Materials All materials in contact with the drinking water are FDA approved. Guaranteed safe and taste-free drinking water.
• Integral Refill Handle For fast and easy refill with no spills
• Large NC Filler Cap Air tight, low profile one hand operated. Compatible with commonly used personal filtration systems. The cap fits the FILBE hydration filler opening.
• Magnetic Clip keeps the drinking valve in place and easily accessible.
• UTA Rapid Refill Adapter for quickly filling the reservoir without opening your pack
• Helix Bite Valve with a rounded shape that requires no mouth orientation for easy use Hydration Tuber Cover and Filler Cap color: Coyote Brown]]>1https://s.turbifycdn.com/aah/optacticalgear/source-ultimate-m-c-3l-hydration-upgrade-kit-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-ultimate-m-c-3l-hydration-upgrade-kit-44.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-universal-tube-adaptor-uta-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-universal-tube-adaptor-uta-52.jpgcustom-itemoptacticalgear-pagecaac77450341914.99Source Universal Tube Adaptor (UTA)Source Tactical Gear111• Filling from a bottle - fits a variety of water bottles.
• Filling Time from a 1.5L bottle: 50 sec.
• Filling from a tap – Designed to fit a wide range of indoor and outdoor taps.
• Filling time from tap - 2L in 45 sec, 3L in 1.05 sec.
• UTA will begin to expand when reservoir is filled and will automatically disconnect if reservoir is accidentally overfilled.
• UTA is compatible with all of Source QMT (Quick Mate Technology) systems. Source Vagabond Systems reservoir systems are warranted for the life of the products. This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-universal-tube-adaptor-uta-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-universal-tube-adaptor-uta-65.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-wlps-3l-bladder-system-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-wlps-3l-bladder-system-53.jpgcustom-itemoptacticalgear-pagecaac77450449XXXX4336.99Source WLPS 3L Bladder SystemSource Tactical Gear111• Hi-Flow Storm-Valve™ No-bite push-pull valve with integrated shut-off mechanism. Like drinking with a straw. Easy disassembly for cleaning. (U.S. Patent 6,622,988).
• Angled Valve Turned 360 degrees for perfect valve/mouth orientation. Allows tube to be 25cm shorter. Less excess tube bouncing around the chest!
• Dirt-Shield™ Protective Cover keeps the drinking valve free of dirt and protected.
• QMT™ Additional In line QMTTM Quick Connector at the tube extremity, allows connection of filter, UTATM or other accessories with the push of a button.
• Cool Weave Cover Tube Insulates and blocks UV-light. Water stays cool and Inhibits bacteria growth from first to last sip.
• Widepac™ Wide Opening Access Patented slide closure for easy draining and cleaning. Airtight seal.
• TASTE-FREETM System Co-extruded PE film retains pure liquid taste with no plastic flavor. BPA and phthalate free.
• Grunge-Guard™ Technology Inhibits bacteria growth on reservoir and drinking tube surfaces for the life of the system. Technology utilized FDA-approved and EPA-registered anti-microbial agent.
• Easy Care & Low Maintenace For use with water, clean by simply rinsing the system and hanging it opened until dry. For use with energy drinks or sweetened liquids, follow the cleaning instructions in the attached care and maintenace booklet. Dimensions:
Length .................14.1”/36 cm
Width ...................9.8”/25 cm
Max. Depth ...........2.6”/6.7 cm Specs:
Liquid Capacity..........................3L / 100 oz
Cargo Capacity..........................NA
Weight.......................................0.115Kg / 0.25Lbs
Hydration System.......................WLPS
Reservoir...................................435 micron co-extruded Glass-Like PE
Valve ........................................Angled Storm-Valve
Tube .........................................Weave Covered 94 cm / 37 Inch long Source Vagabond Systems reservoir systems are warranted for the life of the products. Tube color is Coyote. This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-wlps-3l-bladder-system-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-wlps-3l-bladder-system-66.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-wxp-2l-sqc-storm-valve-46.jpgitem.optacticalgear-pagecaac143055300024032.99Source WXP 2L - SQC - Storm ValveSource Tactical Gear111This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-wxp-2l-sqc-storm-valve-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-wxp-2l-sqc-storm-valve-55.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-wxp-3l-sqc-storm-valve-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-wxp-3l-sqc-storm-valve-52.jpgitem.optacticalgear-pagecaac20WXP3L3932.99Source WXP 3L - SQC - Storm ValveSource Tactical Gear111This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-wxp-3l-sqc-storm-valve-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-wxp-3l-sqc-storm-valve-65.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/source-wxp-3l-low-profile-hydration-system-upgrade-kit-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-wxp-3l-low-profile-hydration-system-upgrade-kit-51.jpgcustom-itemoptacticalgear-pagecaac7846101302035647Source WXP 3L Low Profile Hydration System with Upgrade KitSource Tactical Gear111-Baffled WXP 3L low profile reservoir
-QMT tube with Coyote tube cover
-STORM™ valve
-UTA™ adapter Reservoir dimensions:
-Length: 45 cm
-Width: 21 cm
-Depth when full: 6 cm This item cannot be returned unless in brand new, unused, unopened condition.]]>1https://s.turbifycdn.com/aah/optacticalgear/source-wxp-3l-low-profile-hydration-system-upgrade-kit-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/source-wxp-3l-low-profile-hydration-system-upgrade-kit-61.jpgSource Tactical Gearhttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-cqb-tool-39.jpgitem.optacticalgear-pageknandsh65SB9XX175Spartan Blades CQB ToolSpartan Blades111• Knife Name: CQB Tool
• Overall Length: 6 15/16"
• Blade Length: 2 7/8" (Half Sharpened)
• Blade Thickness: 0.180"
• Blade Steel: 154CM
• Blade Hardness: 57-59 HRC
• Blade Style: Saber Ground Dagger
• Coating: SpartaCoat - PVD - Tungsten DLC (Black) or ZrN (Flat Dark Earth)
• Sheath: Kydex (Black) or (Coyote) to match blade finish respectively.
• Weight: 0.126 LBS (Knife) ]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-blades-cqb-tool-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-cqb-tool-49.jpgSpartan Bladeshttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-enyo-39.jpgitem.optacticalgear-pageknandsh65SB2165Spartan Blades EnyoSpartan Blades111Sheath color matches knife color.

Specifications:

Knife Name: Enyo

Designer(s): Iovito/Carey

Overall Length: 6 1/4"

Blade Length: 2 11/16"

Blade Thickness: 3/16"

Blade Steel: S35VN

Blade Hardness: 58-59 HRC

Blade Style: Fixed Drop Point - this design allows for strength of the blade tip by placing it in line with the users hand while keeping the upward curve of the cutting edge.

Coating: SpartaCoat - PVD - Tungsten DLC

Sheath: Kydex with neck chain, IWB loop, and 2' of Para-Cord (550)

Weight: 0.176 LBS (Knife)]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-blades-enyo-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-enyo-49.jpgSpartan Bladeshttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-horkos-39.jpgitem.optacticalgear-pageknandsh65SB4345Spartan Blades HorkosSpartan Blades111Specifications:

Knife Name: Horkos

Designer(s): Iovito/Carey

Overall Length: 10 7/8"

Blade Length: 5 11/16”

Blade Thickness: 3/16”

Blade Steel: S35VN

Blade Hardness: 58-59 HRC

Blade Style: Drop Point— single edge design with relieved distal spine and tapered drop for tip strength.

Coating: SpartaCoat - PVD - Tungsten DLC (Black)

Handle Material: Canvas Micarta®

Weight: 0.556 LBS Normal lead time for an out of stock version is 5-7 business days. Call to check availability.]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-blades-horkos-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-horkos-49.jpgSpartan Bladeshttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-pallas-folder-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-pallas-folder-58.jpgcustom-itemoptacticalgear-pageknandsh65SF3295Spartan Blades Pallas FolderSpartan Blades111-Knife Name: PALLAS
-Designer(s): Curtis Iovito
-Blade Length: 3 3/4"
-Overall Length: 8 3/4" (Open)
-Blade Thickness: 0.153" or 5/32"
-Blade Steel: CPM S35VN
-Blade Hardness: 58-60 HRC
-Blade Style: Drop Point
-Frame: 6061 Aluminum
-Clip Material: 6AL-4V Titanium
-Finish: Stonewashed Blade, Frame & Clip with a Black Mil Spec Anodized Frame
-Weight: 4.736 oz (very light weight for its size) Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-blades-pallas-folder-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-pallas-folder-72.jpgSpartan Bladeshttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-phrike-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-phrike-45.jpgitem.optacticalgear-pageknandsh65SB17XX280Spartan Blades PhrikeSpartan Blades111• Knife Name: Phrike
• Designer(s): Iovito/Carey
• Blade Length: 4.25"
• Overall Length: 8.50"
• Blade Thickness: 3/16"
• Blade Steel: S35VN
• Blade Hardness: 59-60 HRC
• Blade Style: Fixed, Swedged Drop Point
• Coating: SpartaCoat – PVD – Tungsten DLC (Flat Black) or ZrN (Flat Dark Earth)
• Handle Material: G10 (Black, Green, and Coyote Tan)
• Sheath: Lined Nylon MOLLE sheath (Black, Coyote Tan & Multi-Cam) or Kydex w/IWB loop.
• Weight: 0.244 LBS Normal lead time for this item is approximately 3-7 business days. Call or email us to check availability. ]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-blades-phrike-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-phrike-59.jpgSpartan Bladeshttps://s.turbifycdn.com/aah/optacticalgear/spartan-george-raider-dagger-9.jpgcustom-itemoptacticalgear-pageknandsh65SBBL3150Spartan Blades-George Raider DaggerSpartan Blades111• Designer(s): Les George
• Overall Length: 12"
• Blade Length: 7"
• Blade Thickness: 3/16"
• Blade Steel: SK5
• Blade Hardness: 58-60 HRC
• Blade Style: Fixed dagger symmetrical blade
• Coating: Black Powder Coat
• Sheath: Black Plastic injection molded Sheath with nylon hanger
• Weight: 0.444 LBS (Knife)
• Made in Taiwan by our Allies ]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-george-raider-dagger-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-george-raider-dagger-16.jpgSpartan Bladeshttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-george-v-14-dagger-45.jpgcustom-itemoptacticalgear-pageknandsh65SB27BKBKKYBK495Spartan Blades-George V-14 DaggerSpartan Blades111Knife Name: Spartan George V1-14 Dagger
Designer: Les George
Overall Length: 11 1/2"
Blade Length: 6 3/4"
Blade Thickness: 1/4"
Blade Steel: CPM S35VN
Blade Hardness: 59-60 HRC
Blade Style: Full Tang Hollow Ground Dagger
Coating: SpartaCoat - PVD - Tungsten DLC (Black) or ZrN (Flat Dark Earth)
Handle Material: 3D Contoured G10, Black or Green
Weight: 9.28 Oz Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-blades-george-v-14-dagger-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-george-v-14-dagger-55.jpgSpartan Bladeshttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-harsey-fighter-11.jpgcustom-itemoptacticalgear-pageknandsh65SBBL006195Spartan Blades-Harsey FighterSpartan Blades111• Designer(s): William W. Harsey Jr.
• Overall Length: 11.5”
• Blade Length: 6.125”
• Blade Thickness: 0.195”
• Blade Steel: 1095 Cro-Van
• Blade Hardness: 56-58 HRC
• Blade Style: Fixed – Spear Point – Flat Ground
• Coating: Black Powder Coat
• Handle Material: Black injection molded
• Sheath: injection Molded with active retention thumb lever
• Weight: 0.738 LBS (Knife)]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-blades-harsey-fighter-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-blades-harsey-fighter-21.jpgSpartan Bladeshttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-ir-flag-patch-r-30.jpgcustom-itemoptacticalgear-pagelacutpa82IRFLAG17.99Spartan Village IR Flag Patch (R)Spartan Village111Per ITAR regulations, IR flags are NOT AVAILABLE FOR EXPORT. USA Addresses Only. This Item is Excluded from the Groundhog Day Sale.]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-village-ir-flag-patch-r-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-ir-flag-patch-r-39.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-ir-medic-cross-patch-r-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-ir-medic-cross-patch-r-45.jpgcustom-itemoptacticalgear-pagelacutpa82IRMED15Spartan Village IR Medic Cross Patch (R) Spartan Village111Export Restricted. USA and APO Addresses Only. No International Shipping. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-village-ir-medic-cross-patch-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-ir-medic-cross-patch-r-58.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-mandalorian-crest-patch-31.jpgcustom-itemoptacticalgear-pagelacutpa82MANDOCREST25Spartan Village Mandalorian Crest PatchSpartan Village111This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-village-mandalorian-crest-patch-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-mandalorian-crest-patch-40.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-mandalorian-mythosaur-skull-patch-31.jpgcustom-itemoptacticalgear-pagelacutpa82MYTHO20Spartan Village Mandalorian Mythosaur SkullSpartan Village111This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/spartan-village-mandalorian-mythosaur-skull-patch-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/spartan-village-mandalorian-mythosaur-skull-patch-40.jpgSpartan Villagehttps://s.turbifycdn.com/aah/optacticalgear/special-threat-armor-38.jpgcustom-itemoptacticalgear-pagearmorSpecial Threat Armor1hem2mucuspthhel2sicuspthvesyspthceplhespthsacutrHesco Special Threat Plates:

Hesco BI L210, 5.5 lb Single Curve Plate
•5.56x45mm-M193
•7.62x39mm-M67
•5.56x45mm-M855 / SS109 Green Tip
•7.62x39mm-M43 Mild Steel Core AK
•7.62x39mm-API Armor piercing core AK

Hesco BI M210, Multi-Curve Plate, same threat rating as L210 but also stops:
•5.56x45mm-M855A1 Enhanced Performance SOF Ammo

Hesco BI U210, Multi-Curve Plate, same threat rating as L210 but also stops:
•5.56x45mm-M855A1 Enhanced Performance SOF Ammo Velocity Special Threat, 6 lb Multi-Curve Plate:
•5.56x45mm-M193
•5.56x45mm-M855 / SS109 Green Tip
•7.62x39mm-M43 Mild Steel Core AK
•7.62x51mm-M80 ]]>1https://s.turbifycdn.com/aah/optacticalgear/special-threat-armor-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/special-threat-armor-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/sierratac-2-point-adjustable-padded-sling-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/sierratac-2-point-adjustable-padded-sling-48.jpgcustom-itemoptacticalgear-pagetwopointslings123SLING59.95Spiritus Systems / SIERRATAC Padded SlingSpiritus Systems111Notable Features: - SIERRATAC Proprietary Billet Aluminum Slider allows for quick tension adjustment to the sling without the inherent danger of a tail snagging other items. The slider acts as a solid indexing point under stressful or dark conditions. The slider does have machined slots that allow the user to add a small pull tab to it if desired. - Premium foam padding for added comfort during extended operations or training events. - The padding incasement is constructed out of 500d Cordura and has a minimal seam that ensures that there are no rough edges that will rub the users neck raw. We do not use biding to close the encasement which can rub your neck raw after prolonged usage. -Open looped ends allow the user to add whatever mounting hardware is needed to fit their needs. The Sierra Tac sling was developed, prototyped and produced by SIERRATAC. Spiritus Systems is honored that SIERRATAC has chosen us to provide them with their latest evolution in the line up.]]>1https://s.turbifycdn.com/aah/optacticalgear/sierratac-2-point-adjustable-padded-sling-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/sierratac-2-point-adjustable-padded-sling-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-3-loop-pouch-insert-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-3-loop-pouch-insert-41.jpgcustom-itemoptacticalgear-pagecocavebaho132PI-3L-BLK14.95Spiritus Systems 3 Loop Pouch InsertSpiritus Systems1113 Loop Insert only. All other items sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-3-loop-pouch-insert-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-3-loop-pouch-insert-54.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-34-alpha-chest-rig-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-34-alpha-chest-rig-47.jpgcustom-itemoptacticalgear-pagespsymifichri1132CR-AL134.95Spiritus Systems 34 Alpha Chest RigSpiritus Systems111spsychrigco34 Alpha Chest Rig Only. Shoulder harness and back straps are sold separately. See link at the bottom of the page for Chest Rig Components. The 34 Alpha Chest Rig is a split chassis that will interface directly with the existing line of Spiritus Systems straps and pouches. It is designed to work with our Fat Straps setups. It also requires a Back Strap to work properly. The panels are built with Squadron MOLLE front faces and elastic cells on the back for extra storage. The bottom of each 34 Alpha Panel also has a Velcro slot to mount hanger pouches. This is a true blank-slate platform that enables load-carriage configuration options for weapon ammo of nearly any caliber, and when combined with our SPUD, GP pouches, the end user’s options are limitless. The system is constructed to be as low-profile as possible to add minimal bulk to the finished split rig, letting the mounted pouches contribute the bulk of the storage capability. 34 Alpha Chest Rig Only. Shoulder harness and back straps are sold separately. See link at the bottom of the page for Chest Rig Components. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-34-alpha-chest-rig-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-34-alpha-chest-rig-62.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-4-loop-pouch-insert-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-4-loop-pouch-insert-42.jpgcustom-itemoptacticalgear-pagecocavebaho132PI-4L-BLK14.95Spiritus Systems 4 Loop Pouch InsertSpiritus Systems1114 Loop Insert only. All other items sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-4-loop-pouch-insert-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-4-loop-pouch-insert-55.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-assault-back-panel-core-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-assault-back-panel-core-45.jpgcustom-itemoptacticalgear-pagespsylvplcaan132189.95Spiritus Systems Assault Back Panel CoreSpiritus Systems111litospsylvpaDesigned to fit the Spiritus Systems LV-119 Overt Rear Plate Bag Only. The Assault Panel Core was designed to be a multi-mission back panel attachment to your LV-119 OVERT Rear Plate Bag. We designed the Panel to fill a spectrum of needs ranging from a light weight Assault Panel, to a more robust Pack Panel. The panel is both expandable and modular and can accommodate a plethora of equipment to meet almost any operational need. The Assault Panel Core attaches to your LV-119 Rear Plate Bag using a combination of 6 directional snaps, and 2 full length zippers. It also utilizes two stabilizers that route inside of the Rear Plate Bag if the Panel is used in "Configuration 2 or 3" listed below. The Panel has a removable flap system that allows the user to configure the upper half of the Panel to meet their mission needs. (Flaps are sold separately, the Assault Panel Core does NOT come with a flap.) This eliminates the need to have multiple panels and allows for quicker donning and doffing of mission essential equipment. The top of the Panel features a custom double pull, separating zipper. This zipper serves three purposes. 1) It allows the Flaps to be completely removed from the Core and swapped out. 2) It allows communication antennas and other items such as cabling, hydration tubes, and breaching tools to be routed into and out of the top of the panel. 3) It provides quick access to the inside of the panel without lifting the entire Flap. The Assault Panel Core also has three direction snaps to hold Flaps securely on and to keep tools held inside the panel. The Assault Panel Core features 4 external attachment zippers. These zippers allow the panel to be worn in three configurations. 1) Configuration 1 uses the top zippers to attach the panel to the plate bag. This compresses the panel and allows the panel to be worn in a "light" configuration. This configuration of the panel is great for assaulters who want a streamlined and tight configuration and only need to carry things like a small hydration bladder, slap charges, flash bangs and GP kit on their backs. 2) Configuration 2 uses the bottom zippers to attach the panel to the plate bag. This configuration gives the user much more capacity and configures the panel into more of a backpack. This provides the same features as Configuration 1, but with the added volume for bulky items such as radios, cold weather gear, poll less litters, etc. 3) Configuration 3 also uses the bottom zippers to attach to the rear plate bag, but introduces the bottom expansion as well. This expansion offers the ability to carry longer tools and store even more bulky items in the expanded space. The Assault Panel Core comes standard with a permanently affixed large GP pocket on the lower half. This pocket is velcro lined for attachment of accessory items. It features a total of two tie down locations inside the pouch for securing sensitive equipment. The front of the pouch features a zippered stash pocket for organizing smaller, commonly needed items. This pocket also has a 4" x 5" Velcro Field for attaching identification patches. Behind the GP pocket is a hidden stash compartment. This is used for storing the lower half of slap charges or breach pens when they are passed through the flaps above. It can also be used to stash E&E equipment or smaller personal items. Each side of the panel features six tie down loops for securing longer items external to the panel. These loops are great for attaching Tri-Fold or Bi-Fold charges or other tall items. The bottom expansion has a G-Hook internal to the panel that allows you to secure it in place if a heavier load needs to be carried inside, but you do not want the expansion to deploy inadvertently. Fitment Guide:
• Medium Overt Plate Bags - Fits
• Large Overt Plate Bags - Fits, could use an XL Adapter (sold separately) if you have very thick plates, and are overloading the panel.
• Extra Large Overt Plate Bags - Needs an XL Adapter (sold separately) to be compatible with the XL Plate Bags. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-assault-back-panel-core-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-assault-back-panel-core-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-flashbang-flap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-flashbang-flap-45.jpgcustom-itemoptacticalgear-pagespsylvplcaan132PC-FF85.95Spiritus Systems Back Panel Flashbang FlapSpiritus Systems111litoasbapaco1This product attaches to the ASSAULT BACK PANEL CORE. It is NOT standalone and requires a Core to function properly. Flashbang Flap Only. Assault Back Panel Core sold separately. Link to Assault Back Panel Core towards bottom of this page. The Flash Bang Flap is a two pocketed zip on attachment the mates to our Assault Back Panel Core. It consists of two pockets that measure 5" x 4" x 1.5" The pockets were built to house common Flash Bang sizes available to both LEO's and Military Personnel. Each pocket has a removable flap (included) and a built-in channel behind the pocket that allows for the storage of linear items, such as Slap Charges and Breach Pens. Each pocket can accommodate one of our Dividers, which will keep your flash bangs separate and upright even when one is removed from the pocket. The Flash Bang flap is attached to the Assault Back Panel Core by a separating dual zipper, 3 directional snaps and a hook/loop Velcro field. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-flashbang-flap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-flashbang-flap-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-gp-flap-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-gp-flap-45.jpgcustom-itemoptacticalgear-pagespsylvplcaan132PC-GF87.95Spiritus Systems Back Panel GP FlapSpiritus Systems111litoasbapacoThis product attaches to the ASSAULT BACK PANEL CORE. It is NOT standalone and requires a Core to function properly. GP Flap Only. Assault Back Panel Core sold separately. Link to Assault Back Panel Core towards bottom of this page. The GP Flap is a single pocket zip on attachment to our Assault Back Panel Core. It consists of one pocket that measures 10" x 6" x 2.5" The pocket was built to store extra items that may be needed on an operation such as medical equipment or roll up flex linear charges. The pocket features a half zippered closure to prevent items from inadvertently dumping out unzipping the pouch. Inside the pocket there is Velcro loop lined on both sides for the addition of hook Velcro accessories. There are also two tie down locations on the interior for securing sensitive items. The GP Flap has two built-in channels behind the pocket that allows for the storage of linear items, such as Slap Charges and Breach Pens. The front of the pocket offers a smaller zippered stash pocket for organizing smaller items and features a loop Velcro field that measures 2" x 9" for attaching placards or velcro patches. The GP flap is attached to the Assault Back Panel Core by a separating dual zipper, 3 directional snaps and a hook/loop Velcro field. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-gp-flap-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-gp-flap-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-molle-flap-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-molle-flap-47.jpgcustom-itemoptacticalgear-pagespsylvplcaan132PC-MF39.95Spiritus Systems Back Panel MOLLE FlapSpiritus Systems111This product is only compatible with the Spiritus Systems Assault Back Panel Core for the LV119 Plate Carrier.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-molle-flap-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-back-panel-molle-flap-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-back-strap-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-back-strap-36.jpgcustom-itemoptacticalgear-pagespsymifichri1132MFBS11.95Spiritus Systems Back StrapSpiritus Systems111Back Strap only. All other items sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-back-strap-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-back-strap-46.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-bank-robber-chest-rig-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-bank-robber-chest-rig-53.jpgcustom-itemoptacticalgear-pagespsymifichri1132HEAT59.95Spiritus Systems Bank Robber Chest RigSpiritus Systems111spsychrigpaShoulder and back straps are NOT included and must be purchased separately! Made in the USA. See link below for chest rig parts.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-bank-robber-chest-rig-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-bank-robber-chest-rig-66.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-brunch-box-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-brunch-box-12.jpgcustom-itemoptacticalgear-pagecobamanpumeb132PO-BB99.95Spiritus Systems Brunch Box111The Brunch Box was designed to fill the size gap between the SACK Pouch Mk3 and the Lunch Box Mk2 making it an ideal size for the Assaulter/Breacher. The Brunch Box has a hook and loop tongue to attach to the bottom of our Micro Fight Chest Rig or LV-119 Plate Carrier, making it a versatile choice for those changing load-outs often. Simply pull this off one kit and add it to another. Additionally, the Brunch Box comes with a removable 1" waist strap to wear fanny pack style as well. When worn fanny pack style the hook and loop tongue will fold away, loop side toward the body, for comfort. The main pouch features a "half zip" design and is more contoured than its smaller counterpart (The SACK Mk3). The inside features soft loop fields on both sides, giving you the ability to use our pouch insert suite to fit your requirements. This main compartment can fit two 80" roll-up charges, or a full-size IFAK. There are two tie-down loops inside the main compartment as well. There are also two grommet holes on the bottom to aid with drainage of the pouch if submersion occurs. These can also be used in conjunction with out Universal Retention Kit to add a Tourniquet to the bottom. On the front of the Brunch Box is a small zippered stash pocket with two tie-down loops on the inside for securing critical items. There are also three rows of elastic loops to retain charges to the front of the pouch, while also allowing for quick access. Each side of the pouch has a flat laminate loop for attaching equipment such as gloves, carabiners or chem lights. The main compartment has two grommet holes on the bottom aid with drainage of the pouch if submersion occurs. These can also be used in conjunction with out Universal Retention Kit to add a Tourniquet to the bottom. On the backside of the pouch there are three rows of Velstretch® loops for securing charges. This has the added benefit of being able to secure the hook and loop tongue when worn in fanny pack orientation. Some images shown with optional accessories, sold separately.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-brunch-box-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-brunch-box-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-bungee-retention-kit-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-bungee-retention-kit-45.jpgcustom-itemoptacticalgear-pagespsylvplcaan132BRK9.95Spiritus Systems Bungee Retention KitSpiritus Systems111Bungee Retention Kit Only; other items sold separately. Works well with the Spiritus Systems LV Placard. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-bungee-retention-kit-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-bungee-retention-kit-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-ccs-pouch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-ccs-pouch-47.jpgcustom-itemoptacticalgear-pagespsymifichri1132CR-CS114.95Spiritus Systems CCS PouchSpiritus Systems111The Spiritus Systems CCS Pouch is a purpose-build companion pouch for the MkV Chassis (purchase here). It is designed to cover the entire front of the chassis give the system a large volume of general-purpose storage. The Pouch is divided into two sections, with a strip of loop Velcro on the outside of the pouch for affixing identification and other patches. The rear interior section features two tie-down loops that are easily accessible from the top of the pouch opening and will accept the full range of Spiritus Systems utility inserts, including the padded GP insert. The front pocket is angled to ensure the pouch lays flat against the body when not in use, and will hold a wide range of phones, identification, tools and other utility equipment. The pouch is constructed out of high quality 500D Cordura nylon and both pocket sections are fully enclosed and secured with double zippers to keep small items contained. The MOLLE mounting systems consumes 6 columns and will fit flush when mounted to the chassis. It will also cover the entire front surface area of the MkV placard an helps the end user maintain full color matching capabilities with the rest of their kit. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-ccs-pouch-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-ccs-pouch-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-chem-light-aa-battery-pouch-insert-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-chem-light-aa-battery-pouch-insert-42.jpgcustom-itemoptacticalgear-pagecocavebaho132PI-CLBAT-BLK14.95Spiritus Systems Chem Light / AA Battery Pouch InsertSpiritus Systems111Insert only. All other items sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-chem-light-aa-battery-pouch-insert-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-chem-light-aa-battery-pouch-insert-55.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4400.jpglink.spsy34alchri1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4197.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4198.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-chest-rig-parts-11.jpglink.spsybarochri1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-chest-rig-parts-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-chest-rig-parts-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-configurable-med-tray-insert-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-configurable-med-tray-insert-43.jpgcustom-itemoptacticalgear-pagespsymifichri1132PI-CM19.95Spiritus Systems Configurable Med Tray InsertSpiritus Systems111• Width: 7 in.
• Height: 4.5 in.
• Thickness: 0.125 in.
• MOLLE Columns: 5 Columns
• Included Shock Cord Length: 4 ft.
• Included Barrel Locks: 4
• Build Material: Squadron, Hook Field Tegris Insert Made in the USA. Configurable Med Tray Insert and parts only, medical items and accessories sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-configurable-med-tray-insert-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-configurable-med-tray-insert-56.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-delta-bag-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-delta-bag-17.jpgcustom-itemoptacticalgear-pagemedicalpacks132BU-DB-XX299.95Spiritus Systems Delta BagSpiritus Systems111INCLUDED ITEMS: Delta Bag, Straps, and Bungee with Toggle for Trauma Shears. All Medical supplies, Trauma Shears, and other parts/inserts Sold Separately. The Delta Bag is a compact, assault medic bag that is designed to be worn over a plate carrier and hold a wide variety of medical supplies and equipment. The front of the bag is divided into three uniformly sized compartments with diagonal zipper access that enables the end user to quickly access the entire pocket without having to reposition any of its contents. The unique configuration also aids in passive retention of gear when the compartment is opened. The main compartment of the Delta Bag is a clamshell design with two full fields of loop that can accept any hookbacked accessories (including the entire line of Spiritus Systems utility inserts, and other 3rd party products). The bag can be transported with the clamshell in the open position from location to location using the integrated briefcase handles, and provides an intuitive workstation when emergency medical care is being administered. The back side of the pack features two slim compartments for keeping flat-pack items secure and damage free, and keeps the pack close to the body when worn. The included straps for the delta bag are removeable and replaceable with any 3rd party straps that attach with 1” webbing. The bag features four sewn-in metal tri-glide mounting points for strap integration. The Delta bag features mesh and metal eyelets in key locations for full water drainage capability, and is designed to remain effective and accessible in austere environments. Specs:
• Main Pocket Internal Demensions: Length 9 in. / Width 2.5 in. / Height 6 in.
• Front Pocket Internal Demensions: Length 8 in. / Width 2.5 in. / Height 4.5 in.
• External Width: 10 in.
• External Length: 14.5 in.
• External Depth: 4.25 in. INCLUDED ITEMS: Delta Bag, Straps, and Bungee with Toggle for Trauma Shears. All Medical supplies, Trauma Shears, and other parts/inserts Sold Separately. Made in the USA. ]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-delta-bag-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-delta-bag-30.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-divider-pouch-insert-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-divider-pouch-insert-43.jpgcustom-itemoptacticalgear-pagecocavebaho132PI-DIV-BLK16.95Spiritus Systems Divider Pouch InsertSpiritus Systems111Divider Insert only. All other items sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-divider-pouch-insert-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-divider-pouch-insert-56.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-elastic-strap-extender-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-elastic-strap-extender-45.jpgcustom-itemoptacticalgear-pagespsymifichri1132AC-ESE5.99Spiritus Systems Elastic Strap ExtenderSpiritus Systems111Elastic Strap Extender Only. Back Strap sold separately. The Elastic Strap Extender was built to provide extra flex in the spiritus systems back strap when the wearer needs a wider range of motion during high intensity activities or wants to layer up/down without having to adjust the length of the strap. To install the Elastic Strap Extender, simply remove one of the male Fastex buckles from the Back Strap and replace it with the Elastic Strap Extender. Made in the USA. Elastic Strap Extender Only. Back Strap sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-elastic-strap-extender-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-elastic-strap-extender-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-fanny-sack-mk2-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-fanny-sack-mk2-57.jpgcustom-itemoptacticalgear-pageinmedpoipo132FSP64.95Spiritus Systems Fanny SACK MK3Spiritus Systems111spsyinandpaFanny SACK and 2 x Elastic Loops only; all other parts sold separately. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-fanny-sack-mk2-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-fanny-sack-mk2-66.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-fat-strap-mk-2-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-fat-strap-mk-2-49.jpgcustom-itemoptacticalgear-pagespsymifichri1132MFFS49.95Spiritus Systems Fat Strap MK4Spiritus Systems111Fat Straps only. All other items sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-fat-strap-mk-2-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-fat-strap-mk-2-59.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-pouch-padded-insert-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-pouch-padded-insert-43.jpgcustom-itemoptacticalgear-pagespsymifichri1132RS-AC-PI-GP24.95Spiritus Systems GP Pouch Padded InsertSpiritus Systems111The Spiritus Systems Padded foam insert can be used to pad the interior of a Small or Medium GP against shock. The insert features a Velcro hook field that engages with the interior Velcro of the GP pouches. The flaps of the padded insert collapse to form a protective box that will accommodate night vision binoculars or other sensitive items. Once fully installed, the insert does not cover the 6th (interior) side of the pouch. This is to maximize internal storage capacity. The design relies on the torso of the wearer to provide the 6th wall of protection for the item. The outer surface of the foam pad is backed with loop Velcro and will accept any hook Velcro accessory attachments so small items like batteries or tools can be affixed and located quickly and easily. This insert is designed to work with our Small and Medium GP pouch. Spiritus Systems does not guarantee compatibility with any other pouches. Made in USA.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-pouch-padded-insert-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-pouch-padded-insert-56.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-tall-pouch-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-tall-pouch-17.jpgcustom-itemoptacticalgear-pagegepuutpo132PO-GT72.95Spiritus Systems GP Tall PouchSpiritus Systems111The Spiritus Systems GP Tall is an oversized General-Purpose pouch designed to expand the amount of useable space on a MOLLE cummerbund, back panel, or belt system. The interior is identical in width to our Medium GP pouch but features extra depth to accommodate larger items like Nalgene water bottles, expanded medical kits, or other gear. It also features tie-down loops that keep sensitive items secured when stowed. The GP Tall Pouch features a front pocket for storing items like VS-17 panels or SSE bags. The pouch is built with extra depth to allow for the storage of Night Vision Goggles and has been test fitted with 15s, 31s, and DTNVGS successfully. The pouch is constructed out of high quality 500D Cordura nylon. The inside of the pouch is lined with loop and accepts our Pouch Insert Suite. The GP Tall features an integrated belt loop that does not create extra bulk when not in use. It will accommodate 2” wide belts. The MOLLE mounting systems consumes 4 columns. Some images shown with optional accessories, sold separately. Dimensions (Approximate) Height 10" x Width 7" x Depth 3"1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-tall-pouch-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-tall-pouch-30.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-wide-pouch-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-wide-pouch-17.jpgcustom-itemoptacticalgear-pagegepuutpo132PO-GW73.95Spiritus Systems GP Wide PouchSpiritus Systems111The Spiritus Systems GP Wide is a General-Purpose pouch designed to expand the amount of useable space on a MOLLE back panel or other large MOLLE Mounting surface. The cavernous interior features a mesh divider with two interior tie-down loops that are easily accessible from the top of the pouch opening. The GP Wide Pouch features a front pocket for storing items like VS-17 panels or SSE bags. The pouch is built with extra depth to allow for the storage of Night Vision Goggles and has been test fitted with 15s, 31s, and DTNVGS successfully. The pouch is constructed out of high quality 500D Cordura nylon. The inside of the pouch is lined with loop and accepts our Pouch Insert Suite. The GP wide features an integrated belt loop that does not create extra bulk when not in use. It will accommodate 2” wide belts. The MOLLE mounting systems consumes 6 columns and will fit flush when mounted to the Spiritus Systems LV/119 MOLLE Back Panel. Dimensions (Approximate) Height 6" x Width 10.5" x Depth 3" Some images shown with optional accessories, sold separatel1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-wide-pouch-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-gp-wide-pouch-30.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-hook-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-hook-58.jpgcustom-itemoptacticalgear-pagespsymifichri1132HOOK24.95Spiritus Systems HookSpiritus Systems111 A simple method of attaching items securely where you want them. Easily stow your gloves when not in use or use it to feed chem light bundles on your next objective. The Hook is designed to be utilized on the back side of your micro fight, or underneath the flap or placard of a plate carrier. Velcro surface area measures 3x4 Inches. One side is Velcro Hook the other is Loop. Color: Jet Black Some images shown with optional accessories, sold separately. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-hook-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-hook-71.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-inserts-and-parts-15.jpglink.spsyfasamk21https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-inserts-and-parts-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-inserts-and-parts-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-jsta-pouch-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-jsta-pouch-46.jpgcustom-itemoptacticalgear-pageoptopmapo132JSTA74.95Spiritus Systems JSTA PouchSpiritus Systems111litospsyvein• 1x 5.56 Single Rifle Insert
• 1x 7.62 Single Rifle Insert
• 1x Single Pistol Insert
• 1x Double Pistol Insert
• 1x 5.56 Single Rifle Insert + 1x Single Pistol Insert
• Some Zipper Inserts will also fit this pocket The outer pouch is built with a quick-open Velcro flap, and has two compartments. The primary compartment features a Velcro loop field that will accommodate the following Spiritus Systems Utility Inserts:
• Shotgun/CR123 Battery Insert
• Chemlight / AA Battery Insert
• 3 Loop Pouch Insert The secondary compartment can function as either as admin storage for smaller items or additional spill over from the main compartment. If the outer GP pouch is empty, the pouch is designed to lay extremely flat against the body. This reduces the pouch’s snag hazard when not in use. The JSTA can either be mounted to a belt through the integrated belt loops, or with MOLLE webbing. The pouch requires 3 rows & 3 columns of MOLLE to be properly mounted and has a footprint similar to the Spiritus Systems Small GP Pouch. Outside of belt mounted configurations, the JSTA is a great alternative to a small GP for flanking a Micro Fight on the Thing 2 Chassis. It can also be mounted to an LV/119 MOLLE Cummerbund. Made in the USA. NOTE: The JSTA pouch does not include any accessories. All Velcro inserts are sold separately. ]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-jsta-pouch-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-jsta-pouch-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lbv-expander-kit-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lbv-expander-kit-12.jpgcustom-itemoptacticalgear-pagespsymifichri1132BU-LEK194.95Spiritus Systems LBV Expander KitSpiritus Systems111litospsy34alMolle Columns: 4
Molle Rows: 5]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lbv-expander-kit-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lbv-expander-kit-17.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-liberty-dynamic-flash-bang-pouch-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-liberty-dynamic-flash-bang-pouch-58.jpgcustom-itemoptacticalgear-pagespsymifichri1132PO-FL44.95Spiritus Systems Liberty Dynamic Flash Bang PouchSpiritus Systems111The Liberty Dynamic Flashbang Pouch is a purpose-built storage solution for the Liberty Dynamic Flash Bang Grenade, but with a rectangular profile that is similar in size to many other common items found on the battlefield, this pouch can effectively store a wide variety of other items. 556 magazines, certain ATAK devices, and cell phones will all work with this pouch. The internal dimensions are 2” wide x 7” tall x 1” deep. However, the elastic sides on the pouch and the adjustable top allow it to accommodate larger items (i.e. a Kagwerks EUD case measuring 3.5” wide). The MOLLE backer takes up two columns and features a split MOLLE bar on the second row so it can be configured as a belt pass-through for various belt widths. The top flap of the pouch can be stowed inside the pouch so the user can use it as an open-top storage solution, or install the included shock cord retaining tab. This pouch is also a great alternative to the MPRC Mk5 if you are using small handsets like the Baofeng UV-5R or similar radios. When configured with an open top and shock cord retaining tab it will accommodate aftermarket antennae and PTT wiring wile maintaining access to the radios top-mounted knob.
Internal Height: 6 in.
Internal Width: 2.5 in.
Internal Length: 1 in.
MOLLE Columns: 2
MOLLE Rows: 5]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-liberty-dynamic-flash-bang-pouch-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-liberty-dynamic-flash-bang-pouch-71.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lid-snake-v2-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lid-snake-v2-36.jpgcustom-itemoptacticalgear-pagenvgmoso132LS24.95Spiritus Systems Lid Snake ANVISSpiritus Systems111Lid Snake only. All other items sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lid-snake-v2-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lid-snake-v2-46.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lunch-box-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lunch-box-45.jpgcustom-itemoptacticalgear-pagespsymifichri1132LBP107.95Spiritus Systems Lunch BoxSpiritus Systems111The Lunchbox pouch is a versatile breaching pouch. It was created with exclusive input from the Direct Action Resource Center (DARC), located in Arkansas. DARC is a premiere tactics and training center with the leading breaching program in the country. Their instructors have ages of practical real world experience in explosive breaching, both the military and law enforcement realms. Spiritus Systems worked closely with DARC and applied this first hand knowledge to create a product specifically for the explosive breaching community. The Lunch Box mates well with the DARC breaching curriculum and theory and is available for use in DARC breaching courses. Larger than it's little brother the S.A.C.K Pouch, The Lunchbox was designed to carry large and bulky items with ease. For breachers the pouch is incredibly versatile, allowing the to carry an array of charges onto the objective in a clean and easy to reach package. It also consolidates charges inside of your explosive safe so that they can be accessed at a moments notice and mounted quickly to your plate carrier. The lunchbox can accommodate multiple Roll-Ups, two 8"x 8" Pucks or even a firehose charge. The back side of the pouch features 5 rows of elastic loops. These loops can be used to secure multiple Interior Door Charges for easy access. The pouch features 2 elastic shock cord loops and toggles that allow the pouch to be rolled up and stored in a low profile when not in use. This makes it a great pouch for assaulters who may need to conduct Tactical Site Exploitations or carry extra breaching equipment for the breaching cell. The pouch features a half zip design, which means that your equipment will not easily fall out of the pouch even if the zipper is left unsecured. The front of the pouch features a zippered stash pocket that is constructed using a durable 4 way stretch material and is perfect for stashing small items like det cord remnants or firing device plungers The stretch material keeps those items snug and in place. It also allows the pouch to expand if you must stuff oversized items into it. The inside features soft loop Velcro on both sides. This makes the Lunchbox very dynamic, giving you the ability to use our Velcro Insert Suite to organize mission essential equipment. It also features two slide-locks that make it easy to adjust the tension of the elastic loops hanging below, as well as two tie-down loops for securing sensitive equipment. The two grommet holes on the bottom aid with drainage of the pouch, if submersion occurs. The Lunchbox is designed to fit onto the bottom of our Micro Fight Chest Rig, or plate carrier or rig that accommodates standard hook and loop, making it a versatile choice for those changing load-outs often. Simply pull this off one kit and add it to another. The bottom of the pouch features two elastic loops that can be adjusted to hold a tourniquet or other equipment that you may need to rapidly deploy. If bottom carry doesn't fit your mission needs, you can easily remove and reinstall the loops as necessary. Made in in the USA.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lunch-box-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lunch-box-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv-placard-556-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv-placard-556-44.jpgcustom-itemoptacticalgear-pagespsylvplcaan132LVP-55659.95Spiritus Systems LV Placard - 556Spiritus Systems111litoburekitThe LV Placard can also be used as a stand alone chest rig when combined with Spiritus Systmes Micro Fight components. Each corner has a small loop of 1" webbing. This webbing is used to attach the included ITW Nexus hardware, which can be combined with the Micro Fight Fat Straps and Back Strap for a complete mini chest rig! Bungee Retention Kit for the pouch openings available and sold separately. LV Placard, Velcro Backer, and 4 x Nexus Buckles only. All other parts sold separately. Made in the USA. ]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv-placard-556-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv-placard-556-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-advanced-cummerbund-5-inch-elastic-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-advanced-cummerbund-5-inch-elastic-38.jpgcustom-itemoptacticalgear-pagespsylvplcaan132CB-5E78.95Spiritus Systems LV119 Elastic HLT CummerbundSpiritus Systems111This Cummerbund is designed for use with a front and rear LV119 plate bag (sold separately). The 5-Inch Elastic Hook/Loop Tape (HLT) Cummerbund is a simple and effective solution for professionals who need to carry and have rapid access to additional ammunition and equipment on their sides while still maintaining a low profile. Side loading is great for ground vehicle and low visibility operations. Elastic cells are 3 inches wide and are built around standard 5.56 Magazines, such as the PMAG. Elastic cummerbunds prevent user fatigue while worn for long durations, as they stretch with the body during active maneuvers. By using 5-Inch Elastic, we allow for the stable carriage of taller items as they are held more securely. The sewn-on pull tabs allow for the use of the Bungee Retention Kit to securely hold items for HALO, OTB, or other kinetic operations. The tabs also allow users to pull on the cell and make it easier to load and extract equipment. The Elastic HLT Cummerbund features premium, Berry Amendment Compliant materials sourced from industry leaders in textiles manufacturing. It offers superior construction processes, including triple stitching on the elastic cells to prolong life and prevent cell failure when stuffed with-non standard or oddly shaped items. Cummerbund Attachment
The cummerbund attachment is a proprietary system that allows for the use of all of our cummerbunds, as well as allowing for a wide range of adjustment. The cummerbund attaches inside the plate bag, which is advantageous for a few reasons. 1. There is no external mounting that can get snagged or rip off when exiting vehicles in haste. 2. The design creates a smooth profile when worn underneath clothing. 3. Hook & loop is not utilized as an attachment method on the rear plate bag. Hook & loop wears out over time and is a generally less-than-optimal attachment method when not supported in other ways. Hook & loop doesn't handle weight well and it sticks to everything, especially cloth seats. SIZING: The cummerbund comes in two sizes: Size 1 and Size 2, each offering up to 14 inches of total adjustment. This allows for a proper fitment for all body types. To figure our appropriate sizing, take measurement of the waist at the belly button. When measuring, users should dress as they would while actually wearing the carrier. For example, if the user is operating in arctic environments, they should be wearing cold weather equipment when measuring. Size 1: 28" to 42" Size 2: 40" to 54" If your waist measurement is 42", we suggest going up to the Size 2 cummerbund. NOTE: The LV119 Cummerbund is part of the LV119 Plate Carrier System. This item does not include a Front Plate Bag, Rear Plate Bag, Shoulder Covers, Placards, or any other accessories. Additional components are required for proper use. Some images shown with optional accessories, sold separately. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-advanced-cummerbund-5-inch-elastic-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-advanced-cummerbund-5-inch-elastic-48.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-molle-cummerbund-velcro-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-molle-cummerbund-velcro-38.jpgcustom-itemoptacticalgear-pagespsylvplcaan130CB5MV67.95Spiritus Systems LV119 MOLLE HLT CummerbundSpiritus Systems111 The LV119 MOLLE HLT Cummerbund requires a Front and Rear Bag for proper operation. The MOLLE Hook/Loop Tape (HLT) Cummerbund was designed to be a lightweight and simple load carriage solution for the LV/119 series of vests. Using the widely adopted MOLLE system, the cummerbund offers almost infinite configurations for mission needs by utilizing any MOLLE accessory that can be found on the market. The cummerbund is designed to allow simultaneous use of the same MOLLE cell for products mounted on the inside and outside of the cummerbund. The MOLLE HLT Cummerbund features premium, Berry Amendment Compliant materials sourced from industry leaders in textiles' manufacturing. Attachment.
The cummerbund attachment is a proprietary system that allows for the use of all of our cummerbunds, as well as allowing for a wide range of adjustment. The cummerbund attaches inside the plate bag, which is advantageous for a few reasons. 1. There is no external mounting that can get snagged or rip off when exiting vehicles in haste. 2. The design creates a smooth profile when worn underneath clothing. 3. Hook & Loop is not utilized as an attachment method on the rear plate bag. Hook & Loop wears out over time and is a generally less-than-optimal attachment method when not supported in other ways. Hook & Loop doesn't handle weight well and it sticks to everything, especially cloth seats. SIZING:
The cummerbund comes in two sizes: Size 1 and Size 2, each offering up to 14 inches of total adjustment. This allows for a proper fitment for all body types.
To figure our appropriate sizing, take measurement of the waist at the belly button. When measuring, users should dress as they would while actually wearing the carrier. For example, if the user is operating in arctic environments, they should be wearing cold weather equipment when measuring.
• Size 1: 28" to 42"
• Size 2: 40" to 54" If your waist measurement is 42", we suggest going up to the Size 2 cummerbund. NOTE: The LV119 Cummerbund is part of the LV119 Plate Carrier System. This item does not include a Front Plate Bag, Rear Plate Bag, Shoulder Covers, Placards, or any other accessories. Additional components are required for proper use. Made in the USA. Some images shown with optional accessories, sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-molle-cummerbund-velcro-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-molle-cummerbund-velcro-48.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-overt-front-plate-bag-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-overt-front-plate-bag-47.jpgcustom-itemoptacticalgear-pagespsylvplcaan132LV119FO115.95Spiritus Systems LV119 OVERT Front Plate BagSpiritus Systems111The LV119 Front Plate Bag requires a Rear Bag and Cummerbund for proper operation. The Spiritus Systems LV119 O V E R T shares the same profile as the C O V E R T plate bags but with modifications that make it more suitable for high profile operations. The front bag features a 3 Row / 4 Column MOLLE field that doubles as a 6” x 3” Velcro Field. This may be used to attach End User Devices (EUDs), such as those made by KAGWERKS or Juggernaut Defense. The Velcro may be used to mount placards, patches, and IR identifiers. The MOLLE can also be used to mount administrative pouches, frag grenade pouches, or anything else users may require quick need access to. Every front plate bag comes standard with sewn loops on the sides for attaching First Spear TUBES™ for use with our tubes cummerbund (available soon). Placard and Chest Rig Integration.
All LV/119 Plate Bags offer placard and chest rig integration via removable 1 Inch ITW NEXUS Buckles. These clips are removable, allowing users to reduce the signature of the plate bag if it is being worn under a cover shirt or being utilized in a low-profile role. Push To Talk Support.
Each O V E R T front plate bag comes standard with a PTT/Porkchop Loop on either side. Communication Cable Routing.
The Modern Warfighter and Law Enforcement Officer has a radio. To date, the majority of manufacturers have not taken end-user communications needs in to their design considerations - we endeavor to break that paradigm. The O V E R T front bag offers open shoulders to facilitate commo cable routing inside the plate bags and over the shoulders. It also offers small routing points by the 1 Inch ITW NEXUS buckles on the chest - easily accommodating PTT cable routing. Plate Fitment.
The carrier was designed to fit United States Standard Issue SAPI cut plates. The bags were built to accommodate "thicker" plates, but they will not fit plates that are NOT cut to the SAPI Spec. Medium -10" x 12.5" Large - 10.25" x 13.25" Thickness - MAXIMUM of 1.20" NOTE: The LV119 Front Plate Bag is part of the LV119 Plate Carrier System. This item does not include a Rear Plate Bag, Cummerbund, Shoulder Covers, Placards, or any other accessories. Additional components are required for proper use. Some images shown with optional accessories, sold separately. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-overt-front-plate-bag-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-overt-front-plate-bag-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-overt-rear-plate-bag-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-overt-rear-plate-bag-47.jpgcustom-itemoptacticalgear-pagespsylvplcaan132LV119RO115.95Spiritus Systems LV119 OVERT Rear Plate BagSpiritus Systems111The LV119 Rear Plate Bag requires a Front Bag and Cummerbund for proper operation. The LV/119 O V E R T Rear Plate bag was built for those who need a scalable vest to wear in a multitude of environments ranging from Low Visibility to Direct Action. The O V E R T shares the same profile as the C O V E R T plate bags, while possessing additional features that make it more suitable for high profile operations. The rear plate bag features full integration of our Recovery Handle™. The rear bag also features minimal MOLLE webbing and Zippers for future integrations with our Zip-on panels that will be available later this year. Back Panel Support.
The rear bag also features minimal MOLLE webbing and Zippers for future integrations with our Zip-on panels that will be available later this year. Note: The back panel integration is proprietary and will not support other brands of back panels. Communications Cable Routing.
The Modern Warfighter and Law Enforcement Officer has a radio. To date, the majority of manufacturers have not taken end-user communications needs in to their design considerations - we endeavor to break that paradigm. The O V E R T offers open shoulders to facilitate commo cable routing inside the plate bags and over the shoulders. Cables may also be routed through the cummerbund access. Recovery Handle™ Integration.
Full integration of our Recovery Handle (Sold Separately). Cummerbund Attachment.
The cummerbund attachment is a proprietary system that allows for the use of all of our cummerbunds as well as allowing for a wide range of adjustment. The cummerbund attaches inside the plate bag, which is advantageous for a few reasons. 1. There is no external mounting that can get snagged or rip off when exiting vehicles in haste. 2. The design creates a smooth profile when worn underneath clothing. 3. Velcro is NOT utilized as an attachment method. Velcro wears out over time and is a generally less-than-optimal attachment method when not supported in other ways. Velcro doesn't handle weight well and it sticks to everything, especially cloth seats. Plate Fitment.
The carrier was designed to fit United States Standard Issue SAPI cut plates. The bags were built to accommodate "thicker" plates, but they will not fit plates that are NOT cut to the SAPI Spec. Medium -10" x 12.5" Large - 10.25" x 13.25" Thickness - MAXIMUM of 1.20" NOTE: The LV119 Rear Plate Bag is part of the LV119 Plate Carrier System. This item does not include a Front Plate Bag, Cummerbund, Shoulder Covers, Placards, or any other accessories. Additional components are required for proper use. Some images shown with optional accessories, sold separately. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-overt-rear-plate-bag-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-overt-rear-plate-bag-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-plate-carrier-and-parts-43.jpgcustom-itemoptacticalgear-pageplatecarriersSpiritus Systems LV119 Plate Carriers and Parts1spsylvovfrplspsylvovreplspsymifichri1spsymotucuspsylvadcu5espsylvmocuvespsyasbapacospsybapamoflspsybapaflflspsybapagpflspsymobapaspsyshcotrspsyrehaspsylvpl556spsyburekitsp1initwnebuspsymifichmk1spsymifichmkspsymoexwi1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-plate-carrier-and-parts-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-lv119-plate-carrier-and-parts-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-medium-gp-pouch-mk3-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-medium-gp-pouch-mk3-51.jpgcustom-itemoptacticalgear-pagespsymifichri1132PO-GM59.95Spiritus Systems Medium GP Pouch Mk3Spiritus Systems111Dimensions (Approximate) Height 6" x Width 7" x Depth 2"
Main Pocket Internal Dimensions:
• Height 6.25 in. / Length 6.5 in. / Width 2.5 in.
Front Pocket Internal Dimensions:
• Height 4.5 in. / Length 6 in. / Width 1.5 in.
Molle Collumns: 4
Molle Rows: 5]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-medium-gp-pouch-mk3-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-medium-gp-pouch-mk3-64.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chassis-mk-2-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chassis-mk-2-61.jpgcustom-itemoptacticalgear-pagespsylvplcaan132MFC75.95Spiritus Systems Micro Fight Chassis MK 4Spiritus Systems111litounrekitThe NEW Micro Fight Mk4 Chassis now has additional features and upgrades:
• 2 added grommet holes along the bottom to use with the Universal Retention Kit (sold separately, see link below) for holding Tourniquets and similar items.
• Rear attachment Velcro now covers the entire back side of the Chassis to create the greatest hold with plate carriers when worn as a placard. The Mk4 Chassis is designed to be extremely efficient, modular, and lightweight. The Micro Fight works seamlessly with our accessories suite, which offers nearly endless configurations. The Micro Fight features soft loop Velcro in both pockets to enable you to put mission essential items where you want them based on your individual needs. The improved profile allows for the use of six 5.56 x .45 style magazines or four 7.62 x .51 magazines or any combination of rifle and pistol magazines. The 5” x 9” field of hard loop Velcro on the back of the rig allows for solid integration with accessories, such as the SACK Pouch or Expander Wings. The larger Velcro field also allows a solid integration onto plate carriers, such as the LV119. In addition to the larger Velcro field, the MK 4 also allows for sub load integration of a tourniquet utilizing the two integrated grommets and our Universal Retention Kit. Unmatched Versatility
The Micro Fight Chest Rig sports a host of accessories like no other system. The user can select from any of our accessories to meet operational requirements. The platform is lightweight and small while still allowing you to carry multiple types of munitions and equipment. Examples include rifle and pistol Magazines, 37/40mm grenades, flash-bangs, multi-tools, flashlights, medical supplies, and breaching equipment. Stand Alone System
The Micro Fight Chest Rig was designed to perform as a stand-alone system. It can be configured for wear in low visibility environments that require minimal printing through clothing with maximum equipment storage. It can also be configured for high visibility operations where a full spectrum of equipment is required. Placard Configuration
The Micro Fight Chest Rig was designed to work seamlessly as a "Placard" for plate carrier systems. Simply remove the 1 inch side release buckles and attach the system via the hard loop Velcro located on the back of the system to you plate carrier. This configuration allows for profile expansion or reduction as mission requirements change. NOTE: The Mk4 Chassis is part of the Micro Fight Chest Rig System. This item does NOT include shoulder straps, back strap, half or full flaps, magazine inserts, or any other accessories. Additional components are required for proper use. If running as a stand-alone system, shoulder straps, back strap, magazine inserts, and possibly full or half flaps are needed. If running on a plate carrier, flap(s), and magazine insert(s) are needed. Material: 500D Cordura Included in this package:
1 x Micro Fight Chassis
4 x Side Buckles
1 x Velcro Backer Made in the USA. NOTE: Chassis only. Some images shown with optional accessories, all sold separately. Tourniquet and Universal Retention Kit to attach it are sold sperately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chassis-mk-2-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chassis-mk-2-71.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chassis-mk-v-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chassis-mk-v-47.jpgcustom-itemoptacticalgear-pagespsylvplcaan132MF-0555.95Spiritus Systems Micro Fight Chassis Mk VSpiritus Systems111litomifiacThe Micro Fight Chest Rig MkV will interface with the whole line of Spiritus Systems chest rig and plate carrier components. The footprint of the MkV is identical to the Mk4 and will seamlessly connect with Expander Wings, LV/119 plate bags, and the Thing 1 and Thing 2. The MkV is extremely capable as a low-bulk solution for environments where space and weight command a premium. However, the product’s modularity and compatibility with all Spiritus Accessories allow the micro fight to scale from a minimalistic magazine carrier to a full-fledged plate carrier system, or various sustainment and comms-focused chest rigs. The CCS Pouch (Sold Separately)
The MkV can be combined with its companion product, the CCS Pouch (sold separately). The CCS pouch is a full-featured GP Pouch that vastly improves upon the legacy front cell’s functionality, and storage capacity. For those that do not need a GP Pouch solution, the MkV’s MOLLE front will accept any 3rd party magazine holders or other pouches. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chassis-mk-v-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chassis-mk-v-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chest-rig-and-accessories-56.jpgcustom-itemoptacticalgear-pagespsylvplcaanSpiritus Systems Micro Fight Chest Rig and Accessories1spsy34alchrispsyccspospsymifichmk1spsymifichmkspsylvpl556spsylbvexkitsp1initwnebuspsyth2spsymifiexwispsysapomk3spsygptapospsygpwipospsymurachmkaxlspchinspsylidyflbaspsysmgppospsygppopainspsymegppomkspsybarochrispsymififatsspsymifibastspsyelstexspsymifihafl1spsymififufl1spsyburekitspsyunrekitspsyfasamk2spsyluboxspsymoexwispsymifirimacotatrrooshspsymifipimaspsysipimainspsysugunmaispsyrisimagispsyhospsycomedtrimisycamimisycamid4x6misycaspsynawabopoaxlfumopaforaxlhamopaforbecuziinforsbecumifisthaspsychliaabaspsysh12poinspsy3lopoinspsy4lopoinspsydipoinspsyreha1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chest-rig-and-accessories-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-chest-rig-and-accessories-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-expander-wings-set-of-2-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-expander-wings-set-of-2-49.jpgcustom-itemoptacticalgear-pagespsymifichri1132MFEW39.95Spiritus Systems Micro Fight Expander Wing Mk 2Spiritus Systems111Sold Individually. If you need a pair then buy 2. The Expander Wing Mk 2 was built as direct replacement for the original Spiritus Systems Micro Fight Expander Wing Set with a focus on enhancing the product’s functionality for plate carriers. The wing attaches to a Micro Fight Chassis or 556 Placard with a Velcro flap and can be mounted for increased storage capacity on a chest rig or under the cummerbunds of a LV/119. Unlike its predecessor, the Expander Wing Mk 2 is completely reversible, and can be used on either the right or left side of the torso without any reduction in functionality or storage capacity. Spiritus Systems sells the Expander Wing Mk 2 individually for end users who do not require a full set for their loadout. Wings used for chest rigs are mounted to the soft loop Velcro field on the back side of the Micro Fight Chest Rig. They also utilize our unique loop over design that attaches to your Fat or Skinny straps to ensure a comfortable and stable attachment that will not sag even with heavy items placed inside. When used in conjunction with plate carriers, the Expander Wing Mk 2 will integrate with both Velcro and TUBES cummerbunds. The wing features a TUBES bar pass-through so the cummerbund can be attached or separated without the need to remove the expander wing. The Expander Wing Mk 2 is designed to hug the body which reduces their signature and securely holds items in place. The base Expander Wing Mk 2 pocket depth is 6" however, the adjustable internal retention strap can be lengthened or shortened to create the perfect pocket depth for your items. The top of the pocket also features double eyelets and a bungee retention kit, so radios and magazines remain secure during periods of movement. The expander wing will hold most small & medium caliber rifle magazines as well as a variety of radio platforms like the MPU5, 152, 163, and smaller units like Motorola XTS 5000. Includes bungee, cord lock, and pull tab for securing radios and gear in the wing. Made in the USA. Sold Individually. If you need a pair then buy 2. ]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-expander-wings-set-of-2-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-expander-wings-set-of-2-59.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-full-flap-mk2-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-full-flap-mk2-17.jpgcustom-itemoptacticalgear-pagespsymifichri1132CRFFMK229.95Spiritus Systems Micro Fight Full Flap MK2Spiritus Systems111Full Flap MK2 only. All other items sold separately. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-full-flap-mk2-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-full-flap-mk2-30.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-half-flap-mk2-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-half-flap-mk2-17.jpgcustom-itemoptacticalgear-pagespsymifichri1134CRHFMK219.95Spiritus Systems Micro Fight Half Flap Mk2Spiritus Systems111Half Flap MK2 only. All other items sold separately. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-half-flap-mk2-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-half-flap-mk2-30.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-pistol-magazine-insert-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-pistol-magazine-insert-42.jpgcustom-itemoptacticalgear-pagespsymifichri1132MIP19.95Spiritus Systems Micro Fight Pistol Magazine InsertSpiritus Systems111Made from mil-spec elastic and webbing, this insert allows for open-top quick access to magazine and eliminates the need for pull tabs. The insert also provides secure retention for metal or polymer magazines, and gives you the ability to re-insert mags one-handed. Using elastic has the added benefit of making it very quiet when removing or adding magazines. When mags are not inserted, the insert can fold flat for a slim profile and easy packing. Designed to hold 2 x pistol magazines. Accepts most double-stack pistol magazines. Velcro hook on both sides to secure the pouch. Made in the USA. Color: black]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-pistol-magazine-insert-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-pistol-magazine-insert-55.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-rifle-magazine-insert-5-56-and-7-62-nato-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-rifle-magazine-insert-5-56-and-7-62-nato-42.jpgcustom-itemoptacticalgear-pagespsymifichri1132MI-XXX24.95Spiritus Systems Micro Fight Rifle Magazine Insert MK3Spiritus Systems111This is the latest MK3 model featuring velcro Hook on both sides. This insert is ONLY compatible with the Micro Fight MK3 Chassis. It is not compatible with the MK2 or MK1 Chassis. It may or may not be effective in the kangaroo pouch of an armor carrier, depending on tightness of fit. The Magazine Insert is a custom solution to a common problem. Instead of using pull tabs or a hard kydex insert, we decided to go with a more innovative solution. Made from mil-spec elastic and webbing, this insert allows for open-top quick access to magazine and eliminates the need for pull tabs. The insert also provides secure retention for metal or polymer magazines, and gives you the ability to re-insert mags one-handed. Using elastic has the added benefit of making it very quiet when removing or adding magazines, and sitting flat when not in use. When mags are not inserted, the insert can fold flat for a slim profile and easy packing. This is a critical piece of the Micro Fight Chest Rig System, and can also be used as an upgrade in other products that use velcro to secure their magazine retention system, such as plate carriers featuring velcro kangaroo pockets. Made in in the USA. Color: black]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-rifle-magazine-insert-5-56-and-7-62-nato-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-micro-fight-rifle-magazine-insert-5-56-and-7-62-nato-52.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-back-panel-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-back-panel-47.jpgcustom-itemoptacticalgear-pagespsylvplcaan132PC-MP82.95Spiritus Systems MOLLE Back PanelSpiritus Systems111Designed to ONLY fit Spiritus Systems Rear Plate Bags with Zip-On capability. MOLLE Back Panel Only. Pouches and Accessories sold separately. The MOLLE back panel was designed to give LV/119 O V E R T users the ability to quickly swap out multiple rear bag loadout configurations based on the needs of a mission set. With its semi-rigid MOLLE frame, multiple anchor points, and quick zip installation, the MOLLE Back Panel is just as robust as a permanent sewn-in system while providing a near limitless set of pouch combination options. The MOLLE Back Panel features six columns of MOLLE, which provides ample real estate for attaching water bladders, wide pouches, or multiple small pouches side-by-side. End users can now keep one plate carrier for all missions and simply swap out back panels that have been preloaded with specific equipment and MOLLE storage solutions. Swapping between MOLLE Back Panels takes less than a minute and requires no tools. This allows operators to store additional back panels in vehicles or ready rooms for rapid deployment when needed. The MOLLE Back Panel features 6 slots across, and 12 slots down. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-back-panel-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-back-panel-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-expander-wing-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-expander-wing-47.jpgcustom-itemoptacticalgear-pagespsymifichri1132CR-EW29.95Spiritus Systems MOLLE Expander WingSpiritus Systems111The MOLLE Expander Wing is an ambidextrous and versatile platform for mounting knives, pouches, and other kit underneath the cummerbund of the LV/119 plate carrier. The wing integrates with the front plate bag via a double sided hook and loop field that can be mounted on the front plate bag's loop panel, under a Micro Fight Chassis or 556 Placard. The wing features integrated loops and a pass through for female Tubes™ bars. This allows the wing to seamlessly work with a Tubes™-equipped LV/119, or allow for the integration of tubes on a plate carrier that would not otherwise accept them. The MOLLE grid is backed with ballistic Tegris for a solid mounting platform and uses regularly-spaced metal eyelets so other non-standard items can be lashed or zip-tied to the wing. The MOLLE grid is comprised of two columns and two rows.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-expander-wing-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-expander-wing-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-tubes-cummerbund-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-tubes-cummerbund-47.jpgcustom-itemoptacticalgear-pagespsylvplcaan132PC-MT94.95Spiritus Systems MOLLE TUBES CummerbundSpiritus Systems111The TUBES™ MOLLE CUMMERBUND IS ONLY COMPATIBLE WITH THE SPIRITUS SYSTEMS LV-119 FRONT OVERT PLATE BAG. However it can be used with either the COVERT OR OVERT REAR BAG. SOLD AS A PAIR. The TUBES™ MOLLE Cummerbund was designed to be a lightweight and simple load carriage solution for the LV/119 series of vests. Using the widely adopted MOLLE system, the cummerbund offers almost infinite configurations for mission needs by utilizing any MOLLE accessory that can be found on the market. The cummerbund has MOLLE webbing on both sides, so that you can utilize either side to attach equipment or armor. The TUBES™ MOLLE Cummerbund is a great option for those who are in and out of their vest frequently and have experienced wear and tear on their Velcro attachment vests. It is also a great option for those who are wearing their equipment in and around water. The TUBES™ MOLLE Cummerbund features the proprietary TUBES™ Attachments systems developed by and officially licensed from First Spear. The TUBES™ MOLLE Cummerbund is Berry Amendment Compliant materials sourced from industry leaders in textiles manufacturing. Attachment. The LV Series of vests hosts an attachment system like no other. This system allows for maximum adjustment and stability. This cummerbund will NOT sag when it is fully loaded unlike velcro-attached cummerbunds. The Cummerbund come with all parts and pieces necessary to attach to an Overt carrier. It includes the cummerbund, the TUBE integrator for the vest as well as the shockcord required to attach the cummerbund to the rear plate bag. SIZING: The cummerbund comes in two sizes: Size 1 and Size 2, each offering up to 14 inches of total adjustment. This allows for a proper fitment for all body types. To figure our appropriate sizing, take measurement of the waist at the belly button. When measuring, users should dress as they would while actually wearing the carrier. For example, if the user is operating in arctic environments, they should be wearing cold weather equipment when measuring.
• Size 1: 28" to 42"
• Size 2: 40" to 54" If your waist measurement is 42", we suggest going up to the Size 2 cummerbund. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-tubes-cummerbund-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-molle-tubes-cummerbund-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-multi-platform-radio-chassis-mk-5-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-multi-platform-radio-chassis-mk-5-17.jpgcustom-itemoptacticalgear-pageradiopouches132AC-RC-MP84.95Spiritus Systems Multi-Platform Radio Chassis Mk 5Spiritus Systems111• Persistent Systems MPU5
• L3/Harris AN/PRC-163
• L3/Harris AN/PRC-152
• Thales AN/PRC-148
• Motorola XTS 5000
• Motorola APX 8000
• Motorola APX 7000
• & more… Smallest Recommended Radio Compatibility dimensions* 5.5” Tall - 2.75” wide - 1.25” Deep Largest Recommended Radio Compatibility dimensions* 12+” Tall - 4” wide - 4” Deep *These dimensions be further expanded or retracted via micro adjustments to the Veclro on the battery cup and top strap.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-multi-platform-radio-chassis-mk-5-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-multi-platform-radio-chassis-mk-5-30.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-nalgene-water-bottle-pouch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-nalgene-water-bottle-pouch-47.jpgcustom-itemoptacticalgear-pagespsymifichri1132PO-NB39.95Spiritus Systems Nalgene Water Bottle PouchSpiritus Systems111Pouch Only. Water bottle sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-nalgene-water-bottle-pouch-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-nalgene-water-bottle-pouch-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-pangolin-flap-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-pangolin-flap-47.jpgcustom-itemoptacticalgear-pagecltopmapo132AC-PF-XX11.95Spiritus Systems Pangolin FlapSpiritus Systems111Flap Only. Compbatible Pouches and Placards sold separately. The Pangolin Flap is a multi-purpose pouch closure that can be used in conjunction with the SPUD Pouch, Micro Fight Chassis, or other 3rd party products. They will attach to any pouch or magazine holder with a Velcro loop field on the front. The flap features a multi-directional laser-cut scrim pattern that allows it to wrap and form around irregular objects when pulled tight. This reduces equipment slop when secured in the pouch. Pangolin Flaps are sold individually but can be run in groups in the Micro Fight Chest Rig System by securing them between the elastic magazine inserts, and the chassis. Made in the USA. Flap Only. Compbatible Pouches and Placards sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-pangolin-flap-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-pangolin-flap-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-limited-edition-hot-dog-patch-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-hot-dog-pvc-23.jpgcustom-itemoptacticalgear-pagepvcpatchesOPTSSHDPVC7Spiritus Systems PVC Hot Dog PatchSpiritus Systems111For those who like their counterculture turned up to eleven. Hotdog PVC, but why? Because it's a hotdog, that's why, no hidden joke, it's a f!cking hotdog. Size: 3" PVC material Velcro hook backing.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-hot-dog-pvc-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-hot-dog-pvc-30.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-recovery-handle-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-recovery-handle-49.jpgcustom-itemoptacticalgear-pagespsylvplcaan132RH49.95Spiritus Systems Recovery Handle Mk2Spiritus Systems111rehausguNOTE: The Recovery Handle™ Mk2 DOES NOT INCLUDE the carabiner that will connect the system to the wearer's belt. We recommend you use one with a proper load rating and safety features. The Recovery Handle™ mounts directly to the LV/119 Rear Plate Bag, or a MOLLE compatible vest. The Recovery Handle™ Mk2 sets the standard for emergency casualty evacuation and recovery in non-permissive environments. We are proud to have teamed up with the Direct Action Resource Center to realize their long standing vision and innovative design. The system provides a reliable and repeatable method for dragging a casualty off of the “X” or away from the objective. Unlike other drag handle systems it transfers the force of the evacuation to the hips of the casualty. This prevents the plate carrier from striking them in face, or cutting off their airway. Because the strap deploys to a greater length it allows the operator performing the evacuation to stand straight up which prevents fatigue and helps maintain situational awareness. The Recovery Handle™ mounts directly to the LV/119 Rear Plate Bag, or your MOLLE compatible vest and can be deployed in seconds with a quick pull of the handle. The Recovery Handle™ Mk2 internally retains the excess webbing that would normally be tucked into your MOLLE loops, giving you a clean and snag free solution. The system can easily be repackaged which makes it ideal for resetting the handle while preforming multiple iterations of training. The Recovery Handle™ Mk2 now features removable Tegris® stays with directional snaps that will unlock when enough force is used during deployment. This ensures the Recovery Handle™ Mk2 will reliably deploy from the rear plate bag on an incapacitated individual every time. See link below for Recovery Handle user guide.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-recovery-handle-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-recovery-handle-59.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-rifle-single-mag-insert-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-rifle-single-mag-insert-45.jpgcustom-itemoptacticalgear-pagespsymifichri1132XX-SNGL-BLK19.95Spiritus Systems Rifle Single InsertSpiritus Systems111 The Rifle Single Mag Insert is a custom insert with velcro hook on both sides that allows you to plus-up magazines one by one. It can fit into either pocket on the Micro Fight Chassis MK 3, as well as the FRONT POCKET ONLY on the MK 2. This product is not compatible with the MK1 series. Using elastic is very quiet when removing or adding magazines, giving you quick and easy access to your magazines while providing excellent retention. You can also re-insert magazines with one hand using this insert. This product is also compatible with the Unity Tactical CLUTCH belt. Color: Black Made in the USA. Insert only, other items sold separately. 1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-rifle-single-mag-insert-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-rifle-single-mag-insert-55.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sack-pouch-mk3-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sack-pouch-mk3-47.jpgcustom-itemoptacticalgear-pagespsymifichri1132SPMK364.95Spiritus Systems SACK Pouch Mk3Spiritus Systems111litocomedtri• Height 4.50"
• Width 7.00"
• Depth 2.50 "
• Velcro Attachment measures 7"x 4" Made in the USA. SACK Pouch Only. Medical items and gear sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sack-pouch-mk3-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sack-pouch-mk3-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoe-snakes-multicam-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoe-snakes-multicam-17.jpgcustom-itemoptacticalgear-pagesoandin132-RS-ACC9.95Spiritus Systems Shoe Snakes - MulticamSpiritus Systems111Shoes not included]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoe-snakes-multicam-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoe-snakes-multicam-30.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shotgun-123cr-pouch-insert-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shotgun-123cr-pouch-insert-42.jpgcustom-itemoptacticalgear-pagespsymifichri1132PI-SGBAT14.95Spiritus Systems Shotgun / 123CR Pouch InsertSpiritus Systems111The Spiritus Systems Pouch Insert Suite is designed to optimize your equipment through organization and increase performance by improving function. The inserts were designed to be modular, allowing you to mix and match them to your specific needs. The Shotgun/123A Battery Pouch Insert is a simple yet effective design that allows you to carry Shotgun Shells or 123A batteries in a secure and organized fashion. We utilized a larger footprint in order to give the insert stability and keep it in place even in the most non-permissive environments. While most Velcro placards on the market today are flimsy and unreliable, our insert suite is designed to stay in place exactly where you attach it. Simply attach the Velcro Hard Loop Insert into your pouch or onto your Soft Loop lined accessory. Holds Six shotgun shells or Six 123A batteries. Compatible with all Spiritus Systems Pouches. Available in Jet Black. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shotgun-123cr-pouch-insert-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shotgun-123cr-pouch-insert-55.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoulder-cover-trifold-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoulder-cover-trifold-46.jpgcustom-itemoptacticalgear-pagecaac1132SC-TF19.95Spiritus Systems Shoulder Cover - TrifoldSpiritus Systems111The TRI Fold shoulder cover is a simple solution for covering up your LV/119 shoulder straps. Although these are not built with padding in mind, they do offer some comfort for extended wear. The TRI Fold design makes these easy to take on and off. It also makes routing communication wires easy and simple. NOTE: The Shoulder Cover is part of the LV/119 Plate Carrier System. This item does not include a Front Plate Bag, Rear Plate Bag, Cummerbund, Placards, or any other accessories. Additional components are required for proper use. Some images shown with optional accessories, sold separately. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoulder-cover-trifold-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-shoulder-cover-trifold-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sierratac-non-padded-sling-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sierratac-non-padded-sling-44.jpgcustom-itemoptacticalgear-pagetwopointslings132AC-SN-ST-BK39.95Spiritus Systems SIERRATAC Non-Padded SlingSpiritus Systems111• SIERRATAC Proprietary Billet Aluminum Slider allows for quick tension adjustment to the sling without the inherent danger of a tail snagging other items. The slider acts as a solid indexing point under stressful or dark conditions. The slider does have machined slots that allow the user to add a small pull tab to it if desired.
• Open looped ends allow the user to add whatever mounting hardware is needed to fit their needs. Sling and Sling Retention Band Only. Swivels and mounts sold separately. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sierratac-non-padded-sling-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sierratac-non-padded-sling-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-single-pistol-magazine-insert-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-single-pistol-magazine-insert-41.jpgcustom-itemoptacticalgear-pagespsymifichri1132MIP-SNGL14.95Spiritus Systems Single Pistol Magazine InsertSpiritus Systems111 The Single Pistol Magazine Insert is a custom solution to a common problem. Instead of using pull tabs, velcro/snap flaps, or a hard kydex insert, we decided to be a little more innovative. Using elastic is very quiet when removing or adding magazines, giving you quick and easy access to your magazines while providing excellent retention. Accepts most double-stack pistol magazines. Color: Black Some images shown with optional accessories, sold separately. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-single-pistol-magazine-insert-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-single-pistol-magazine-insert-54.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sling-retention-bands-4-pack-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sling-retention-bands-4-pack-42.jpgcustom-itemoptacticalgear-pageslac132RS-ACC-BANDS5.95Spiritus Systems Sling Retention Bands - 4 PackSpiritus Systems111The Spiritus Systems Sling Retention Bands are sold in packs of four and manufactured out of UV-resistant EPDM rubber. The bands feature an oversized side wall that maintains the bands elasticity intact after long periods of use. The bands are built to fit securely on most rifle fore-ends with enough expansion room for the SIERRATAC Padded and Non-Padded Slings. The bands are colored matte black and have a low-reflective surface.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sling-retention-bands-4-pack-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-sling-retention-bands-4-pack-56.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-small-gp-pouch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-small-gp-pouch-47.jpgcustom-itemoptacticalgear-pagegepuutpo132PO-GS54.95Spiritus Systems Small GP PouchSpiritus Systems111There are plenty of GP pouches out there on the market, but this one is more than your average General Purpose pouch. Using feedback from service members of multiple organizations, we've expanded what a GP pouch can be. The Small GP Pouch features a front pocket for storing items like VS-17 panels or SSE bags. The pouch is built with extra depth to allow for the storage of Night Vision Goggles and has been test fitted with 15s, 31s, and DTNVGS successfully. The pouch is constructed out of high quality 500d Cordura nylon. The inside of the pouch is lined with Velcro and accepts our Pouch Insert Suite. The Small Gp Pouch is designed to mount to MOLLE or Belt Systems. For MOLLE the pouch consumes 3 Columns. For Belts it has a pass through that can accommodate 2" wide belts. Dimensions (Approximate) Height 5.5" x Width 5.5" x Depth 3" Some images shown with optional accessories, sold separately. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-small-gp-pouch-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-small-gp-pouch-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-spud-pouch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-spud-pouch-47.jpgcustom-itemoptacticalgear-pagecltopmapo132AC-MS59.95Spiritus Systems Spud PouchSpiritus Systems111The SPUD pouch is built hold pretty much anything. Spiritus Systems has taken the traditional, open-top, general-purpose pouch and thoroughly re-worked it to give it a big bump in versatility. The rim of the pouch is lined with an adjustable shock cord loop to keep the contents (secure and slip free even if they are significantly smaller than the pouch itself. The top of the pouch features both Velcro and pull tabs so you can choose between the included scrim cover or an adjustable shock cord flap. Both options are included with every SPUD pouch. The scrim cover, when pulled tight will wrap around any irregular shapes and keep the user’s kit fully locked into the pouch while still maintaining full coverage. The whole system takes up two columns of MOLLE and can be mounted pretty much anywhere. It will hold anything from a single 556 magazine, all the way up to two 7.62 magazines (and a wide variety of different items as well). Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-spud-pouch-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-spud-pouch-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-submachine-gun-magazine-insert-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-submachine-gun-magazine-insert-45.jpgcustom-itemoptacticalgear-pagespsymifichri1132SMG24.95Spiritus Systems Submachine Gun Magazine InsertSpiritus Systems111This insert is ONLY compatible with the Micro Fight MK3 Chassis. It is not compatible with the MK2 or MK1 Chassis, nor plate carrier kangaroo pouches. MP7 Magazines fit in the MPX/Scorpion insert. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-submachine-gun-magazine-insert-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-submachine-gun-magazine-insert-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-big-fanny-sack-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-big-fanny-sack-12.jpgcustom-itemoptacticalgear-pagecobamanpumeb132PO-BF74.95Spiritus Systems The BIG Fanny SACK111The BIG Fanny SACK is the new full-size variant in Spiritus Systems' line of waist packs. While similar in purpose to its predecessor (the Fanny SACK Mk3) it has been updated and expanded to accommodate larger frame pistols like Glock 17's, small frame Staccato 2011's, as well as handguns with optics and lights. The BIG Fanny SACK is equally at home worn during full mission profile, or over boardshorts and a hoodie. It was designed to make critical equipment easy to access from both sides or when in a confined space like a vehicle. The BIG Fanny SACK can also be worn on the lower back and out of the way but quickly slid around the waist when needed. The main pouch features a "half zip" design and is more contoured than its smaller counterpart (the Fanny SACK Mk3) with a small front zippered stash pocket. The inside features soft loop fields on both sides. This makes the pouch very dynamic, giving you the ability to use our pouch insert suite to fit your requirements. The backside of the pouch has a third zipper pocket ideal for personal items such as ID, money, and other equipment that you would not want to clutter up the main compartment with a gun concealed. This frees up the main compartment for weapon storage, reducing the risk of accident when drawing under stress. Each side has a flat laminate loop for attaching equipment such as gloves, carabiners or chem lights. The main compartment has two grommet holes on the bottom to aid with drainage of the pouch if submersion occurs. Some images shown with optional accessories, sold separately.1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-big-fanny-sack-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-big-fanny-sack-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-medical-sleigh-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-medical-sleigh-12.jpgcustom-itemoptacticalgear-pageinmedpoipo132PI-FK42.95Spiritus Systems The Medical SleighSpiritus Systems111Medical Items not included]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-medical-sleigh-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-medical-sleigh-17.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-muff-25.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-muff-23.jpgcustom-itemoptacticalgear-pagegloves132BU-MFF119.95Spiritus Systems The MUFFSpiritus Systems1111https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-muff-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-muff-36.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-thing-2-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-thing-2-48.jpgcustom-itemoptacticalgear-pagemaveclqaco132CR-T279.95Spiritus Systems The Thing 2Spiritus Systems111Thing 2 platform only. Harness, straps, and compatible placards sold separately. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-thing-2-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-the-thing-2-60.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-universal-retention-kit-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-universal-retention-kit-49.jpgcustom-itemoptacticalgear-pagespsymifichri1132URK9.95Spiritus Systems Universal Retention KitSpiritus Systems111Designed specifically for the MK4 Chassis, may not work on previous generations. Made in the USA. Sold as a pair. Includes:
2 x Elastic Cord
2 x Cord Locks]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-universal-retention-kit-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-universal-retention-kit-62.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-37.jpgcustom-itemoptacticalgear-pagefigemiSpiritus Systems Wontons1spsywosmspsywomespsywola1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-large-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-large-45.jpgcustom-itemoptacticalgear-pagepacocobawaba132PO-WL37.95Spiritus Systems Wontons - LargeSpiritus Systems111WONTONS were designed to organize your life. They can be used to organize vehicle kit or deployment kit bags. Their uses are almost endless. LARGE - (16" W x 16" L)
Large WONTONS handle lofty or oversized items well. Everything from high loft jackets to vehicle recovery equipment fit well inside these pouches. ]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-large-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-large-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-medium-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-medium-54.jpgcustom-itemoptacticalgear-pagepacocobawaba132PO-WM26.95Spiritus Systems Wontons - MediumSpiritus Systems111WONTONS were designed to organize your life. They can be used to organize vehicle kit or deployment kit bags. Their uses are almost endless. MEDIUM - (12" W x 12" L)
Medium WONTONS work well for securing items like clothing or climbing equipment. Medium WONTONS are the go to for organizing duffle bags and tote boxes with all of your deployable kit.]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-medium-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-medium-67.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-small-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-small-45.jpgcustom-itemoptacticalgear-pagepacocobawaba132PO-WS23.95Spiritus Systems Wontons - SmallSpiritus Systems111WONTONS were designed to organize your life. They can be used to organize vehicle kit or deployment kit bags. Their uses are almost endless. Small - (6" W x 12" L)
Small WONTONS work well for stowing smaller items such as batteries, cables or other small sensitive equipment. They fit well in places like the door pockets of vehicles and in day packs or carry on luggage. ]]>1https://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-small-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/spiritus-systems-wontons-small-58.jpgSpiritus Systemshttps://s.turbifycdn.com/aah/optacticalgear/split-back-1-inch-itw-nexus-buckles-pair-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/split-back-1-inch-itw-nexus-buckles-pair-48.jpgcustom-itemoptacticalgear-pagecaac1132-RB2.49Split-Back 1 Inch ITW NEXUS Buckles - PairITW Nexus111Sold as a set of 2 buckles. Works well for the JPC 2.0 and any other carriers that do not already include buckles to attach Swift Clip compatible Placards and Chest Rigs. Can be used for placards that include loops on the left and right sides to set up a "Micro Rig," such as the Mayflower Modified Gen IV Placard, Spiritus Systems MK4 or MK5, and Spiritus Systems LV Placard - or just a set of field-reparable 1 inch buckles. Note: 4 buckles are required with a compatible placard to use it as a "Micro Chest Rig." Not all Placards are capable of this setup. Sold as a set of 2 buckles. ]]>1https://s.turbifycdn.com/aah/optacticalgear/split-back-1-inch-itw-nexus-buckles-pair-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/split-back-1-inch-itw-nexus-buckles-pair-61.jpgITW Nexushttps://s.turbifycdn.com/aah/optacticalgear/spotting-scopes-monoculars-binoculars-36.jpgcustom-itemoptacticalgear-pageopticsSpotting Scopes, Monoculars, Binoculars1lema412taspstrnoratrnoratwnebipov2ha1https://s.turbifycdn.com/aah/optacticalgear/spotting-scopes-monoculars-binoculars-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/spotting-scopes-monoculars-binoculars-35.jpghttps://s.turbifycdn.com/aah/optacticalgear/steiner-dbal-a3-dual-beam-aiming-laser-r-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/steiner-dbal-a3-dual-beam-aiming-laser-r-49.jpgcustom-itemoptacticalgear-pageweaponlasers144505XXX1864.991649.99Steiner DBAL-A3 Visible and IR Laser (R)Steiner111• Visible green laser
• Weight 8 oz.
• Submersible to 5m
• Fully Adjustable Windage / Elevation
• Dual remote cable ports: remote fire standard port and visible override port (allows vis laser to be fired no matter the setting)
• Low profile windage and elevation adjusters
• Mounting holes for a flip-up front sight, sub-miniature red dot sight or a MIL-SPEC-1913 top rail.
• 6061-T6 Aircraft Aluminum, MIL-SPEC Type III hardcoat anodized case
• Remote Cable Pressure Pad: Yes Specs:
• Visible Green Laser:<5mW
• IR Laser: <0.7mW
• IR Illuminator: <4mW
• Beam Divergence - Visible Green Laser: <0.8 mRad
• Beam Divergence - IR Laser: <0.8 mRad
• Beam Divergence - IR Illuminator: 95-195mRAD (non LED)
• Range/Visibility (Night/Day)* - Visible Green Laser: 750 m / 15 m
• Range/Visibility (Night/Day)* - IR Laser: >250m
• Range/Visibility (Night/Day)* - IR Illuminator: ≤175 m
• Temperature: -0° C to +65° C
• Battery: CR 123A
• Battery Life (mode dependent): > 3 Hours
• Material: Aircraft Aluminum
• Weight (with battery): 8 oz.
• Dimensions: 3.5 (L) x 2.75 (W) x 1.59 (H)
• Waterproof Submersible to >5 m
• Mount: QD HT Mount
• Windage and Elevation Adjustment: Yes
• Activation Switch: Integrated Push Button ITAR Restricted, No International Shipping. Continental USA Shipping Addresses Only.]]>1https://s.turbifycdn.com/aah/optacticalgear/steiner-dbal-a3-dual-beam-aiming-laser-r-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/steiner-dbal-a3-dual-beam-aiming-laser-r-59.jpgSteinerhttps://s.turbifycdn.com/aah/optacticalgear/step-1-44.jpgitem.optacticalgear-pageweaponpaintingDesignate the weapon and any accoutrements to be painted.11Start with the weapon preparation, I used a Springfield Armory M1A Scout. Here is what I started with: my M1A, the scope (didn't paint it, it was replaced with an EO Tech) and an old Harris bipod.1https://s.turbifycdn.com/aah/optacticalgear/step-1-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-1-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-10-44.jpgitem.optacticalgear-pageweaponpaintingThe final setup, blatant gear-porn.111Here is the entire setup: M1A rifle, Sig 229, Blackhawk .308 chest rig (discontinued), 9 M1A mags, 3 Sig 229 mags, Buttstock cleaning kit, sling, and Harris bipod (painted with above method). This process is very easy and anyone can do it, most people are apprehensive because they may want to sell their guns some day or think they may mess them up. The biggest thing to remember is do not overdo it! Light coats of paint are all you need, once that priming coat is on, you just need to go over each area once. Be creative, but also take the time to look at your work. DO NOT OVERDO IT, I cannot emphasize that enough, if you think you messed something up, just go on to the next thing. If the enemy can see your mess ups, they are probably too close. Also, do not backtrack, do not go back and redo a previous step unless you messed up badly, and if you have to do this redo all steps afterwords, the sidespray from the next color makes the paint job what it is. A couple sidenotes: Bowflage: Why don't I use it? walk around some time in the rain for 8 or 9 hours with Bowflage on your weapon, and afterwords observe the black weapon you have. Bowflage removeable paints are not made for military applications, they are designed for civilian hunting. I do strongly recommend Hunter Specialties permanent paints for painting weapons, I am just not a fan of their removeable ones for prolonged combat operations or exercises. Sealants and all that cool stuff the $100 Sniper paint job comes with: I can do about 20 of these paint jobs for that money. Your gun should already be annodized and protected from the elements. If the paint wears off, redo it, it takes a while to wear away, and when it has happened it only costs a few dollars to redo. Different environments: just tailor to the mission. Final words: Have fun with this, I have done quite a few paint jobs, and my technique is always evolving.1https://s.turbifycdn.com/aah/optacticalgear/step-10-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-10-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-2-44.jpgitem.optacticalgear-pageweaponpaintingMake any modifications to the setup before prep begins.11I added an old M14 hinged shoulder rest to the rifle, this facilitates using the slots in the stock for the M14 buttstock cleaning kit, it also reduced my buttstock length and gave me the hinged shoulder rest for prone firing.1https://s.turbifycdn.com/aah/optacticalgear/step-2-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-2-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-3-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-3-53.jpgitem.optacticalgear-pageweaponpaintingDisassemble then tape, mask and block the openings, dials, and serial numbers of the weapon.11Weapon was disassembled, Eotech was mounted, and tape was applied to areas that needed it: sights, moving parts, openings, mounting areas for optics assemblies (where the scope mount is on the side). I set aside the trigger assembly, and painted the rifle as two halves, this served two purposes, it is much easier than trying to tape off the cracks of the rifle without getting outlines, and also I live in a residential apartment complex, and painting outside can be a spectator sport, this lowers the signature when it's only a stock or only an upper receiver. I was sure to mask off the serial numbers and the dials and corresponding hash marks to ensure that these functions would still be useful once painting was complete. To block off the muzzle from paint I rolled up a torn portion of a cereal box and inserted it into the barrel.1https://s.turbifycdn.com/aah/optacticalgear/step-3-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-3-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-4-44.jpgitem.optacticalgear-pageweaponpaintingPriming11Next step, the base coat, I used Krylon Ultra Flat "Sand Dune 8148", and gave the entire rifle a nice light coating of this, twice. Paint is available through AAFES, and any Krylon supplier for civilians . 1https://s.turbifycdn.com/aah/optacticalgear/step-4-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-4-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-5-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-5-53.jpgitem.optacticalgear-pageweaponpaintingCreate "striping" using your darkest color.11The next step is the darkest color. I know, we always learn light to dark no matter what. Here is the method to my madness: The Sand Dune and the Brown are the two LEAST occuring colors in a woodland environment, therefore they constitute the base of the weapon, everything goes on top of them so they do not dominate the color scheme, just watch and you will see what I mean. I used Krylon Ultra Flat "Brown 8142" and made vertical stripes, why vertical? at the level that the average man walks, most brown occurs in a vertical pattern, and when he is in the prone this is especially true. If you get excessive overspray from the brown and you feel it is washing out your tan, then give a quick stripe of tan to cover the affected areas. In camouflage there are two types of patterns: striping and spotting. What I have found is that a combination of the two works best, with the striping underneath the spotting, much like looking at a bush or tree, the leaves dominate the branches underneath.1https://s.turbifycdn.com/aah/optacticalgear/step-5-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-5-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-6-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-6-53.jpgitem.optacticalgear-pageweaponpaintingContrast reduction using intermediate colors.11Now I have my highlight and shadow, the only problem is the contrast created. So I have to tone it down with an intermediate tone, sort of gray it out, otherwise it sticks out like a sore thumb. I applied vertical stripes of Krylon Ultra Flat "Medium Brown 8147" to fill the void. The reason this is done third and not second, as in after the Sand Dune, is as stated before, I want those to be the NON-dominant colors. When using spray paint there is a certain factor of a light side spray we are all aware of, just doing this color in vertical stripes actually gets a nice dispersal on the parts you aren't even aiming for and creates a blending of the colors.1https://s.turbifycdn.com/aah/optacticalgear/step-6-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-6-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-7-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-7-53.jpgitem.optacticalgear-pageweaponpaintingAdd the "spotting" using a man-made pattern or natural vegetation.11Now you have your base, the weapon is primed, and has it's basic colors on it. If I were painting a weapon for a desert environment I would now go in a different direction with it. Since I am painting for a wooded area, I am going to continue with woodland colors. Here is the technique: Take the tree pattern branch that comes with a set of HS Bowflage paints, if you don't have one, you can fabricate one from paper or plastic, use actual vegetation like an evergreen branch or a handful of grass, held at a distance of 1-2 inches. Place the chosen item 1-2 inches from the target area and spray in bursts. I go methodically from back to front and place the branch over the darker areas. Reason: twigs are darker, plus the sidespray from the paint will hit the lighter areas if you do this. Just going from side to side will suffice if you use a good interval. The OD color is Krylon Ultra Flat "Olive Drab 8143."1https://s.turbifycdn.com/aah/optacticalgear/step-7-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-7-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-8-44.jpgitem.optacticalgear-pageweaponpaintingTouching up.11At this point you have to be all about touch-ups and use your better judgement. If you have a big space of the sand color hit it with the branch and some Medium Brown and some OD. I had only 2 or 3 spots that needed it on this project. You are going for a look here that has no linear definition, using the principles of camouflage: shape, shadow, silhouette, surface, spacing, color, movement, siting, mission, dispersion, and terrain patterns. A problem many of us face when painting weapons is we have the paradigm that they have to have these really crisp outlines and look like the sniper rifles we see pictures of. Most of these patterns look cool, but are lacking when it comes to versatility on the battelfield. I want something that blends, not that has crisp outlines only useful in one place. 1https://s.turbifycdn.com/aah/optacticalgear/step-8-42.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-8-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-9-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-9-53.jpgitem.optacticalgear-pageweaponpaintingWait 24 hours, remove tape and reassemble your weapon.111After a 24 hour period I removed the tape, and reassembled the weapon. I added an OD Specter Gear sling and of course put in a 20 round mag to see how the final product looks. At this point dusting off the weapon is a good idea, spray paint tends to leave a dusty coating on everything and removal with a light brush will prevent the dust from getting on everything that gets near the weapon, and even worse, in the moving parts of the weapon.1https://s.turbifycdn.com/aah/optacticalgear/step-9-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/step-9-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/stickers-93.jpgitem.optacticalgear-pagepaemStickers1optbudocostopttowarbustoptjowastoptmasofstoptmainstoptgrlostoptsfsnlostoptsfaslostoptdobustoptorguandcooptbemanvistoptacetocost1optacetocostoptwardrstoptbuwalostoptsignstickeroptgaflstoptyeetstickeroptgujoelostoptgujoelost1rosqtwistnonofasthodebehosthodetophatsthobaowgrst1https://s.turbifycdn.com/aah/optacticalgear/stickers-91.jpghttps://s.turbifycdn.com/aah/optacticalgear/stickers-92.jpghttps://s.turbifycdn.com/aah/optacticalgear/pack-covers-compression-bags-waterproof-bags-scales-45.jpgitem.optacticalgear-pageba1spsywosmspsywomespsywolamadawawipolamadawawipomemadawawiposmmadaliposmmadalipomemadalipolamadawiposmmadawipomemadawipolamadaposmmadapomemadapolamadacan20madacanlahpg812stsaprdrcola13liprdrcoxl20liprdrcoxx35li1https://s.turbifycdn.com/aah/optacticalgear/pack-covers-compression-bags-waterproof-bags-scales-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/pack-covers-compression-bags-waterproof-bags-scales-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-750ml-ez-pump-bottle-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-750ml-ez-pump-bottle-45.jpgcustom-itemoptacticalgear-pagestfoendr136SFE750ML54.99Strike Force Energy 750ml EZ-Pump BottleStrike Force111• 750ml Bottle of Strike Force Energy
• Bottle made of space-age polymers! (Plastic)
• Free Pump Included with Each Bottle
• 1/4oz serving with Each Pump ]]>1https://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-750ml-ez-pump-bottle-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-750ml-ez-pump-bottle-58.jpgStrike Forcehttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drink-10-count-box-83.jpghttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drink-10-count-box-81.jpgcustom-itemoptacticalgear-pagestfoendr136SF10.99Strike Force Energy Drink - 10 Count BoxStrike Force111Nutritional Info: See below and inset picture
Since Strike Force is so awesome, you may be wondering if it is all too good to be true. What could be in it besides Dragon Tears and Unicorn Farts? Well, that's a perfectly good question. And I'll tell you. I'll tell you everything! INGREDIENTS: Purified Water, Malic Acid, Potassium Citrate, Citric Acid, Natural and Artificial Flavors, Sucralose, Taurine, Caffeine, Niacinamide, Pyridoxine HCL, Vitamin B12, Sodium Benzoate (Preserves Freshness) Caffeine Content: 80mg/Serving, 160mg/Flavor Pack]]>1https://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drink-10-count-box-93.jpghttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drink-10-count-box-94.jpgStrike Forcehttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drink-single-packet-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drink-single-packet-73.jpgcustom-itemoptacticalgear-pagestfoendr136SFSINGLE1.25Strike Force Energy Drink - Single PacketStrike Force111Nutritional Info: See below and inset picture
Since Strike Force is so awesome, you may be wondering if it is all too good to be true. What could be in it besides Dragon Tears and Unicorn Farts? Well, that's a perfectly good question. And I'll tell you. I'll tell you everything! INGREDIENTS: Purified Water, Malic Acid, Potassium Citrate, Citric Acid, Natural and Artificial Flavors, Sucralose, Taurine, Caffeine, Niacinamide, Pyridoxine HCL, Vitamin B12, Sodium Benzoate (Preserves Freshness) Caffeine Content: 80mg/Serving, 160mg/Flavor Pack What you get: 1 x Packet of Strike Force Energy Drink.
Also available in 10 and 300 packs (sold separately). ]]>1https://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drink-single-packet-85.jpghttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drink-single-packet-86.jpgStrike Forcehttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drinks-59.jpgcustom-itemoptacticalgear-pagehysyStrike Force Energy Drinks1stfoendrsipastfoendr10costfoen75ezbo1https://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drinks-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/strike-force-energy-drinks-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-big-data-armband-gen-ii-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-big-data-armband-gen-ii-17.jpgcustom-itemoptacticalgear-pagewrdohoXX-DM00483Sun and Shadow Big Data Armband Gen IISun and Shadow111• Three data card windows
• Windows can be used with dry/wet-erase markers or as a tape board
• Windows sized for 3x5” cards
• Low-glare, clear, matte PVC panels for reduced glare and observability
• Quiet-open flap for noise discipline in the field
• Pen/marker holder that won’t get snagged
• Option to add a second pen or chemlight (sold separately)
• Adjustable elastic bands for a secure and comfortable hold
• Neoprene backing for comfort
• Weighs 3.5 oz
• Made in the USA This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-big-data-armband-gen-ii-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-big-data-armband-gen-ii-30.jpgSun and Shadowhttps://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-carbine-cheek-riser-34.jpghttps://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-carbine-cheek-riser-32.jpgcustom-itemoptacticalgear-pagem4arbuttstocksXX-CARCHERIS51Sun and Shadow Carbine Cheek RiserSun and Shadow111• Industrial hook and loop provides increased retention over our original risers
• Stock Skin options are now available in select colors or camo patterns
• Decreased overall length and weight for improved placement
• Addition of NODs-height 0.75" and 1.00" options for passive aiming
• Improved manufacturing quality with 3D printing processes The Carbine Cheek Riser features:
• 0.25”, 0.50”, 0.75, or 1.00" height increase for a solid cheek weld
• Shadow Black color with option to add Stock Skin fabric (adds color and traction to the riser)
• Fits a wide variety of stocks, including B5 SOPMOD, Magpul SL, BCM, Reptilia, and many more!
• Adjustable placement on your carbine's stock along the buffer tube axis
• High strength industrial hook and loop attachment for rapid removal or movement to a different stock
• 3D printed Nylon polymer design
• On-board, patent-pending, weather-resistant storage in NODs-height versions
• 0.75" height will fit one AAA battery
• 1.00" height will fit two CR123 batteries
• Weighs between 0.6 and 2 oz, depending on model
• Dimensions: 3.9" L x 1.8" W
• All Carbine Cheek Risers ship with a black Velcro mounting loop for the stock
• Made in the USA NOTE: Due to the nature of the AR-15 and AR-10 designs, the Carbine Cheek Riser may interfere with the charging handle unless the stock is extended out to positions 3, 4, or 5 of the adjustable range. We recommend checking charging handle interference before positioning the riser. Fits the Following AR15 Stocks:
B5 Bravo, B5 CAR, B5 SOPMOD, BCM Gunfighter, BCM Gunfighter SOPMOD, HK E1/E2 (MR556, 416, M27, etc), LMT SOPMOD, LWRCI Compact, M4 Waffle Stock, Magpul ACS, Magpul ACS-L, Magpul CTR, Magpul STR, Magpul SL, Magpul SL-K, Magpul SL-M, Magpul SL-S, Magpul UBR (Gen I and II), Reptilia RECC-E, VLTOR IMOD, VLTOR EMOD, And many more! Will not fit the SBA3 brace or Daniel Defense stock. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-carbine-cheek-riser-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-carbine-cheek-riser-45.jpgSun and Shadowhttps://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-tripod-table-gen-ii-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-tripod-table-gen-ii-26.jpgcustom-itemoptacticalgear-pagerangegearXX-PD00669Sun and Shadow Tripod Table Gen IISun and Shadow111• Platform measures 8.5" x 5.5" and is sized for medium shooting bags (works great with your shmedium or pint-sized game changer)
• Lightweight, thermoformed Kydex design
• Grip pads on work surface to prevent your bag from sliding
• 1"-wide slots on left and right for straps or mounting lightweight accessories
• 18-8 Stainless Steel 1/4"-20 threaded insert with Black Nitride finish for connection to your favorite mounting accessory or tripod head
• Anti-rotation slots on the mounting surface to prevent the table from spinning loose when mounted.
• Weighs 7 oz
• Made in the USA This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-tripod-table-gen-ii-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/sun-and-shadow-tripod-table-gen-ii-39.jpgSun and Shadowhttps://s.turbifycdn.com/aah/optacticalgear/superfeet-blue-insole-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/superfeet-blue-insole-47.jpgcustom-itemoptacticalgear-pagesoandin1442454.99Superfeet Blue InsoleSuperfeet111FEATURES
A. HEEL CUP: Cradles the heel to opitimize natural shock absorption B. MEDIUM ARCH SUPERFEET SHAPE: Medium arch orthotic support helps stabilize the foot, reducing stress on feet, ankles, knees and back C. DURABLE CONSTRUCTION: Superfeet insoles keep their shape, delivering reliable support and comfort for up to 12 months or 500 miles, whichever comes first D. ORGANIC ODOR-CONTROL COATING: All natural coating helps eliminate odor-causing bacteria E. REINFORCED STABILIZER CAP: Thinner shape acts as the base of the insole to support the rearfoot and provide structure and stability, reinforced with side rails for added strength F. HIGH-DENSITY FOAM: Closed-cell foam provides a firm foundation to support the foot for long-lasting comfort This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/superfeet-blue-insole-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/superfeet-blue-insole-62.jpgSuperfeethttps://s.turbifycdn.com/aah/optacticalgear/superfeet-green-insole-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/superfeet-green-insole-47.jpgcustom-itemoptacticalgear-pagesoandin14414__54.99Superfeet Green InsoleSuperfeet111FEATURES
A. DEEP HEEL CUP: Wide and deep heel cup works with your body's natural cushioning for maximum support B. HIGH ARCH SUPERFEET SHAPE: High arch orthotic support helps stabilize the foot, reducing stress on feet, ankles, knees and back C. DURABLE CONSTRUCTION: Superfeet insoles keep their shape, delivering reliable support and comfort for up to 12 months or 500 miles, whichever comes first D. ORGANIC ODOR-CONTROL COATING: All natural coating helps eliminate odor-causing bacteria E. STABILIZER CAP: Acts as the base of the insole that supports the rearfoot and provides structure and stability to the foam layer F. HIGH-DENSITY FOAM: Closed-cell foam provides a firm foundation to support the foot for long-lasting comfort This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/superfeet-green-insole-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/superfeet-green-insole-62.jpgSuperfeethttps://s.turbifycdn.com/aah/optacticalgear/superfeet-widegreen-insole-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/superfeet-widegreen-insole-47.jpgcustom-itemoptacticalgear-pagesoandin144150__54.99Superfeet WideGreen InsoleSuperfeet111FEATURES
A. EXTRA WIDE HEEL CUP FOR WIDE-WIDTH FOOTWEAR: Extra wide heel cup works with your body's natural cushioning for maximum support B. HIGH ARCH SUPERFEET SHAPE: High arch orthotic support helps stabilize the foot, reducing stress on feet, ankles, knees and back C. DURABLE CONSTRUCTION: Superfeet insoles keep their shape, delivering reliable support and comfort for up to 12 months or 500 miles, whichever comes first D. ORGANIC ODOR-CONTROL COATING: All natural coating helps eliminate odor-causing bacteria E. STABILIZER CAP: Acts as the base of the insole that supports the rearfoot and provides structure and stability to the foam layer F. HIGH-DENSITY FOAM: Closed-cell foam provides a firm foundation to support the foot for long-lasting comfort G. MADE FOR WIDE FEET: Specially designed to fit well in wide-width footwear, sizes 3E to 6E This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/superfeet-widegreen-insole-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/superfeet-widegreen-insole-62.jpgSuperfeethttps://s.turbifycdn.com/aah/optacticalgear/surefire-socom-4-prong-flash-hider-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-socom-4-prong-flash-hider-r-44.jpgcustom-itemoptacticalgear-pagem4arupreandp103FH556RC-12-28199179Surefire SOCOM 4-Prong Flash Hider (R)Surefire111LIMIT 2 PER CUSTOMER. If you order more than 2, your order may be canceled without notice. The FH556RC-1/2-28 flash hider for 5.56 mm weapon platforms is the exact flash hider that SureFire developed to dominate the most rigorous suppressor trial in military history and earn the USSOCOM suppressor contract. Its four-tine design significantly reduces muzzle flash — typically greater than 99% compared to a bare muzzle — delivering extreme signature reduction and rugged dependability. With multiple bearing surfaces that ensure proper suppressor alignment, the FH556RC-1/2-28 serves as a rock-solid mounting platform for any SureFire SOCOM Fast-Attach® suppressor. Precision-machined from U.S. mill-certified stainless-steel bar stock, and heat-treated for added strength, it is highly resistant to gas and particle erosion, so you can depend on it to provide years of faithful service. SureFire flash hiders are individually inspected to ensure concentricity and alignment and covered by SureFire’s No-Hassle Guarantee. Features:
• Patent-pending design provides approximately 99% reduction in flash, when compared to a plain muzzle
• Multiple bearing surfaces provide superior suppressor alignment and prevent ringing of tines inside suppressor
• Precision machined from US mill-certified heat-treated stainless steel bar stock
• High-precision single-point cut barrel threads create optimum thread interface
• Inspected for all critical dimensions including concentricity and alignment
• Black Ionbond DLC coating provides maximum protection against harsh environmental conditions and facilitates cleaning after extreme use
• Serves as rock-solid mounting adapter for SureFire SOCOM Series sound suppressors
• Labyrinth seals mitigate gas leak from suppressor lock ring
• Installation requires no permanent modifications for M4 / M16 / AR15 type weapons Specs:
• Caliber 5.56 mm (.223 caliber)
• Coating: DLC Coating
• Length: 2.6 in
• Weight: 3.9 oz LIMIT 2 PER CUSTOMER. If you order more than 2, your order may be canceled without notice. This Item is Excluded from ALL Sale Coupon Codes Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-socom-4-prong-flash-hider-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-socom-4-prong-flash-hider-r-58.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-x300u-a-ultra-led-weaponlight-with-rail-lock-mounting-system-r-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-x300u-a-ultra-led-weaponlight-with-rail-lock-mounting-system-r-55.jpgcustom-itemoptacticalgear-pageweaponlights1103X300UA379341Surefire X300U-A Ultra 1000 Lumens LED with Rail-Lock Mount (R)Surefire111now featuring the same wider and shorter switches as the X300U-B model for improved ergonomics and comfort — at the rear of the body, providing one-finger control — press the switch on either side for momentary-on activation, flip up or down for constant-on activation. Optional DG grip switches (for pistols) and a pressure activated XT07 tape switch (for long guns) permit the X300 Ultra to be activated without altering your grip on your weapon. The X300 Ultra can be attached to a pistol or a long gun since its Rail-Lock® system permits rapid attachment to and removal from either Universal or Picatinny rails. Its high-strength aerospace aluminum body is Mil-Spec hard anodized for superior toughness and is O-ring and gasket sealed to make it weatherproof. FITS: Handguns and long guns with Picatinny or Universal rails. Adapter mounts available for several non-railed handguns. Features:
• Virtually indestructible LED regulated to maximize output and runtime
• Tactical-level output with TIR lens for close- to longer-range applications
• Quick-detach rail clamp
• Accepts optional pistol grip and long gun forend switches
• Weatherproof—O-ring and gasket sealed
• Construction—High-strength aerospace aluminum with Mil-Spec anodizing; impact-resistant polymer; coated tempered window
• Includes high-energy 123A batteries with 10-year shelf life Specs:
• Max Output - White Light: 1000 lumens
• Tactical Runtime**: 1.25 hours
• Length: 3.60 inches
• Bezel Diameter: 1.125 inches
• Weight w/Batteries: 4.0 oz Batteries: 2 123A (included) THIS ITEM CAN ONLY SHIP TO CONTINENTAL USA ADDRESSES (NO APO). It cannot ship international.]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-x300u-a-ultra-led-weaponlight-with-rail-lock-mounting-system-r-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-x300u-a-ultra-led-weaponlight-with-rail-lock-mounting-system-r-64.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-lfp-123a-rechargeable-batteries-pack-of-2-35.jpgcustom-itemoptacticalgear-pagebach103SF2-CB76Surefire 123A Lithium Batteries - Pack of 2Surefire111• High-performance batteries, optimized for high-drain use in flashlights
• 10-year shelf life
• Wide temperature tolerance
• Built-in heat and fault (short-circuit) protection
• Made in the USA to SureFire specifications Pack of 2 Batteries. THIS ITEM CAN SHIP TO APO ADDRESSES. It cannot ship international. This Item is Excluded from Limited Sale Coupon Codes ]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-lfp-123a-rechargeable-batteries-pack-of-2-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-lfp-123a-rechargeable-batteries-pack-of-2-42.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-closed-tine-flash-hider-for-5-56mm-rifles-r-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-closed-tine-flash-hider-for-5-56mm-rifles-r-12.jpgcustom-itemoptacticalgear-pagem4arupreandp103SFSFCT169152Surefire Closed Tine Flash Hider for 5.56mm Rifles (R)111• A high-performance closed-tine flash hider that is easy to install
• Highly resistant to gas and particle erosion
• Multiple bearing surfaces for accurate suppressor alignment Embrace Tradition. SureFire adapters serve as rock-solid, precision mounting platforms for SureFire SOCOM Fast-Attach Suppressors, as well as, serving as a standalone muzzle device. The SFCT-556-1/2-28 closed-tine adapter closely represents a traditional birdcage flash hider, with wrench flats for easy installation. Just like other SureFire SOCOM muzzle devices, this adapter is precision machined from heat-treated stainless steel which is highly resistant to gas and particle erosion. Additionally, these adapters utilize multiple bearing surfaces to ensure proper suppressor alignment every time.]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-closed-tine-flash-hider-for-5-56mm-rifles-r-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-closed-tine-flash-hider-for-5-56mm-rifles-r-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-dg-grip-switch-assembly-for-x-series-weaponlights-r-47.jpgcustom-itemoptacticalgear-pagewelilasw103DG-XX145131Surefire DG Grip Switch Assembly for X-Series WeaponLights (R)Surefire111• DG-11 — Glock 17,17L,18,19,20,21,22,23,24,31,32,34,35 (rail versions)
• DG-12 — Smith & Wesson M&P
• DG-17 — Standard 1911 (using MR07)
• DG-18 — Standard 1911 (with rails) Features:
• Ergonomic Design
• Ambidextrous dual momentary and constant-on push/toggle switch
• Remote switch uses a minimal center-mounted pad ]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-dg-grip-switch-assembly-for-x-series-weaponlights-r-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-dg-grip-switch-assembly-for-x-series-weaponlights-r-57.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-ds00-waterproof-switch-assembly-for-scoutlight-weaponlights-30.jpgcustom-itemoptacticalgear-pagewelilasw103DS00145131Surefire DS00 Waterproof Switch Assembly for Scoutlight WeaponLightsSurefire111• Click on/off pushbutton switch
• System disable feature
• Two piece, o-ring sealed housing swivels to facilitate precise positioning of the integrated click on/off switch in the DS switch housing. Color: Black]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-ds00-waterproof-switch-assembly-for-scoutlight-weaponlights-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-ds00-waterproof-switch-assembly-for-scoutlight-weaponlights-40.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-dual-fuel-scout-light-pro-1500-lumens-r-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-dual-fuel-scout-light-pro-1500-lumens-r-45.jpgcustom-itemoptacticalgear-pageweaponlights1103M640DFPRO369332Surefire Dual Fuel Scout Light Pro - 1500 Lumens (R)Surefire111scliprodeviThis Flashlight comes with both MLOK and Pic rail adapters, and allen wrench. Mount allows the light to be rotated into the optimal position next to your rail or laser. An out of the box versatile solution to your low profile lighting needs. The new Surefire Scout Light® Pro Dual Fuel is the ultimate single output WeaponLight, uniting the combat-proven elements of the M600DF Scout Light® with SureFire’s new Low-Profile Mount (LPM). The LPM delivers unprecedented versatility by allowing the user to optimize the light’s position relative to the rail. Rugged and reliable, the LPM can be easily and securely attached to any MIL-STD-1913 (Picatinny) or M-LOK rail, and every Scout Light Pro model includes mounting cleats for both rail styles. The Scout Light Pro Dual Fuel features a recoil proof, ultra-high-output LED that delivers 1,200 lumens of blinding white light with 123A batteries and 1,500 lumens of light with the SF18650B* rechargeable lithium-ion battery. A proprietary Total Internal Reflection (TIR) lens shapes the recoil-proof LED’s light into a beam with plenty of reach but enough surround light to accommodate peripheral vision, making the Scout Light Pro Dual Fuel ideal for close to longer-range applications. A slight press of the Z68 tailcap switch will activate the momentary-on, while fully depressing the tailcap until it clicks will activate constant-on. Constructed of lightweight aerospace aluminum with a Mil-Spec Hard-Anodized finish, and O-ring sealed to keep out the elements, the rugged and lightweight Scout Light Pro Dual Fuel will endure combat-like conditions without any sacrifice in weapon maneuverability. SF18650B battery required for 1,500 lumen output, 1.5 hours runtime, and 250 meter beam distance Features
• New SureFire Low-Profile Mount (LPM) greatly enhances versatility, allowing the user to mount the Mini Scout Light Pro in the optimal position on any MIL-STD-1913 (Picatinny) or M-LOK rail
• MIL-STD-1913 (Picatinny) and M-LOK rail mounting cleats are included with every Scout Light Pro model
• Dual Fuel, virtually indestructible ultra-high-output LED generates 1,200 lumens of blinding light with 123A batteries or 1,500 lumens with included SF18650B rechargeable lithium-ion battery & charger kit
• TIR lens shapes versatile beam with enough reach and surround light for close- to longer-range operations
• Reliable activation via Z68 momentary/constant-on pushbutton switching with protective shroud
• Mil-Spec Hard-Anodized aluminum body, tempered window and O-ring seals make the Scout Light Pro IR rugged, durable, and combat ready Specs:
• Bezel Diameter: 1.125 inches
• Length: 5.56 inches
• Weight w/Batteries: 5.5 ounces
• Batteries: SF18650B or CR123
• Finish: Mil-Spec Hard Anodized
• Construction: Aluminum
• 18650 Output: 1,500 Lumens
• 123A Output: 1,200 Lumens*
• 18650 Runtime: 1.5 Hours
• 123A Runtime: 1.25 Hours Made in the USA. THIS ITEM CAN ONLY SHIP TO CONTINENTAL USA ADDRESSES (NO APO). It cannot ship international.]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-dual-fuel-scout-light-pro-1500-lumens-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-dual-fuel-scout-light-pro-1500-lumens-r-58.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-edcl2-t-everyday-carry-flashlight-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-edcl2-t-everyday-carry-flashlight-31.jpgcustom-itemoptacticalgear-pageflashlights103EDCL2-T259233Surefire EDCL2-T Everyday Carry Flashlight -1200 LumensSurefire111• Highly versatile light serves as an everyday carry light or an improvised weapon light
• Virtually indestructible LED emitter regulated to maximize output and runtime
• Fully press tailcap switch for high output, and slightly press tailcap switch for low. Twist for constant on.
• High-strength aerospace aluminum body, Mil-Spec hard anodized for extreme durability
• Body and tailcap are knurled for a secure grip
• Two-way clip permits light to be carried bezel up or down
• Backed by SureFire’s No-Hassle Guarantee Specifications:
• Output / Runtime -- White Light
• High: 1,200 Lumens / 1.0 hours*
• Low: 5 Lumens / 60 hours*
• Length: 5.84 inches
• Bezel Diameter: 1.125 inches
• Weight w/Batteries: 4.1 ounces
• Batteries: 2 x CR123A (Included) ]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-edcl2-t-everyday-carry-flashlight-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-edcl2-t-everyday-carry-flashlight-41.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-ep4-sonic-defenders-plus-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-ep4-sonic-defenders-plus-48.jpgcustom-itemoptacticalgear-pagehepr103EP417.4916SureFire EP4 Sonic Defenders PlusSurefire111Features
- 24dB Noise Reduction Rating (NRR) with filter caps inserted
- Lowers potentially dangerous noise levels above 85dB
- Hear safe sound levels (with filter caps out) as if you weren't wearing ear plugs
- Patented EarLock® retention rings utilize seven contact points to lock earpieces in place and fit the same way every time; soft, triple-flanged stems provide secure seals and all-day comfort
- Made from hypoallergenic, medical-grade polymer that's soft, durable, and long-lasting
- Low-profile design allows you to keep them in place while wearing a mask, helmet, hat, or while using phone, headphones, or supplemental hearing muffs
- Serve as earpieces for compatible* radio communication systems
- Available in clear, black, or orange
- 26" polymer lanyard included Made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-ep4-sonic-defenders-plus-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-ep4-sonic-defenders-plus-61.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-ep7-sonic-defenders-ultra-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-ep7-sonic-defenders-ultra-45.jpgcustom-itemoptacticalgear-pagehepr103EP723.9922SureFire EP7 Sonic Defenders UltraSurefire111Features
- 28dB Noise Reduction Rating (NRR) with filter caps inserted
- Lowers potentially dangerous noise levels above 85dB
- Hear safe sound levels (with filter caps out) as if you weren't wearing ear plugs
- Patented EarLock® retention rings utilize seven contact points to lock earpieces in place and fit the same way every time
- Soft memory-foam Canal™ Comply Tips provide secure seals in ear canals and all-day comfort
- Made from hypoallergenic, medical-grade polymer that's soft, comfortable, and durable
- Low-profile design allows you to keep them in place while wearing a mask, helmet, hat, or while using phone, headphones, or supplemental hearing muffs
- Serve as earpieces for compatible* radio communication systems
- Available in clear, black, or orange
- 26" polymer lanyard included
- Additional pair of Comply™ Canal tips included Made in the USA Sizing chart for this item is the same as the EP4 ]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-ep7-sonic-defenders-ultra-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-ep7-sonic-defenders-ultra-58.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-fury-dft-dual-fuel-tactical-flashlight-1500-and-1200-lumens-r-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-fury-dft-dual-fuel-tactical-flashlight-1200-and-1500-lumens-r-24.jpgcustom-itemoptacticalgear-pageflashlights103FURY-DFT259233Surefire Fury DFT Dual Fuel Tactical Flashlight - 1500 and 1200 LumensSurefire111• Virtually indestructible LED emitter regulated to maximize light output and runtime
• Single high output level, strong enough to also serve as a searchlight
• Dual fuel light powered by either two 123A lithium batteries or a single 18650 lithium-ion rechargeable battery*
• Press tailcap slightly for momentary-on, or fully press or click for constant-on
• The high-strength aerospace-aluminum body and tailcap are knurled for a secure grip and it is Mil-spec hard-anodized to resist abrasion and corrosion Specifications:
• Output / Runtime -- White Light
• CR123A Batteries: 1200 Lumens / 1.25 Hours
• 18650 Li-Ion Battery: 1500 Lumens / 1.5 Hours
• Length: 5.6 in
• Bezel Diameter: 1.39 in
•Batteries: 2 x CR123A (included) or 1 x 18650 Li-Ion Battery with 5A discharge rate or higher (sold separately) NOTE: This flashlight will only function with 18650 Batteries that have a minimum 5A discharge rate. It is highly recommended to use Surefire SF18650A Batteries with this flashlight.]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-fury-dft-dual-fuel-tactical-flashlight-1200-and-1500-lumens-r-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-fury-dft-dual-fuel-tactical-flashlight-1200-and-1500-lumens-r-31.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-g2x-pro-flashlight-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-g2x-pro-flashlight-56.jpgcustom-itemoptacticalgear-pageflashlights103G2X-D-XX9989Surefire G2X Pro Flashlight - 600 LumensSurefire111• Virtually indestructible LED emitter regulated to maximize output and runtime
• Brilliant tactical-level max output and, useful extended runtime low output
• Precision reflector creates smooth, optimized beam with plenty of reach and surround light
• Tough, lightweight Nitrolon® polymer body for corrosion resistance and durability
• Dual-output tailcap click switch—press for momentary-on low, click for constant-on low, return to off then press or click again for high
• Weatherproof—O-ring and gasket sealed
• Includes high-energy 123A batteries with 10-year shelf life Specifications:
Output / Runtime -- White Light
• High 600.0 lumens / 1.5 hours*
• Low 15.0 lumens / 52.0 hours
• Tactical Runtime* 2.5 hours
• Length 5.20 inches
• Bezel Diameter 1.25 inches
• Weight w/Batteries 4.4 ounces
• Batteries 2 x 123A (included)]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-g2x-pro-flashlight-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-g2x-pro-flashlight-66.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-km1-e-infrared-white-light-head-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-km1-e-infrared-white-light-head-17.jpgcustom-itemoptacticalgear-pageheliandac103SFKM1-E-BK265239Surefire111litossprmmoThis light head is compatible with the S&S Precision M-Ax Mount Features
• Virtually indestructible infrared & white LEDs are regulated to maximize light output and runtime
• On-the-fly switching between IR mode and white-light; no IR filter required
• TIR lens shapes versatile beam with enough reach and surround light for medium- to longer-range operations
• Rugged, durable and combat ready Hard Anodized aluminum body and tempered window Key Attributes
HIGH OUTPUT: 250 lumens
HIGH RUNTIME: 1.5 hours
IR OUTPUT: 100 milliWatts
IR RUNTIME: 6 hours
PEAK BEAM INTENSITY: 9,300 candela
BATTERIES: One 123A (not incl.)
SWITCHING: N/A
LENGTH: 1.78 in (4.5 cm) Output
HIGH OUTPUT: 250 lumens
HIGH RUNTIME: 2.5 hours
IR OUTPUT: 100 milliWatts
IR RUNTIME: 6 hours
DISTANCE: 190 meters Body
CONSTRUCTION: Aluminum
FINISH: Mil-Spec Hard Anodized
WEIGHT W/ BATTERIES: 1.28 oz (36.3 g)
BEZEL DIAMETER: 1.06 in (2.7 cm) This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-km1-e-infrared-white-light-head-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-km1-e-infrared-white-light-head-30.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-m140a-micro-scout-pro-r-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-m140a-micro-scout-pro-r-43.jpgcustom-itemoptacticalgear-pageweaponlights1103M140APRO349314SureFire M140A Micro Scout Pro (R)Surefire111THIS ITEM CAN ONLY SHIP TO CONTINENTAL USA ADDRESSES (NO APO). It cannot ship international. Micro-Sized, AAA-Powered LED Scout Light® Pro The Micro Scout Light Pro is the most compact WeaponLight to bear the Scout Light name, designed and precisely engineered from the ground up to deliver close-quarters illumination with minimal impact on your weapon's profile. Its minimal size, weight make it an ideal choice for positive target ID, low-light navigation, or Sensitive Site Exploitation. You won't even know it's there unless you need it. And SureFire's Low-Profile Mount (LPM) allows you the flexibility to adjust the Micro Scout Light Pro so it is close to the weapon, no matter the rail or configuration. The LPM ships with both a MIL-STD-1913 mount as well as an M-LOK® mount for hassle-free mounting options. Focused through SureFire's smooth parabolic reflector, the Micro Scout Light Pro's recoil-proof, premium LED generates a 300-lumen beam with 1.25 hours of runtime from a single rechargeable AAA battery. A shrouded, push-button tailcap provides easy, instant momentary-on activation, or you can click through for constant-on activation. Constructed of rugged aerospace aluminum and MIL-A-8625 Type III, Class 2 hard-anodized for scratch and corrosion resistance, Scout Light Pros are also O-ring sealed to keep out the elements, ensuring that they can endure the harshest conditions. The Micro Scout Light Pro will help you prevail in the most extreme conditions. Features
- 300 Lumens
- 1,045 candela
- 1.25 hours of runtime
- Reliable activation via momentary/constant-on push-button switching with protective shroud
- Included AAA rechargeable NiMH barrery provides over an hour of runtime percharge (Battery charger sold separately) Made in the USA. THIS ITEM CAN ONLY SHIP TO CONTINENTAL USA ADDRESSES (NO APO). It cannot ship international.]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-m140a-micro-scout-pro-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-m140a-micro-scout-pro-r-56.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-remote-dual-switch-for-weaponlight-atpial-laser-device-sr-d-it-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-remote-dual-switch-for-weaponlight-atpial-laser-device-sr-d-it-61.jpgcustom-itemoptacticalgear-pagewelilasw103SR07-D-IT139125Surefire Remote Dual Switch for Weaponlight + ATPIAL Laser Device - SR-D-ITSurefire111• Momentary-on switch activates SureFire WeaponLight, Insight® ATPIAL, or both
• Weatherproof plugs and pressure pad switches
• Snap-on clamp for Picatinny rails
• 7-Inch switch cable ]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-remote-dual-switch-for-weaponlight-atpial-laser-device-sr-d-it-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-remote-dual-switch-for-weaponlight-atpial-laser-device-sr-d-it-75.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-remote-dual-switch-for-weaponlights-7-inch-cable-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-remote-dual-switch-for-weaponlights-7-inch-cable-60.jpgcustom-itemoptacticalgear-pagewelilasw103SR07119107Surefire Remote Dual Switch for WeaponLights - 7 Inch CableSurefire111• Provides remote momentary-on and constant-on WeaponLight activation
• Switch platform clips to Picatinny rail without tools
• Weatherproof switches and plug ]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-remote-dual-switch-for-weaponlights-7-inch-cable-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-remote-dual-switch-for-weaponlights-7-inch-cable-74.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-scout-light-pro-1000-lumens-r-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-scout-light-pro-1000-lumens-r-45.jpgcustom-itemoptacticalgear-pageweaponlights1103M640UPRO369332SureFire Scout Light Pro - 1000 Lumens (R)Surefire111scliproyoviThis Flashlight comes with both MLOK and Pic rail adapters, and allen wrench. Mount allows the light to be rotated into the optimal position next to your rail or laser. An out of the box versatile solution to your low profile lighting needs. The SureFire Scout Light® Pro WeaponLight raises the bar by which all other weapon lights are measured. Featuring SureFire’s new Low- Profile Mount (LPM), the Scout Light Pro delivers unprecedented versatility by allowing the user to optimize the light’s position relative to the handguard and the laser aiming device (if installed). Rugged and reliable, the LPM can be easily and securely attached to any MIL-STD-1913 (Picatinny) or M-LOK rail, and every Scout Light Pro model includes mounting cleats for both rail styles. The Scout Light Pro is a tactical powerhouse, featuring a recoil-proof, premium LED that generates 1000 blinding lumens from two 123A batteries. Focused through SureFire’s proprietary TIR lens, it produces a far-reaching, high-intensity beam with ample surround light. Rugged and reliable, its shrouded Z68 push-button tailcap provides, easy, instant activation with a single click. Constructed of lightweight aerospace aluminum with a Mil-Spec Hard-Anodized finish, and O-ring sealed to keep out the elements, the tough. Scout Light Pro will help you adapt and overcome in combat conditions without any sacrifice in weapon maneuverability. Specs Bezel Diameter 1.125 inches Length 5.5 inches Weight w/Batteries 4.8 ounces Batteries 123A (2, included with purchase) Output White 1,000 Lumens Runtime White 1.25 Hours* Features New SureFire Low-Profile Mount (LPM) greatly enhances versatility, allowing the user to mount the Mini Scout Light Pro in the optimal position on any MIL-STD-1913 (Picatinny) or M-LOK rail MIL-STD-1913 (Picatinny) and M-LOK rail mounting cleats are included with every Scout Light Pro model Virtually indestructible ultra-high-output LED generates 1000 lumens of blinding light; produces tactical-level light for 1.25 hours on two 123A batteries TIR lens shapes versatile beam with enough reach and surround light for medium- to longer-range operations Mil-Spec Hard-Anodized aerospace aluminum body, tempered window and O-ring seals make the Scout Light Pro rugged, durable, and combat ready Reliable activation via Z68 momentary/constant-on push-button switching with protective shroud Made in the USA. THIS ITEM CAN ONLY SHIP TO CONTINENTAL USA ADDRESSES (NO APO). It cannot ship international.]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-scout-light-pro-1000-lumens-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-scout-light-pro-1000-lumens-r-58.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-scout-light-rear-cap-32.jpgcustom-itemoptacticalgear-pagewelilasw103UE-XX7971Surefire Scout Light Rear CapSurefire111• Aerospace grade aluminum construction, MilSpec Type III hard-anodized in Black or Desert Tan
• For use with a SureFire tape switch
• Lock-out feature prevents accidental activation during transport or storage Tape Switches sold separately. ]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-scout-light-rear-cap-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-scout-light-rear-cap-41.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-scout-light-rear-cap-and-remote-dual-switch-combo-r-30.jpgcustom-itemoptacticalgear-pagewelilasw103UE-SR07-BK159143Surefire Scout Light Rear Cap and Remote Dual Switch ComboSurefire111Get the Rear Cap and Remote Dual Switch together for your weapon light and save! Rear Cap:
Replace your Scout Light's rear push-button cap assembly with this cap in order to attach a SureFire tape switch. Lock-out feature positively prevents activation during tactical operations, transportation, or storage. Made from aerospace aluminum, MilSpec Type III hard-anodized.
Fits: Scout Light WeaponLights; Flashlights with .75" diameter switch, including , E1E-HA, E1B, E1L-HA-WH, E2D-BK, E2DL-BK, E2L-HA-WH, L4-HA-WH Remote Dual Switch:
The SR Remote Dual Switch provides remote activation for any SureFire WeaponLight with a switch socket. Two switches—a momentary-on pressure pad switch and a constant-on pushbutton switch—are integrated with a snap-on clamp for easy attachment to your firearm's Picatinny rail forend. The seven-inch cable length works with most rifle/carbine applications.
Fits: Millennium Universal, Classic Universal, Scout Light with socketed tailcap, and X200, X300, and X400 with XT tailcap Features:
• Provides remote momentary-on and constant-on WeaponLight activation
• Switch platform clips to Picatinny rail without tools
• Weatherproof switches and plug Color: Black]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-scout-light-rear-cap-and-remote-dual-switch-combo-r-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-scout-light-rear-cap-and-remote-dual-switch-combo-r-37.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-sf3p-556-1-2-28-21.jpgcustom-itemoptacticalgear-pagem4arupreandp103SF3P-556-1/2-28169152Surefire SF3P-556-1/2-28 Flash Hider / Suppressor Adapter (R)Surefire111NOTE: SureFire SOCOM Series Fast-Attach sound suppressors, flash hider/suppressor adapters, and muzzle brake/suppressor adapters are not compatible with previous SureFire Fast-Attach sound suppressors, muzzle brakes, or flash hiders. Features:
• Patent-pending design provides greater than a 99% reduction in flash, when compared to a plain muzzle
• Multiple bearing surfaces provide superior suppressor alignment and prevent ringing of tines inside suppressor
• Precision machined from US mill-certified heat-treated stainless steel bar stock
• High-precision single-point cut barrel threads create optimum thread interface
• Inspected for all critical dimensions including concentricity and alignment
• Black Ionbond DLC coating provides maximum protection against harsh environmental conditions and facilitates cleaning after extreme use
• Serves as rock-solid mounting adapter for SureFire SOCOM Series sound suppressors
• Labyrinth seals mitigate gas leak from suppressor lock ring
• Installation requires no permanent modifications for M4 / M16 / AR15 type weapons Specifications:
• Caliber 5.56 mm (.223 caliber)
• Length 2.67 inches This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-sf3p-556-1-2-28-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-sf3p-556-1-2-28-28.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-socom-muzzle-brake-r-29.jpgcustom-itemoptacticalgear-pagem4arupreandp103SFMB-556-1/2-28169152Surefire SOCOM Muzzle Brake / Suppressor Adapter - 5.56 and 7.62 Models (R)Surefire111• M4 / 5.56 NATO caliber rifles with ½-28 muzzle threads
• 7.62 NATO (.308 caliber) rifles with 5/8-24 muzzle threads Features:
• Offset porting delivers greatly reduced recoil impulse and muzzle rise, so the weapon tracks straight back to keep you on target for faster shot-to-shot recovery
• Multiple bearing surfaces for superior suppressor alignment
• Precision machined from U.S. mill-certified heat-treated stainless steel bar stock
• High-precision single-point cut barrel threads for optimum thread interface
• Inspected for all critical dimensions including concentricity and alignment
• Pilot holes for tuning of muzzle brake and to pin-and-weld to rifle barrel as needed
• DLC coating provides maximum protection against harsh environmental conditions and facilitates cleaning after extreme use
• Serves as rock-solid mounting adapter for SureFire SOCOM Series sound suppressors
• Labyrinth seals prevent carbon buildup on suppressor lock ring indexing system
• Mounts all SureFire SOCOM Series sound suppressors Note: SureFire SOCOM Series Fast-Attach sound suppressors and current-model muzzle brake/suppressor adapters and flash hider/suppressor adapters are not compatible with previous SureFire Fast-Attach sound suppressors, muzzle brakes, or flash hiders. SPECS:
• CONSTRUCTION: Heat Treated Stainless Steel
• COATING: DLC Coating
• LENGTH: 2.6 in (6.6 cm)
• WEIGHT: 3.9 oz (110.5 g)]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-socom-muzzle-brake-r-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-socom-muzzle-brake-r-39.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-stiletto-multi-output-rechargeable-flashlight-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-stiletto-multi-output-rechargeable-flashlight-42.jpgcustom-itemoptacticalgear-pageflashlights103PLR-A129116Surefire Stiletto Multi-Output Rechargeable FlashlightSurefire111The Stiletto is a dual-purpose tactical handheld light that also functions as utility light - a slim, lightweight solution that's ideal for everyday carry. The thin design allows it to be drawn and activated from a pocket as fast as a knife. It is a rechargeable, high-output handheld flashlight – ideal for anyone’s everyday carry kit. The primary switch on the body activates a wide 650-lumen, medium 250-lumen or dialed-down 5-lumen beam for tasks using a MaxVision Beam® reflector. The Tactical switch on the rear of the light activates high (650 lumen) output only and has an optional high-frequency strobe. Simply recharge the lithium polymer battery with any ubiquitous MICRO-USB cable charger (included). The heavy duty pocket clip will always keep the Stiletto® quickly accessible and secured. The Stiletto gives you the edge when the threat of darkness looms upon you. Features:
• High-performance LED and MaxVision Beam® reflector projects a wide flood beam ideal for situational awareness
• Primary switch activates high, medium and low light output for a wide variety of tasks
• Tactical switch activates high output and an optional tactical strobe when white light is used as a fighting tool
• Programming switch unlocks activation sequences to choose between tactical and/or task illumination preferences
• Integrated MICRO-USB rechargeable lithium polymer battery is environmentally friendly and reduces the cost of operation
• LED Fuel Gauge for tracking battery charge/discharge status
• Mil-Spec hard anodized aluminum head assembly is corrosion resistant and durable
• Melonite® coated, spring steel pocket clip for bezel up, everyday carry quick access
• Compact, lightweight polymer body passes IPX7 water testing to one meter for 30 minutes Specifications:
• Output/Runtime -- White Light
• High: 650 Lumens / 1.75 Hours*
• Medium: 250 Lumens / 2 Hours*
• Low 5 Lumens / 30 Hours*
• Bezel Diameter: 0.8 Inches
• Length: 4.45 Inches
• Weight w/Batteries: 2.8 Ounces *All performance claims tested to ANSI/NEMA FL1-2009 Standard. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-stiletto-multi-output-rechargeable-flashlight-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-stiletto-multi-output-rechargeable-flashlight-56.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-ue07-remote-switch-assembly-for-scoutlights-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-ue07-remote-switch-assembly-for-scoutlights-62.jpgcustom-itemoptacticalgear-pagewelilasw103UE0710998Surefire UE07 Remote Switch Assembly for ScoutLightsSurefire111• Tape switch attaches with adhesive-backed Velcro®
• 7" cable is standard; other cable lengths available
• O-ring sealed, weatherproof]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-ue07-remote-switch-assembly-for-scoutlights-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-ue07-remote-switch-assembly-for-scoutlights-76.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-warcomp-closed-tine-flash-hider-for-5-56mm-rifles-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-warcomp-closed-tine-flash-hider-for-5-56mm-rifles-r-42.jpgcustom-itemoptacticalgear-pagem4arupreandp103WARCOMP-556-CTN-1/2-28169152Surefire WARCOMP Closed Tine Flash Hider for 5.56mm Rifles (R)Surefire111• Provides reduction in muzzle flash compared to a plain muzzle, which helps to conceal the shooter’s location and preserve darkadapted vision.
• Aids in reduction of muzzle rise allowing shooter to stay on target for faster follow-up shots.
• Serves as a rock-solid mounting adapter for all SureFire SOCOM Series Fast-Attach® suppressors.
• Made in the USA. Specifications:
• Caliber: 5.56 mm (.223 caliber)
• Length: 2.48 inches Color: Black This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-warcomp-closed-tine-flash-hider-for-5-56mm-rifles-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-warcomp-closed-tine-flash-hider-for-5-56mm-rifles-r-56.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-warcomp-flash-hider-suppressor-adapter-r-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-warcomp-flash-hider-suppressor-adapter-r-36.jpgcustom-itemoptacticalgear-pagem4arupreandp103WARCOMP169152Surefire WARCOMP Flash Hider / Suppressor Adapter - 5.56 and 7.62 Models (R)Surefire111• M4 / 5.56 NATO caliber rifles with ½-28 muzzle threads
• 7.62 NATO (.308 caliber) rifles with 5/8-24 muzzle threads Features
• Patent-pending design provides over 99% flash elimination; virtually eliminates muzzle rise
• Serves as rock-solid mounting adapter for SureFire SOCOM suppressors
• Multiple bearing surfaces provide suppressor alignment and prevent tines from ringing inside suppressor
• Precision machined from US mill-certified heat-treated stainless steel bar stock
• High-precision single-point cut barrel threads for optimum thread interface
• Individually inspected for all critical dimensions, including concentricity and alignment
• Ionbond DLC coating provides maximum protection against harsh environmental conditions and facilitates cleaning after extreme use
• Labyrinth seals prevent carbon buildup on suppressor lock ring indexing system
• Installation requires no permanent modifications to weapon
• Made in the USA and backed by SureFire No-Hassle Guarantee Lengths:
• 5.56 NATO: 2.67 inches
• 7.62 NATO: 2.84 inches This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-warcomp-flash-hider-suppressor-adapter-r-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-warcomp-flash-hider-suppressor-adapter-r-46.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-x300-ultra-led-handgun-or-long-gun-weaponlight-r-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-x300-ultra-led-handgun-or-long-gun-weaponlight-r-76.jpgcustom-itemoptacticalgear-pageweaponlights1103X300U-B379341Surefire X300-B Ultra 1000 Lumens LED with T-Slot Mounting Rail (R)Surefire111ambidextrous switches—now wider and shorter for improved ergonomics and comfort—at the rear of the body. Simply press the switch on either side for momentary-on activation or flip up or down for constant-on activation. Optional DG grip switches (for handguns) and pressure-activated XT tape switches (for long guns) permit the X300 Ultra to be activated remotely. The X300 Ultra can be securely attached to a handgun or a long gun via its new and improved T-slot mounting system. Universal and Picatinny crossbar wedges are included for simple, foolproof installation. Its high-strength aerospace aluminum body—including the mounting system—is Mil-Spec hard anodized for superior toughness and it is O-ring sealed, making it weatherproof. FITS: The new T-slot mounting system fits most railed handguns (and rail-equipped long guns) but adapter mounts are available for some non-railed handguns, including Beretta M9 and 1911 models. Features:
• Virtually indestructible LED regulated to maximize output and runtime
• Tactical-level output with TIR lens for close- to longer-range applications
• Integral aluminum T-slot mounting system offers rock-solid attachment to railed hand guns and long guns equipped with MIL-STD 1913 rails
• Accepts optional pistol grip and long gun forend switches
• Weatherproof—O-ring and gasket sealed
• Construction—High-strength aerospace aluminum with Mil-Spec anodizing; impact-resistant polymer; coated tempered window
• Includes high-energy 123A batteries with 10-year shelf life Specificatons:
• Max Output -- White Light 1000 lumens
• Tactical Runtime* 1.25 hours
• Length 3.60 inches
• Bezel Diameter 1.125 inches
• Weight w/Batteries 4.0 ounces
• Batteries 2 x 123A (included) THIS ITEM CAN ONLY SHIP TO CONTINENTAL USA ADDRESSES (NO APO). It cannot ship international.]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-x300-ultra-led-handgun-or-long-gun-weaponlight-r-85.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-x300-ultra-led-handgun-or-long-gun-weaponlight-r-86.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-x300v-led-weaponlight-white-and-ir-output-r-30.jpgcustom-itemoptacticalgear-pageweaponlights1103X300V-B499449Surefire X300V LED WeaponLight — White and IR Output (R)Surefire111• Virtually indestructible white-light/infrared LED head is regulated to maximize light output and runtime
• Total Internal Reflection (TIR) lens shapes white or IR light into focused beams with enough reach and surround light for close- to medium-range applications
• Features quick-detach Rail-Lock® system for rapid and secure attachment/detachment
• Accepts optional SureFire DG pistol grip and long gun forend switches
• Weatherproof—O-ring and gasket sealed
• Construction—High-strength aerospace aluminum with Mil-Spec anodizing; impact-resistant polymer; coated tempered window
• Includes high-energy 123A battery with 10-year shelf life Specs:
• Max Output - White Light: 350.0 Lumens
• Tactical Runtime (White Light): 1.8 hours
• Output / Runtime (IR): 120.0 mW / 8.0 hours
• Length: 4.0 inches
• Bezel Diameter: 1.06 inches
• Weight w/Batteries: 3.9 ounces Batteries: 2 x 123A (included) Color: Black THIS ITEM CAN ONLY SHIP TO CONTINENTAL USA ADDRESSES (NO APO). It cannot ship international.]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-x300v-led-weaponlight-white-and-ir-output-r-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-x300v-led-weaponlight-white-and-ir-output-r-39.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-xvl2-irc-weaponlight-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-xvl2-irc-weaponlight-r-46.jpgcustom-itemoptacticalgear-pageweaponlights1103XVL2-XX-IRC15491394SureFire XVL2 IRC WeaponLight (R)Surefire111Features
- Virtually indestructible white-light and infrared LEDs regulated to maximize output and runtime
- Integral ambidextrous momentary- and constant-on switching
- Attaches securely to both Universal and Picatinny accessory rails
- Weatherproof, waterproof O-ring and gasket sealed; the XVL2 meets IPX8 standards (66 feet, 2 hours)
- Accepts optional pressure-activated remote switches for precision control without altering grip on weapon
- Includes a nylon pouch to store the XVL2, mount key, safety screw key, cleaning cloth and lens cleaner KEY ATTRIBUTES
- HIGH OUTPUT: 400 lumens
- IR OUTPUT: 300mW / 850 nm
- PEAK BEAM DENSITY: 820 candela
- BATTERIES: One 123A lithium (incl.)
- SWITCHING: Ambidextrous push / toggle
- HIGH RUNTIME: 1.5 hours
- GREEN LASER OUTPUT: <5 millWatts (520 nm)
- IR LASER OUTPUT: <.7 milliWatts (+/- 10%)
- DISTANCE: 54 meters BODY
- CONSTRUCTION: Aluminum
- FINISH: Mil-Spec Hard Anodized
- WEIGHT W/ BATTERIES: 5.0 oz (142 g)
- LENGTH: 3.0 in (7.62 cm)
- BEZEL DIAMETER: 1.06 in (2.7 cm)
- LIQUID INGRESS PROTECTION: IPX8 (66 feet, 2 hours) ITAR Restricted, No International Shipping. Continental USA Shipping Addresses Only. No APO Addresses. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-xvl2-irc-weaponlight-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-xvl2-irc-weaponlight-r-60.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/surefire-z68-tailcap-12.jpgcustom-itemoptacticalgear-pageweaponlights1103SFZ683935Surefire Z68 TailcapSurefire111This tailcap is compatible with the S&S Precision M-Ax Mount Features
• Aerospace grade aluminum construction, Mil-Spec hard-anodized
• Press for momentary-on, press further for constant-on
• Lock-out feature prevents accidental activation during transport or storage
• Fits Scout Light WeaponLights and flashlights with a 3/4-inch diameter switch ]]>1https://s.turbifycdn.com/aah/optacticalgear/surefire-z68-tailcap-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/surefire-z68-tailcap-21.jpgSurefirehttps://s.turbifycdn.com/aah/optacticalgear/survival-kits-tools-and-signalling-56.jpgitem.optacticalgear-pagemesuhySurvival Tools and Signalling1caprpewadekimutwnoname1eblolprcowisawsotemimapaorpremsimiorsubatickkey1https://s.turbifycdn.com/aah/optacticalgear/survival-kits-tools-and-signalling-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/survival-kits-tools-and-signalling-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/suspenders-45.jpgitem.optacticalgear-pagebeltsSuspenders1atslowprsuvitacosu1https://s.turbifycdn.com/aah/optacticalgear/suspenders-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/suspenders-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/suspenders-video-17.jpglink.vitacosu1https://s.turbifycdn.com/aah/optacticalgear/suspenders-video-15.jpghttps://s.turbifycdn.com/aah/optacticalgear/suspenders-video-16.jpghttps://s.turbifycdn.com/aah/optacticalgear/suunto-clipper-l-b-nh-compass-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/suunto-clipper-l-b-nh-compass-64.jpgcustom-itemoptacticalgear-pagelandnavigation81SS00410201119.95Suunto Clipper L-B NH CompassSuunto111No International Shipping allowed. Your compass is always as close as your wrist with the Suunto Clipper L-B NH compass. Just clip it on your watchband for quick, easily-accessible navigation. Features
-Rotating bezel with easy-to-read markings in 10-degree increments, liquid-filled capsule, jewel bearing and hardened steel needle
-The Suunto Clipper L-B NH compass also clips to the edge of a map, bag strap or the sleeve of your jacket Dimensions: 1.2 x 0.94 inches Weight: 0.18 oz This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/suunto-clipper-l-b-nh-compass-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/suunto-clipper-l-b-nh-compass-76.jpgSuuntohttps://s.turbifycdn.com/aah/optacticalgear/suunto-core-all-black-military-42.jpgitem.optacticalgear-pagelandnavigation81SS014279010219Suunto Core All Black MilitarySuunto111No International Shipping allowed. Suunto Core gathers a range of accurate data and information you need when exploring the wilder parts of the world. You look up and see stars. But your Suunto Core sees an approaching squall. And it tells you with the Storm Alarm -one of several intelligent features that can help you make consistently good decisions. Building on the success of the venerable Suunto Vector, the Suunto Core keeps you informed with an accurate altimeter, barometer, digital thermometer, Weather Trend Indicator and digital compass. The pressure gauge operates in four distinct modes, including an automatic setting that senses your movement or lack thereof, switching between altimeter and barometer accordingly. The compass features a rotating bezel for traditional use, or a one-touch function that allows you to sight, lock and follow a bearing. Daily functions include dual time, date, alarm, sports chronograph and predicted times for sunrise and sunset. Product Features Altimeter: Difference Measurement / Start from 0, Logbook, Automatic Mode Barometer: Storm Alarm, Weather Trend Indicator, Weather Graph Compass: Rotating Bezel, Digital Bearing, Easy Calibration Depth Measurement: Maximum Depth 10 m Watch: Sunrise/Sunset Time, Dual Time, Countdown Other: Button Lock, 4 Language Menu The US Postal Service will not insure watches shipped through the postal system, choose $7.95 Shipping option at your own risk. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/suunto-core-all-black-military-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/suunto-core-all-black-military-50.jpgSuuntohttps://s.turbifycdn.com/aah/optacticalgear/suunto-m9-wrist-compass-with-strap-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/suunto-m9-wrist-compass-with-strap-64.jpgitem.optacticalgear-pagelandnavigation81SS0044030013531.95Suunto M9 Wrist Compass with StrapSuunto111No International Shipping allowed. Handy Wrist Compass for Quick and Easy Navigation The Suunto M-9 wrist compass is a handy and reliable tool that a great variety of people find invaluable. Featuring a serrated bezel ring for easy turning even while wearing gloves and available in either black or green, the Suunto M-9 enables you to navigate effectively in town or country. Features:
-Two Zone System (available for northern hemisphere only)
-serrated bezel ring
-jewel bearing
-luminous card
-side-reading window
-ratchet mechanism to set desired direction
-capsule size: 1.61 x 1.85 x 0.55 inches
-weight: 16 g / 0.56 oz This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/suunto-m9-wrist-compass-with-strap-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/suunto-m9-wrist-compass-with-strap-76.jpgSuuntohttps://s.turbifycdn.com/aah/optacticalgear/mayflower-velocity-swift-clip-qasm-compatible-69.jpgcustom-itemoptacticalgear-pagemollevestsrigsSwift Clip / QASM Compatible Rigs, Parts, and Vests1sp1initwnebuspsyth2mauwgenivertmaqu5plshcoarcplv3shcoramelin1wh7fichplwh7alpapedetr5maplaaxlsandwichbagaxlchrigrekimaswclkitaxladveplforaxlcrfrfltopdorageqavecovesytr5swplestr556daplestr556daplmesdafrpaswplestr762daplvesymoplzum4resichrimauwchriggenmapuuwgenvipmauwgenvspfrhastd3chrighastd3riandaspsymifichri1spsylvpl556vesyliweplcavesylawenplcopmbasplcavesyscplcaanmaloarca20vemaloasarca201https://s.turbifycdn.com/aah/optacticalgear/mayflower-velocity-swift-clip-qasm-compatible-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-velocity-swift-clip-qasm-compatible-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-40mm-bandolier-40.jpgcustom-itemoptacticalgear-pagehagrsmgrflfl92T340MMBLC68.62T3 40mm Belt Laser CutT3 Gear111Features:
• Holds 12 rounds (dummy rounds not included)
• Velcro closure system
• Low profile fit with adjustable 2" side-release buckle
• Laser-Cut for strength and ultra-light weight
• Dimensions: 54"x2"
• Weight: 8.4 oz]]>1https://s.turbifycdn.com/aah/optacticalgear/t3-40mm-bandolier-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-40mm-bandolier-47.jpgT3 Gearhttps://s.turbifycdn.com/aah/optacticalgear/t3-70oz-molle-hydration-carrier-with-2l-bladder-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-70oz-molle-hydration-carrier-with-2l-bladder-38.jpgcustom-itemoptacticalgear-pagemohypa9270OZMHC94.9675.97T3 70oz MOLLE Hydration Carrier with Hydrapak BladderT3 Gear111- Designed to carry 70 oz / 2 Liter hydration bladder -Hydrapak 70oz Bladder included - MOLLE along front of pack for attaching additional pouches and securing gear - Compatible to all Molle/modular webbed systems - VELCRO Brand fastener loop along top section of pouch for patches and IFF - hydration tube opening on the back side top of the pouch for running tubing - Material: 500D Cordura - Lifetime Warranty Dimensions: 31" x 7.5" x 2" Weight: 8.5 oz (without bladder) Made in the USA]]>1https://s.turbifycdn.com/aah/optacticalgear/t3-70oz-molle-hydration-carrier-with-2l-bladder-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-70oz-molle-hydration-carrier-with-2l-bladder-48.jpgT3 Gearhttps://s.turbifycdn.com/aah/optacticalgear/t3-hans-backpack-82.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-hans-backpack-80.jpgcustom-itemoptacticalgear-pageassaultpacks92T3-HANSBP299.58239.99T3 Hans BackpackT3 Gear111(Included with Pack). It has 3 ports to feed a drinking tube or radio cables. Two side pouches hold Nalgene bottles or standard a C4 Charge and two small front pockets offer added organization. The unique open top mesh pocket is designed to carry a helmet or anything the you would need to access quickly. Compression straps keep your gear secured and chest and sternum straps help distribute weight. There are three ways to carry: padded shoulder straps, rugged drag handle or MOLLE/PALS. Features:
-Removable shoulder straps, MOLLE compatible back panel for direct attachment to carriers and other MOLLE systems.
-Main compartment is sized to fit up to a 117 radio, with three concealable top ports for antenna.
-Separate mesh hydration compartment for up to a 3 liter bladder (Included with Pack)
-See Drop Down Menu options for ordering with or without Bladder
-Zippered side admin pouches fit additional antenna or Nalgene bottles
-Kangaroo pocket on front of pack for storing a helmet or similar sized gear for quick access, reinforced with dive mesh for drainage and feature strap cinches for retention.
-3 x small GP pouches along front of bag for admin and similar items
-Velcro loop for Name tape / IFF Approximate dimensions of main compartment: 15.75 x 8 x 3.5 inches Approximate weight: 1.9 lbs Lifetime warranty.]]>1https://s.turbifycdn.com/aah/optacticalgear/t3-hans-backpack-93.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-hans-backpack-94.jpgT3 Gearhttps://s.turbifycdn.com/aah/optacticalgear/t3-padded-nvg-pouch-41.jpgcustom-itemoptacticalgear-pagephflpdbapo92T3-PNVGP1438.1935.99T3 Padded NVG PouchT3 Gear111• Material: 500D Cordura
• Dimensions: 5.5"x4"x3"
• Weight: 4.50 oz This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/t3-padded-nvg-pouch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-padded-nvg-pouch-50.jpgT3 Gearhttps://s.turbifycdn.com/aah/optacticalgear/t3-personal-retention-lanyard-2-33.jpgcustom-itemoptacticalgear-pagerela92T3PRL283.9869.99T3 Personal Retention Lanyard 2T3 Gear111Note: Designed for single Operator use only. Test capabilities prior to use.]]>1https://s.turbifycdn.com/aah/optacticalgear/t3-personal-retention-lanyard-2-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-personal-retention-lanyard-2-42.jpgT3 Gearhttps://s.turbifycdn.com/aah/optacticalgear/t3-spear-chest-rig-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-spear-chest-rig-46.jpgcustom-itemoptacticalgear-pagevests92T3SPCR350.38279.99T3 Spear Chest RigT3 Gear111Accessories not included]]>1https://s.turbifycdn.com/aah/optacticalgear/t3-spear-chest-rig-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-spear-chest-rig-60.jpgT3 Gearhttps://s.turbifycdn.com/aah/optacticalgear/t3-belt-mounted-weapon-catch-38.jpgcustom-itemoptacticalgear-pagewere92T3_WC43.5239.99T3 Weapon Catch - MOLLE MountT3 Gear111The T3 Weapons Catch is made with an aluminum insert, covered with PV material making it extremely light and durable. The aluminum allows it to be bent for smaller weapons like an M4 or Shotgun. Additionally, it can be opened wide for heavy weapons, like a SAW. Dimensions: W:2" L:5" D:3" Weight: 3.90 oz 1https://s.turbifycdn.com/aah/optacticalgear/t3-belt-mounted-weapon-catch-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-belt-mounted-weapon-catch-45.jpgT3 Gearhttps://s.turbifycdn.com/aah/optacticalgear/t3-weapons-catch-belt-mount-12.jpgcustom-itemoptacticalgear-pagewere92T3_BMWC-BELT54.0843.27T3 Weapons Catch - Belt MountT3 Gear111The T3 Weapons Catch is made with an aluminum insert, covered with PV material making it extremely light and durable. The aluminum allows it to be bent for smaller weapons like an M4 or Shotgun. Additionally, it can be opened wide for heavy weapons, like a SAW. Dimensions: W:2" L:5" D:3" Weight: 3.90 oz 1https://s.turbifycdn.com/aah/optacticalgear/t3-weapons-catch-belt-mount-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/t3-weapons-catch-belt-mount-21.jpgT3 Gearhttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-control-wrap-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-control-wrap-56.jpgitem.optacticalgear-pagebandages84CW2.7Tac Med Solutions Control WrapTac Med Solutions111By reducing the risk of accidental unrolling of the bandage, you minimize the following risks: Contaminating a clean bandage. Waste of a bandage due to contamination. Lost time while managing loose ends. Loss of pressure after applying the bandage due to shifting of material. There are no returns or exchanges on medical items. THIS ITEM CAN ONLY BE SHIPPED TO USA AND APO ADDRESSES. CHECK WITH YOUR LOCAL DISTRIBUTOR FOR INTERNATIONAL SALES.]]>1https://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-control-wrap-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-control-wrap-70.jpgTac Med Solutionshttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-downed-operator-kit-no-hemostatic-49.jpgitem.optacticalgear-pagebandages84DOK56.51Tac Med Solutions Downed Operator Kit (NO Hemostatic)Tac Med Solutions111THIS ITEM CAN ONLY BE SHIPPED TO USA AND APO ADDRESSES. CHECK WITH YOUR LOCAL DISTRIBUTOR FOR INTERNATIONAL SALES. There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-downed-operator-kit-no-hemostatic-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-downed-operator-kit-no-hemostatic-59.jpgTac Med Solutionshttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-h-h-compressed-gauze-30.jpgcustom-itemoptacticalgear-pagebandages84COMP-GAUZE5.02Tac Med Solutions Compressed GauzeTac Med Solutions111There are no returns or exchanges on medical items.]]>1https://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-h-h-compressed-gauze-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-h-h-compressed-gauze-40.jpgTac Med Solutionshttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-olaes-hemostatic-bandage-flat-packed-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-olaes-hemostatic-bandage-flat-packed-45.jpgcustom-itemoptacticalgear-pagebandages8485-002445Tac Med Solutions OLAES Hemostatic Bandage - FLAT PACKEDTac Med Solutions111THIS ITEM CAN ONLY BE SHIPPED TO USA AND APO ADDRESSES. CHECK WITH YOUR LOCAL DISTRIBUTOR FOR INTERNATIONAL SALES. This is the Hemostatic Flat Packed 4-Inch Model. The OLAES® Hemostatic Bandage combines the globally recognized OLAES® Modular Bandage with battle tested HemCon® ChitoGauze® PRO to create the most comprehensive trauma bandage for multiple injury profiles. Both proven life-saving devices are now together in a single, easily accessible package to increase any level of pre-hospital care provider’s treatment capabilities while reducing application times and saving space in your kit. One of few CoTCCC recommended hemostatic dressings, ChitoGauze® PRO features chitosan as the hemostatic agent, is X-Ray detectable, and is located inside the bandage’s wound pad for rapid access at the point of injury. The included hemostatic gauze is located inside the bandage’s wound pad for rapid access at the point of injury. The convenience of having both products in a single kit item allows you to have more time to focus on treating your patient rather than locating and opening multiple packages. The flat packed version easily fits into most standard IFAKs, giving you options to best fit your trauma kit space requirements. It was designed with direct input from some of the most experienced combat medics in the world, first responders here at home, and our end-users so no details are left out, making the OLAES® Hemostatic Bandage the best multi-functional piece of gear inside your kit. Parts of the Bandage:
• 1) Hemostatic Gauze: Stocked with 3”x12’ of ChitoGauze® PRO hemostatic gauze, ideal for a variety of applications and wound surfaces.
• 2) True Pressure Cup: Generates focused pressure on the wound site to assist occluding damaged vessels. It can also serve as a rigid eye shield for ocular injuries per CoTCCC guidelines.
• 3) Wound Pad: Covers the injury site to assist with sustained bleeding control and keep the wound clear of debris. Its non-adherent compartment keeps gauze tucked neatly inside for rapid access during application.
• 4) Velcro® Control Strips: Built-in Velcro® Control Strips stationed along the bandage's elastic wrap prevent accidental unrolling during application.
• 5) Elastic Wrap: Secures the gauze and wound pad to the injury site and assists in maintaining consistently applied pressure.
• 6) Securing Clip: Locks the bandage into place to free up the user’s hands to treat other injuries or casualties.
• 7) Easy-Tear Points: Intuitive, rapid access to the sterile bandage is achieved through multiple tear points indicated by red arrows at each package corner. Additional Features:
• 4-Inch Flat Pack version
• Latex-Free
• FDA Registered
• CoTCCC Recommended Hemostatic Dressing
• X-Ray Detectable Gauze
• 5.5 Year Shelf Life Made in the USA. There are no returns or exchanges on medical items. THIS ITEM CAN ONLY BE SHIPPED TO USA AND APO ADDRESSES. CHECK WITH YOUR LOCAL DISTRIBUTOR FOR INTERNATIONAL SALES.]]>1https://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-olaes-hemostatic-bandage-flat-packed-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-olaes-hemostatic-bandage-flat-packed-59.jpgTac Med Solutionshttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-olaes-modular-bandage-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-olaes-modular-bandage-71.jpgitem.optacticalgear-pagebandages84OAL7.76Tac Med Solutions OLAES Modular BandageTac Med Solutions111APPLICATION EFFICIENCY During high stress situations, such as those involving casualties, stress effects on human performance often affect the fine motor skills of individuals. This makes simple tasks such as bandage application more difficult and time consuming. By creating a bandage where application involves only gross motor skills, no direction changes around hooks or bars, the Olaes Modular Bandage significantly offers a simpler and more effective solution in bandage options. The elastic simply requires wrapping where the elastic stays flat instead of turning into a cord. Control of the elastic roll is maintained by the 'Control Strips' should the elastic be dropped. You no longer have to open or carry a package of gauze and a separate bandage as both are included in the same package. A TRUE PRESSURE CUP The unique pressure cup generates true focused pressure on top of the wound site where it is required, not circumferential pressure like an ineffective tourniquet. By generating this focused pressure it helps occlude damaged vessels at the wound site where it is needed. It also reduces the amount of manual pressure required to be held, freeing up the care provider to treat other injuries or casualties. The pressure cup can also be removed and used as an eye cup for treatment of ocular injuries as recommended in the new TCCC guidelines. Features Include: Latex Free. Elastic wrap with built in 'Control Strips' to prevent inadvertent unraveling. 3 meters of sterile 4 ply gauze. Plastic occlusive sheet included in dressing pocket. Transparent pressure cup that focuses pressure on the wound site and allows for visual inspection of uncontrolled hemorrhage. Available in both 4" and 6" bandages. There are no returns or exchanges on medical items. THIS ITEM CAN ONLY BE SHIPPED TO USA AND APO ADDRESSES. CHECK WITH YOUR LOCAL DISTRIBUTOR FOR INTERNATIONAL SALES. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-olaes-modular-bandage-84.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-olaes-modular-bandage-85.jpgTac Med Solutionshttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-operator-ifak-full-kit-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-operator-ifak-full-kit-63.jpgitem.optacticalgear-pageinmedpoipo84O-IFAK101.94Tac Med Solutions Operator IFAK (Full Kit)Tac Med Solutions1111x SOF® Tactical Tourniquet-Wide
1x OLAES® 4" Modular Bandage
1x Petrolatum Gauze
1x Nasopharyngeal Airway 28F w/ Lube
1PR Nitrile Gloves XL
1x 2" Surgical Tape
1x Adsafe Face Shield
1x 5.5" Trauma Shears
1x TacMed™ Combat Casualty Card Colors: Tan, Ranger Green, Black, Multicam There are no returns or exchanges on medical items. THIS ITEM CAN ONLY BE SHIPPED TO USA AND APO ADDRESSES. CHECK WITH YOUR LOCAL DISTRIBUTOR FOR INTERNATIONAL SALES.]]>1https://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-operator-ifak-full-kit-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-operator-ifak-full-kit-76.jpgTac Med Solutionshttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-pocket-medical-kit-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-pocket-medical-kit-46.jpgcustom-itemoptacticalgear-pagebandages84PMK65.15Tac Med Solutions Pocket Medical KitTac Med Solutions111-1 x SOF® Tactical Tourniquet Gen 4 in Rescue Orange
-1 x Esmark Bandage
-1 x Compressed Gauze or Quik Clot Combat Gauze LE
-1 x Beacon™ Chest Seal
-1 PR Black Gloves THIS ITEM CAN ONLY BE SHIPPED TO USA AND APO ADDRESSES. CHECK WITH YOUR LOCAL DISTRIBUTOR FOR INTERNATIONAL SALES. There are no returns or exchanges on medical items. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-pocket-medical-kit-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-pocket-medical-kit-60.jpgTac Med Solutionshttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-rise-splint-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-rise-splint-44.jpgcustom-itemoptacticalgear-pagebandages8487-104627.02Tac Med Solutions RISE SplintTac Med Solutions111THIS ITEM CAN ONLY BE SHIPPED TO USA AND APO ADDRESSES. CHECK WITH YOUR LOCAL DISTRIBUTOR FOR INTERNATIONAL SALES. Low Profile, Packable, Rugged Splint for Extremities and Pelvic Binding The RISE™ (Rigid Immobilization System for Extremities) is a rugged, low-profile, splint for extremity fractures and pelvic binding in the prehospital environment. Born from lessons on the battlefield, it can be intuitively applied under stress to create a straight splint, 90-degree splint, or pelvic binder. It can be easily secured to the patient with items such as an elastic wrap or pressure bandage. It features dynamic living hinges that allow the splint to collapse for maximum portability and kit space savings while easily form-fitting to the required shape and dimensions for proper upper and lower extremity splinting of fractures. With its compact size, the RISE™ fits into most individual first aid kits including all standard military-issued IFAKs. Unique to the RISE™, multiple cutout slots provide you the capability to create a pelvic binder when paired with a windlass or ratcheting tourniquet such as our new SOF® Tourniquet. The Committee on Tactical Combat Casualty Care (CoTCCC) recognizes splinting and pelvic binding application as a critical step to prevent additional injury before moving a casualty. The one-of-a-kind design is made of a lightweight polymer capable of withstanding surface cleaning and harsh elements, including saltwater while maintaining its rigidity and durability. Whether you’re on the battlefield or a responder here at home, the RISE™ is an advantageous addition to any IFAK for increasing your medical capability at the point of injury when needed most. Parts of the RISE™:
• 1) Dynamic Living Hinges - Pre-formed folding points for form-fitting to the required shape & dimension while minimizing size for storage versatility.
• 2) Pelvic Binder Slots - Unique cutout slots provide you the ability to create a pelvic binder in conjunction with a windlass or ratcheting tourniquet.
• 3) Securing Snaps - Allow you to bend and lock the RISE into place for the 90-degree applications.
• 4) Lightweight Polymer Construction - The material maintains its strength and rigidity without fail, even after refolding multiple times.
• 5) Compact Folding - The pre-formed folding points allow for compact storage, even smaller when shrink-wrapped, so it can fit into virtually any size IFAK.
• 6) Screen Printed Instructions - Instructions for all 3 splinting application styles, printed directly on the surface so you always have them when needed. Specs/Info:
• Dimensions: 6.25"W x 4"L x 1"D (Folded) / 32"L x 6.25"W (Open Flat)
• Weight: 4oz
• Latex-Free
• Radiolucent (Excludes Snaps)
• Blood & Chemical Resistant
• FDA Registered
• Patent Pending Made in the USA. There are no returns or exchanges on medical items. THIS ITEM CAN ONLY BE SHIPPED TO USA AND APO ADDRESSES. CHECK WITH YOUR LOCAL DISTRIBUTOR FOR INTERNATIONAL SALES.]]>1https://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-rise-splint-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-rise-splint-58.jpgTac Med Solutionshttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-softt-tourniquet-gen-4-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-softt-tourniquet-gen-4-49.jpgcustom-itemoptacticalgear-pagetourniquets84SOFTT-W434Tac Med Solutions SOF Tourniquet - Latest GenTac Med Solutions111• 1) Performance Compression Band
• Completely redesigned webbing maximizes compression during the application process. At a true 1.5" width, the performance material glides through the Rugged Buckle for quick, snag-free operation and minimizes loss of pressure over time after application. 2) Slack Indicator Wedge
• Stitched into the Performance Compression Band below the windlass. The contrasting wedge offers a visual confirmation you have pulled all excess slack from the band. This is a critical step for proper tourniquet application and results in fewer windlass rotations required to reach occlusion. 3) Rugged Buckle
• Engineered to remove excess slack in a single fluid motion. The buckle's shape stabilizes the Performance Compression Band at any angle of engagement. The Rugged Buckle is an advanced, lightweight composite design with superior strength over previous versions. SPECS:
• Dimensions: 5.5"L x 2"W x 1.75"D (Folded in Package)
• Weight: 3.7oz Made is in the USA. There are no returns or exchanges on medical items.]]>1https://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-softt-tourniquet-gen-4-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/tac-med-solutions-softt-tourniquet-gen-4-59.jpgTac Med Solutionshttps://s.turbifycdn.com/aah/optacticalgear/tacops-m-9-assault-medical-backpack-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/tacops-m-9-assault-medical-backpack-70.jpgitem.optacticalgear-pagemedicalpacks90TSSM9397Tacops M-9 Assault Medical BackpackTSSI111NSN 6545-01-539-6448
Specially designed by Special Forces Medic
Especially for vehicle or aircraft operations
Closed dimenstions: 20"H x 13"W x 3" D
Very thin profile carries necessary med supplies Internal Compartments
• 4 Rectangle Mesh Pouches
• 1 Instrument Panel
• 1 Set of Padded Shoulder Straps Carry Options
• Carry handles located on top of pack body and flap
• Padded and non-padded shoulder strap options and waist strap
• MOLLE compatible attachment points on side of pack body and front flap with Quick Detach Buckles Additional Features
• Bottom pocket designed to hold IV solutions (accessible through front zipper or from inside of pack via trap door bottom)
• Internal zipper pulls are red para-cord for fast and easy identification
• Drain hole located in bottom
• Webbing loose ends on backpack straps and waist strap have VELCRO® Brand fastener securing straps (for tying up bitter ends)
• 3x2 in. VELCRO® Brand fastener patch (loop side) sewn on front cover for IR identifiers
• Made in the USA with all US components See brochure link at bottom of page for detailed description of the bags contents if ordered full. Empty Bags are normally in stock. If not in stock we can get them in approximately 1 week; however, this is not guaranteed. Lead time will depend on manufacturer. Field Ready Kit version comes with medical kit and is available for an additional $685. This version is not normally stocked. See inset picture for list of contents. Lead time is approximately 2-3 weeks. UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item (due to the size of item). This Item is Excluded from ALL Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/tacops-m-9-assault-medical-backpack-82.jpghttps://s.turbifycdn.com/aah/optacticalgear/tacops-m-9-assault-medical-backpack-83.jpgTSSIhttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-malice-clip-long-single-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-malice-clip-long-single-48.jpgitem.optacticalgear-pagemollepouches83MCSBULK11.631.49Tactical Tailor Fight Light MALICE Clip - LongTactical Tailor111PRICE IS FOR A SINGLE CLIP!]]>1https://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-malice-clip-long-single-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-malice-clip-long-single-58.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-malice-clip-short-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-malice-clip-short-single-40.jpgitem.optacticalgear-pageammopouches83MCSBULK1.371.27Tactical Tailor Fight Light MALICE Clip - ShortTactical Tailor111PRICE IS FOR A SINGLE CLIP!]]>1https://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-malice-clip-short-single-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-malice-clip-short-single-47.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-malice-pack-frame-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-malice-pack-frame-62.jpgcustom-itemoptacticalgear-pageruandac83100899184165Tactical Tailor Fight Light MALICE Pack FrameTactical Tailor111UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item (due to the size of item). This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-malice-pack-frame-75.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-fight-light-malice-pack-frame-76.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-super-belt-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-super-belt-60.jpgitem.optacticalgear-pageruandac83320025247.84Tactical Tailor Super BeltTactical Tailor111TT's Super Belt replaces the issue kidney pad used with the ALICE pack frame but with a number of improvements. Most importantly, the TT Super Belt utilizes 1.5" padding for maximum comfort. Other features include a dual adjustable front buckle and side webbing attachment points to allow additional modular gear to be attached directly to the belt. Two easy to use adjustable buckles replace the awkward 'ratchet' style attachment system on the issue kidney pad. The Super Belt is a must have for anyone seeking more comfort and durability with their ALICE or MALICE Packs. Available in Coyote Brown, and OD. Colors: Olive Green, Coyote1https://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-super-belt-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/tactical-tailor-super-belt-73.jpgTactical Tailorhttps://s.turbifycdn.com/aah/optacticalgear/link-to-takeout-features-video-11.jpglink.madatala1https://s.turbifycdn.com/aah/optacticalgear/link-to-takeout-features-video-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/link-to-takeout-features-video-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/taran-tactical-base-pad-kit-for-glock-19-4-5-r-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/taran-tactical-base-pad-kit-for-glock-19-4-5-r-48.jpgcustom-itemoptacticalgear-pagemainco116GBP940C43.99Taran Tactical Base Pad Kit for Glock 19 +4/+5 (R)Taran Tactical111*Does not come with an allen key. The screws are set with Loctite to achieve a nice tension with the pin. If the pin is very loose use a 1/16 allen(hex) to tighten it.* Features:
- Designed for factory Glock 19/23 magazines.
- Patented proven push pin design.
- Super easy to attach and detach from the magazine.
- No specialty tools or devices required to disassemble.
- One piece design, no extra parts to possibly lose during disassembly.
- Fits the USPSA 140mm gauge.
- Ideal for full size magazines.
- Holds 17+1 rounds of 40S&W.
- Holds 20+1 rounds of 9mm.
- Easy to load into the gun with fully loaded magazine.
- Adds weight to magazine so mags drop free easier for faster reloads.
- Comes with ISMI +10% spring.
- CNC machined from billet aluminum.
- Hard Anodized.
- Used and endorsed by World and National Champions Bob Vogel, the Glock Shooting Team, Randi Rogers, Allie Barrett, and of course Taran Butler.
- Compatible with the Raven Concealment Freya Mag Well for Glock 19 pistols. Made in the USA. Basepad and Replacement Spring only. Magazine sold separately. This item cannot ship to California or outside the USA due to State law and ITAR.]]>1https://s.turbifycdn.com/aah/optacticalgear/taran-tactical-base-pad-kit-for-glock-19-4-5-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/taran-tactical-base-pad-kit-for-glock-19-4-5-r-60.jpgTaran Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/tti-firepower-base-pad-kit-for-glock-5-6-r-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/tti-firepower-base-pad-kit-for-glock-5-6-r-38.jpgcustom-itemoptacticalgear-pagemainco116GBP940-00S43.99Taran Tactical Firepower Base Pad Kit for Glock 17 +5/+6 (R)Taran Tactical111*Remove the plastic insert at the bottom before installation*
*Does not come with an allen key. The screws are set with Loctite to achieve a nice tension with the pin. If the pin is very loose use a 1/16 allen(hex) to tighten it.*
- Patented proven push pin design.
- Super easy to attach and detach from the magazine.
- No specialty tools or devices required to disassemble.
- One piece design, no extra parts to possibly lose during disassembly.
- Designed for Glock 17/22 Magazines.
- Fits the USPSA 140mm gauge.
- Ideal for full size magazines.
- Holds 20+1 rounds of 40S&W.
- Holds 23+1 rounds of 9mm.
- Easy to load into the gun with fully loaded magazine.
- Adds weight to magazine so mags drop free easier for faster reloads.
- Comes with ISMI +10% spring.
- CNC machined from billet aluminum.
- Hard Anodized.
- Used and endorsed by World and National Champions Bob Vogel, the Glock Shooting Team, Randi Rogers, Allie Barrett, and of course Taran Butler. Will NOT work with Glock 19 Mags. Other models are available for Glock 19 magazines. Made in the USA. Basepad and Replacement Spring only. Magazine sold separately. This item cannot ship to California or outside the USA due to State law and ITAR.]]>1https://s.turbifycdn.com/aah/optacticalgear/tti-firepower-base-pad-kit-for-glock-5-6-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/tti-firepower-base-pad-kit-for-glock-5-6-r-47.jpgTaran Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/targets-59.jpgcustom-itemoptacticalgear-pageweaponsTargets1irtounze25meirtoupthzetairtopaphirtopathrirtopagaropt3indottariinra25meze2riinra25meze1actab8tarefahitarefakizotarefaestarefaiqtademahashdevitatariinra91al25riinra25meze1https://s.turbifycdn.com/aah/optacticalgear/targets-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/targets-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-cam-fit-chinstrap-extender-12.jpgcustom-itemoptacticalgear-pagecbrngasmasks857-21-EXT13Team Wendy CAM FIT Chinstrap ExtenderTeam Wendy111• The CAM FIT™ chinstrap extender is ONLY compatible with Team Wendy’s CAM FIT™ Retention System and CAM FIT™ H-Back Retention System. It is not compatible with the Standard Chinstrap.
• Extends the CAM FIT™ Retention System by 4”.
• Commonly used by operators who need to extend the length of their chinstrap to accommodate a gas mask. This Item is Excluded from ALL Coupon Codes ]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-cam-fit-chinstrap-extender-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-cam-fit-chinstrap-extender-21.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-epic-air-combat-helmet-liner-system-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-epic-air-combat-helmet-liner-system-47.jpgcustom-itemoptacticalgear-pageachmiheandac8504137124.67Team Wendy EPIC AIR Combat Helmet Liner SystemTeam Wendy111Key Features
Provides the benefits of the EPIC™ system with additional air channels and a removable crown pad Compatible Helmets
ACH, LW-ACH, MICH, ECH, LWH,OpsCore FAST , Crye AirFrame™ Construction Materials
Zorbium® impact and comfort foams,milspec moisture wicking and loop fabric with antimicrobial comfort pads Headsize & Corresponding ACH Shell Size / Head Circumference (in)
Up to 22.5“ ACH Medium
22.5” - 23.5” ACH Large
Over 23.5” ACH X-Large Sizing Notes
More sizing flexibility is provided through comfort pad selection,therefore those at the border between sizes may be able to go up or down a size compared to standard ZAP™ Installation
Hook and Loop Performance / Blunt Impact Performance:
Exceeds the ACH blunt impact requirements (AR/PD 10-02) (Performance is based on testing in ACH shells. Results vary by shell type and manufacturer.) *Although Team Wendy's EPIC Air™ Combat Helmet Liner System exceeds blunt impact protection requirements of the Advanced Combat Helmet (AR/PD 10-02), the system is not currently authorized through first article testing for use in U.S. Military Advanced Combat Helmets or U.S. Marine Lightweight Helmets. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-epic-air-combat-helmet-liner-system-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-epic-air-combat-helmet-liner-system-60.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-epic-specialist-ballistic-helmet-high-cut-r-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-epic-specialist-ballistic-helmet-high-cut-r-12.jpgcustom-itemoptacticalgear-pageheac85-77-HH-2222211013001092Team Wendy EPIC Specialist Ballistic Helmet - High Cut (R)111litoteweepspUPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. Details
Fully outfitted to meet SWAT or riot team member demands.
Features Ceradyne seamless ballistic shell technology.
Substantially lighter than the ACH while meeting NIJ IIIA (NIJ STD 0106.01/0108.01).
Team Wendy’s CAM-FIT™ BOA Dial retention system quickly adjusts to individual head shapes for a custom fit.
EPIC Air® Fit liner system provides maximum comfort and meets ACH Gen II Blunt Impact (AR/PD 14-01) and AEP 2902 Clause 4.1.1.1 Method H.
Low profile, reverse dovetail accessory rails compatible with common helmet accessories.
Durable aluminum shroud interfaces with Wilcox lanyards and most standardized NVG mount baseplates.
Includes shock cord kit for increased stability of night vision devices.
*Ceradyne seamless ballistic shell technology incorporates a proprietary Thermoplastic composites forming/molding process and no-hole-through design. Features:
Durable Aluminum NVG Shroud
• No Thru-Hole Attachment (No drilled holes through shell for attachment)
• Machined aluminum plate, anodized for color
• Compatible with most standardized NVG mount baseplates
• Wilcox lanyard compatibility
• Shock cord attachment Ceradyne Seamless Ballistic Shell Technology
• Proprietary thermoplastic composites forming/molding process
• Ultra-high molecular weight polyethylene fiber composites, 33% lighter than Aramid material
• High strength/low-density combination fiber offers maximum strength-to-weight ratio
• Complete no thru-hole technology​ provides increased ballistic performance EPIC Air® Fit Liner System
• Utilizes Team Wendy’s proven Zorbium® foam technology
• Designed to accommodate communication headset integration
• Proprietary water-resistant film and loop fabric covering
• Meets ACH Gen II Blunt Impact (AR/PD 14-01) No Thru-Hole CAM FIT™ Retention System
• BOA® fit system with micro-adjustable dial
• Utilizes Cam Lock sliders for one-handed adjustment and secure fit
• Asymmetric design keeps buckle tucked smoothly along jaw line
• Chin cup lining ensures maximum comfort and chafe-free wear
• Custom clip system attachment (no-thru holes)​ Reverse Dovetail Accessory Rails
• No Thru-Hole Attachment (No drilled holes through shell for attachment)
• Integrated low profile reverse dove-tail mounting system
• Compatible with common helmet accessories and optional removable picatinny adapter
• Provides counterweight attachment options
• Accommodates optional shock cord system for increased stability of Night Vision Devices Performance
Ballistic Performance: NIJ IIIA (NIJ STD 0106.01/0108.01)
Fragment Performance: 17gr V50 ≥ 2560 ft/s (780 m/s)
Backface Deformation: 9mm BFD ≤ 25.4 mm
Blunt Impact Performance: Meets ACH Gen II Blunt Impact (AR/PD 14-01) and AEP 2902 Clause 4.1.1.1 Method H Weight: High-Cut *Weights (lbs) +/- 3%
Size Complete System Shell
Small 2.64 lbs (1.15 kg) 1.84 lbs (0.84 kg)
Medium 2.7 lbs (1.17 kg) 1.9 lbs (0.86 kg)
Large 2.82 lbs (1.23 kg) 2.01 lbs (0.91 kg)
XL 3.08 lbs (1.35 kg) 2.26 lbs (1.02 kg) Shell weight includes edge trim & paint. Complete system weight includes helmet shell, shroud, rails, impact liner and retention system. O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. There are no returns or exchanges on body armor items. Please be sure of your size before ordering. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order.]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-epic-specialist-ballistic-helmet-high-cut-r-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-epic-specialist-ballistic-helmet-high-cut-r-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-esapi-non-ballistic-training-plates-pair-30.jpgcustom-itemoptacticalgear-pagecaac18591-C1150136.5Team Wendy ESAPI Non-Ballistic Training Plates (PAIR)Team Wendy111UPS SHIPPING OPTIONS ONLY. No $5 Flat Rate for this item (due to the weight/shape of the item). ESAPI Non-Ballistic Training Plates from Team Wendy® allow you to train like you fight without risk to life-saving ballistic body armor. The training plates are made from virtually indestructible, density-modifiable, cross-linked polyurethane that will not crack or break when hit, dropped or impacted. Designed to replicate the weight, shape, curvature and thickness of actual ballistic plates, they are stiff enough to hold their shape, yet flexible enough to easily insert into any carrier. 8.75” x 11.75” 5 lbs each (pair weights 10 lbs) Multi-curve shape Pair of two Due to package bulk this item may incur additional shipping charges These Plate are NOT ballistic rated. UPS SHIPPING OPTIONS ONLY. No $5 Flat Rate for this item (due to the weight/shape of the item). This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-esapi-non-ballistic-training-plates-pair-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-esapi-non-ballistic-training-plates-pair-40.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ballistic-and-sl-rail-3-0-helmet-cover-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ballistic-and-sl-rail-3-0-helmet-cover-47.jpgcustom-itemoptacticalgear-pageteweheandpa8576-MHC3115104.65Team Wendy EXFIL Ballistic and SL Rail 3.0 Helmet CoverTeam Wendy111Features: Designed for use with Team Wendy's EXFIL® Ballistic or EXFIL® Ballistic SL with the EXFIL® Rail 3.0 only
• Material: Nylon/spandex stretch fabric across the top, polyester mesh sides
• Easy installation and removal via hook/loop attachment allows rapid change of helmet pattern, no tools required
• Close fitting cover creates a secure fit to the shell that also protects the helmet finish
• Loop patches on the cover attach gear or patches to the outside of the helmet and feature slots to provide better cable management
• Made in USA, Berry Compliant This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ballistic-and-sl-rail-3-0-helmet-cover-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ballistic-and-sl-rail-3-0-helmet-cover-60.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ballistic-helmet-with-rail-2-0-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ballistic-helmet-with-rail-2-0-r-58.jpgcustom-itemoptacticalgear-pageteweheandpa857317251449Team Wendy Exfil Ballistic Helmet with Rail 3.0 (R)Team Wendy111UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. The EXFIL® Ballistic features a hybrid composite shell for increased strength with a unique geometry for optimal fit. An innovative, boltless CAM FIT™ retention quickly adjusts to individual head shapes, providing a comfortable and stable fit. A Zorbium® foam liner protects against impact and allows for an overhead communications headband. Customizable fit is achieved through a set of moveable comfort pads. A lanyard compatible Wilcox® shroud secures any standard NVG mount. The EXFIL® Rail 3.0 accessory mounting system is compatible with EXFIL® accessories. Shell Technology
• Proprietary Hybrid Composite Shell Weight - helmet shell, shroud, accessory rails, impact liner and retention system
• 2.6 lbs (1.18kg) size 1
• 2.75 lbs (1.25kg) size 2 Performance
• Ballistic Performance: NIJ Level IIIA (according to NIJ STD 0106.01 / 0108.01).
• Fragment Performance: 17gr V50 ≥ 2400 ft/sec (731 m/s).
• Backface Deformation: 9mm (1400fps)
• BFD: <25mm all locations (front/back/crown/sides) exposed to high temp/humidity, solar, low temperature, altitude, sea water, and salt fog.
• Blunt Impact Performance: Exceeds current ACH Blunt Impact Protection requirements (per AR/PD 10-02). Liner System
• Zorbium® foam liner with 16 customizable comfort pads in two thicknesses. Retention System
• Boltless CAM FIT™ Retention System featuring a BOA® Fit System for optimized stability and fit.
• Right-Eye-Dominant Chin Strap Shroud
• Lanyard compatible 3-hole Wilcox® W shroud. Rail 3.0 System
• Compatible with all standard EXFIL® accessories
• Includes two Magpul® MOE® picatinny style rails and mounting hardware
• Allows installation of the EXFIL® Ballistic Visor and the EXFIL® Face Shield
• Includes shock cord kit for stabilizing NVG Sizing: Thin and Thick Pads included to help adjust sizing slightly for best fit
• Size 1 (M/L): Head Circumference 20.5 - 23.5 Inches, 6 5/8 - 7 1/2 Hat Size
• Size 2 (XL): Head Circumference 23 - 24.75 Inches, 7 3/8 - 7 7/8 Hat Size O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. There are no returns or exchanges on body armor items. Please be sure of your size before ordering. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ballistic-helmet-with-rail-2-0-r-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ballistic-helmet-with-rail-2-0-r-68.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-counterweight-kit-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-counterweight-kit-47.jpgcustom-itemoptacticalgear-pageteweheandpa8570CWK112101.92Team Wendy EXFIL Counterweight KitTeam Wendy111Customizable kit available in two sizes:
Small- adustable up to 0.75lbs. using (3) 0.25lb. weights
Large- adjustable up to 1.5lbs. using (3) 0.5lb. weights Includes fully coated lead weights This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-counterweight-kit-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-counterweight-kit-60.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ltp-rail-3-0-helmet-cover-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ltp-rail-3-0-helmet-cover-47.jpgcustom-itemoptacticalgear-pageteweheandpa8571-MHC3115104.65Team Wendy EXFIL LTP Rail 3.0 Helmet CoverTeam Wendy111Features:
• Designed for use with Team Wendy's EXFIL® LTP helmet with Carbon/LTP Rail 3.0
• Material: Nylon/spandex stretch fabric across the top, polyester mesh sides
• Easy installation and removal via hook/loop attachment allows rapid change of helmet pattern, no tools required
• Close fitting cover creates a secure fit to the shell that also protects the helmet finish
• Loop patches on the cover attach gear or patches to the outside of the helmet and feature slots to provide better cable management
• Made in the USA, Berry Compliant This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ltp-rail-3-0-helmet-cover-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ltp-rail-3-0-helmet-cover-60.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ltp-with-rail-2-0-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ltp-with-rail-2-0-45.jpgcustom-itemoptacticalgear-pageteweheandpa8572480403.2Team Wendy Exfil LTP with Rail 3.0Team Wendy111Shell Technology
• Polycarbonate Copolymer Shell Weight: helmet shell, shroud, accessory rails, impact liner and retention system
• Both sizes weigh 1.59 lbs (.72kg). Performance
• Meets shock absorption requirements of BS EN 1385:2012 (Whitewater). Liner System
• Zorbium® Foam Liner features moisture wicking fabric and includes six adjustable comfort pads. Retention System
• Boltless CAM FIT™ Retention System featuring a BOA® Fit System for optimized stability and fit.
• Right-Eye-Dominant Chin Strap Shroud
• Integrated Wilcox® machined aluminum mounting plate for NVG mounts. 3.0 Rail System
• Compatible with all standard EXFIL® accessories
• Includes two Magpul® MOE® picatinny style rails and mounting hardware
• Allows installation of the EXFIL® Ballistic Visor and the EXFIL® Face Shield (Sold Separately)
• Includes shock cord kit for stabilizing NVG Sizing: Thin and Thick Pads included to help adjust sizing slightly for best fit
• Size 1 (M/L): Head Circumference 20.5 - 23.5 Inches, 6 5/8 - 7 1/2 Hat Size
• Size 2 (XL): Head Circumference 23 - 24.75 Inches, 7 3/8 - 7 7/8 Hat Size This Helmet is only bump/impact rated; it is NOT ballistic rated. There are no returns or exchanges on helmets. Please be sure of your size before ordering. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ltp-with-rail-2-0-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-ltp-with-rail-2-0-55.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-peltor-quick-release-adapter-back-plate-set-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-peltor-quick-release-adapter-back-plate-set-45.jpgcustom-itemoptacticalgear-pageteweheandpa8580-CAK-BP29Team Wendy EXFIL Peltor Quick Release Adapter Back Plate SetTeam Wendy111Back Plates Only. Peltor Adapter Set Sold Separately. Please note that the back plates do not come threaded. Reserve the Plastite® thread-rolling screw in your current Peltor™ adapter’s hardware to self-thread it into the new back plate. We recommend using a manual screwdriver while self-threading the back plate to avoid over-tightening the screw, which can strip the created threads. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-peltor-quick-release-adapter-back-plate-set-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-peltor-quick-release-adapter-back-plate-set-58.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-peltor-headset-adapter-kit-for-rail-2-0-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-peltor-headset-adapter-kit-for-rail-2-0-42.jpgcustom-itemoptacticalgear-pageteweheandpa8580CAKBK120109.2Team Wendy EXFIL Peltor Quick Release AdaptersTeam Wendy111• Works with all Peltor™ COMTAC systems and a variety of other brands and models
• Eliminates rigid metal headband providing better fit and comfort
• Tool-free attachment directly to the quick release slot on the EXFIL® Rail 2.0, EXFIL® Rail 3.0, EXFIL® SAR Rail and M-216™ Rail Systems
• Open and closed positions allow quick donning and doffing of helmet
• Wiring is easily routed in or outside the helmet shell
• Kit includes one boom microphone adapter This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-peltor-headset-adapter-kit-for-rail-2-0-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-exfil-peltor-headset-adapter-kit-for-rail-2-0-52.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-helmets-and-parts-53.jpgcustom-itemoptacticalgear-pageheac1teweexbahewiteweexltpwiragteweexbaheteweexcokituntapladfortuntama20ampteweexpeheadteweexpequreuntamakitteweexbaandsteweexltpra3teweepaircohtewecamfitchtewerarigsyteweesnotrpltewetrpabymyuntasasoad1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-helmets-and-parts-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-helmets-and-parts-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-radio-rig-system-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-radio-rig-system-47.jpgcustom-itemoptacticalgear-pagevests8523C4ABK2190172.9Team Wendy Radio Rig SystemTeam Wendy111This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-radio-rig-system-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-radio-rig-system-60.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-transit-pack-by-mystery-ranch-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-transit-pack-by-mystery-ranch-57.jpgcustom-itemoptacticalgear-pageebba8570-MRC260236.6Team Wendy Transit Pack by Mystery Ranch - Current GenTeam Wendy111• Shoulder straps
• Bag handles on top and side for hand-carry
• MOLLE-compatible webbing on the back for attachment to MOLLE panels on other packs or gear The clamshell opening gives access to the entire contents and creates two useable surfaces for kit layout. The interior flap has VELCRO loop for spare patches and loop-mounted accessories. MOLLE-compatible webbing on the top of the pack offers additional accessory or gear attachment. The pack contains three moveable internal pouches that can be placed anywhere in the bag:
• A zippered pocket on each side for accessories such as strobes, goggles, glasses, etc.
• One removable draw cord bag for NVGs or headset, perfect for storing under the helmet. UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item (due to the size of item). This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/team-wendy-transit-pack-by-mystery-ranch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/team-wendy-transit-pack-by-mystery-ranch-67.jpgTeam Wendyhttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4403.jpglink.redwingt50taa1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4203.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4204.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4404.jpglink.kere50taa1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4217.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4218.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4412.jpglink.mateblfrpobr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4223.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4224.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4411.jpglink.marablfrpobr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4201.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4202.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4413.jpglink.kefa401https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4215.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4216.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4406.jpglink.zevopmabag341https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4221.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4222.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-for-more-information-go-to-for-more-information-click-here-51.jpglink.zevz19dustsl1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-for-more-information-go-to-for-more-information-click-here-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-for-more-information-go-to-for-more-information-click-here-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4405.jpglink.maexblfrpogr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4211.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4212.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4401.jpglink.kere30taa1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4199.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4200.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4407.jpglink.marafdefrpog1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4205.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4206.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4410.jpglink.maexblfrpobr1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4213.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4214.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4408.jpglink.keltyslingbag1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4207.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4208.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4409.jpglink.maexblfrpobr11https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4209.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4210.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-for-more-information-go-to-for-more-information-click-here-50.jpglink.zevopmabag191https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-for-more-information-go-to-for-more-information-click-here-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-for-more-information-go-to-for-more-information-click-here-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-for-more-information-click-here-12.jpglink.zevopmabag1911https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-for-more-information-click-here-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-for-more-information-click-here-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem2-307.jpglink.zevopmabag1921https://s.turbifycdn.com/aah/optacticalgear/newitem2-291.jpghttps://s.turbifycdn.com/aah/optacticalgear/newitem2-292.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4402.jpglink.zevopmabathp1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4219.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4220.jpghttps://s.turbifycdn.com/aah/optacticalgear/thyf-gmp-gas-mask-pouch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/thyf-gmp-gas-mask-pouch-47.jpgcustom-itemoptacticalgear-pagecbrngasmasksXXGMP-XXX95Thyf GMP Gas Mask PouchTHYF111Pouch Sizing:
• Regular: sized to fit Avon C50/M50, FM12, and most Mira Safety masks. Will fit with VPU and filter attached.
• XL: sized to fit Avon FM53/54 and Airboss LBM. Will fit with VPU and filter attached. Waist Strap Sizing: one size fits all. The webbing can be adjusted from 20"-60". To be honest, if you can't fit this thing around your waist, you shouldn't be carrying a gas mask for a living. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/thyf-gmp-gas-mask-pouch-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/thyf-gmp-gas-mask-pouch-60.jpgTHYFhttps://s.turbifycdn.com/aah/optacticalgear/tick-key-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/tick-key-52.jpgitem.optacticalgear-pagesukiandto263709959.996.99Tick KeyTick Key111Colors Vary; if you have a preference specify on checkout, however, be prepared to receive whatever we may have on hand]]>1https://s.turbifycdn.com/aah/optacticalgear/tick-key-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/tick-key-66.jpgTick Keyhttps://s.turbifycdn.com/aah/optacticalgear/titan-tactical-elastic-tourniquet-holder-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/titan-tactical-elastic-tourniquet-holder-60.jpgcustom-itemoptacticalgear-pageinmedpoipo135ETH18.9516.95Titan Elastic Tourniquet HolderTitan Tactical111-Lightweight
-Secure elastic retention
-Low profile
- Slim profile Velcro hook mounting surface, No MOLLE used to mount
-Seamless plate carrier integration
-Placeable in three positions
-Ambidextrous
-Compatible with both CAT and SOF-T WIDE Gen3 tourniquets Made in the USA. One Elastic Tourniquet Holder only. All other items sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/titan-tactical-elastic-tourniquet-holder-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/titan-tactical-elastic-tourniquet-holder-73.jpgTitan Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/tnvc-mohawk-mk1-gen-2-counterweight-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/tnvc-mohawk-mk1-gen-2-counterweight-45.jpgcustom-itemoptacticalgear-pageheacandweXXTNVC-MHK1-G289TNVC Mohawk MK1 Gen 2 CounterweightTNVC111• Lighter Weight 500D Cordura Nylon construction
• Pattern-matched loop fastener in ALL patterns
• Cord Lock Retainer
• Longer loops for comms cable retention
• 100% Berry Compliant, Made in the USA BENEFITS
Signal Strobe Attachment & Retention A vertically-oriented Mohawk strip is the centerpiece of the design. It features a Velcro pile surface that accepts attachment of all currently issued / fielded signal strobe devices. The continuous pile strip allows for precise placement of the device on the rear or top of the helmet. It also provides enough room for attaching a blast sensor device. An adjustable shock cord net provides secondary retention for the devices while not limiting access to their controls. This is important when performing high stress activities such as airborne operations and high angle work. Don’t wear a strobe light? No problem. The shock cord net provides excellent storage for a tourniquet – Easily accessible and always handy. Versatile Storage Compartment An ambidextrous access, low profile storage compartment helps solve the classic counterweight argument. Some argue that any added weight should be comprised of useful mission essential gear. Others argue that once operators begin using said mission essential gear, they end up losing the counterweight and defeating the purpose. Counterweights have historically been designed for one side or the other. But, why can’t the operator have both? Now they can. The main storage compartment features two elastic pockets that hold removable, flexible lead weight strips (4 strips are included) for 1 pound of counterweight. The rest of the compartment is occupied by a removable battery organizer tray that holds up to 6 cells. Operators can choose to run just the weights, just the batteries, or both. But that’s not all! when the weights and battery tray are removed, the Mohawk storage compartment will perfectly fit the low profile “summer” battery box for the GPNVG-18. Ready Access Batteries Two elastic loops sit atop the main compartment, providing immediate access battery storage. These loops allow operators to grab two batteries without ripping Velcro. They also provide secondary functionality by holding a chemlight for nighttime airborne operations or field ID while hunting. Headset Cable Management The Mohawk MK1 Gen. 2 has two bottom-located Velcro strips for bundling and storing communication headset cable. This extremely useful feature solves one of the most annoying issues facing operators. The headset cable that plugs into your body-mounted PTT is often left dangling to snag on everything during training or storage of the helmet. Or if you have dual comms (one for team radio and one to plug into the vehicle radio), one of the cables will be left to dangle when you dismount the vehicle. The Mohawk MK1 Gen. 2 cable storage straps will stow those pesky cables, protecting them and giving you freedom of head movement. Secondary Retention The Mohawk MK1 Gen. 2 features two loops for routing 550 or shock cord on either side. This is for secondary retention of the entire system during high intensity activities. Velcro does not provide 100% retention on a helmet. The Mohawk MK1 Gen. 2 provides the opportunity for the operator to run cord from the system to the rear helmet bolts or rail. Doing so will keep your Mohawk MK1 Gen. 2 securely in place regardless of battlefield conditions. User Feedback Generated Gen. 2 Features Lighter weight 500D Cordura Nylon material compared to the 1000D Gen. 1 versions, color and pattern matched Velcro pile on all versions, improved cable retention for helmet mounted comms, and a built-in cord lock retainer to keep the bungee retainer from hanging loose. The TNVC Mohawk MK1 Gen. 2 is the most feature-rich helmet accessory system available. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/tnvc-mohawk-mk1-gen-2-counterweight-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/tnvc-mohawk-mk1-gen-2-counterweight-58.jpgTNVChttps://s.turbifycdn.com/aah/optacticalgear/tnvc-nvg-pouch-padded-expandable-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/tnvc-nvg-pouch-padded-expandable-44.jpgcustom-itemoptacticalgear-pagenvgmosoXXTNVC-OE-NVP65TNVC NVG Pouch - Padded ExpandableTNVC111POUCH ONLY – Helmet, Patch & Contents Not Included The TNVC NVG Pouch, Padded Expandable (NVG-PPE) is a new solution to an old problem–a modern, practical, and useful update to the classic green “lunch sack” NVG Carrying Case, and designed in-house at TNVC. One of the most common yet baffling accessories usually included with night vision devices is green soft case, issued by the thousands with USGI AN/PVS-14s and often provided with many night vision systems. While the “lunch sack” undoubtedly does in fact do its job of carrying night vision devices, it doesn’t really do much to protect the device or keep the contents of the case and basic issue items (BII) organized–as a storage, shipping, and carrying case, it leaves a great deal to be desired, causing many users to seek alternative solutions. In our continuing efforts to improve not only existing products, but their accessories, we decided to take another look at the NVG carrying case and re-design it from the ground up. In examining other solutions and alternatives on the market, we found that carrying cases and pouches tended to come in either one of two main categories: Hard-sided cases of varying quality that were primarily designed for shipping and administrative storage, but were often far larger than they had to be and not very useful in the field Too small and/or overtly specific in and that they either only fit a single device or type of device, but none of the common accessories or BII that some users might want to keep with their NVGs, or that would only support one specific application/method of carry Moreover, in many cases, NVG-specific storage and carrying solutions tended to be surprisingly expensive for what they are. The TNVC NVG Pouch, Padded Expandable was designed to not only be a useful OEM carrying case solution for shipping and storage of TNV NVG systems, but also to an adaptable and practical NVG pouch that could realistically be used in the field by a wide range of end-users with a wide variety of units, accessories, and configurations at a lower cost than many other NVG-specific case/carrying options. The TNVC NVG-PPE has multiple zipper-secured compartments with multiple ways to access them, allowing you to not only securely carry and transport your single or dual tube night vision device, but any accessories you might need as well. The main pocket can support a dual tube night vision device with an ECOTI, or even dual PVS-14s and a FLIR Breach, while the secondary compartment can hold ancillary equipment and can be accessed either from the main compartment or from the outside. The NVG-PPE also has a large Velcro loop panel on the lid, allowing ID/Callsign patches or placards to be placed on the pouch to identify individual pouches, as well as a rapid closure/compression/cinch strap with a Fastex buckle The secondary compartment is also expandable with zippered 4-way stretch Tweave material, allowing you to securely carry small accessories such as spare batteries, cleaning supplies, etc., with the compartment collapsed, or larger items such as mounts, external battery packs, or any other equipment that you may want to keep with your night vision device when expanded. The soft-sided pouch is also sized so that it can be carried inside of a helmet for extra protection and to keep your gear together. While we do not recommend attaching the TNVC NVG-PPE to individually worn first or second-line load-carrying gear, the NVG-PPE also has PALS webbing and is supplied with MALICE clips that offer a wide variety of options for mounting the pouch to MOLLE platforms like seat cover panels, range bags, or packs. The TNVC NVG-PPE pouch isn’t designed to be the be-all, end-all of night vision cases, but rather to be a value-added alternative to some of the more useless alternatives that come with many night vision devices—even if you don’t use it for your night vision, it’s a highly adaptable general purpose pouch that gives you a lot of options for different mission essential gear that provides some protection for the contents, but is not overly bulky or difficult to transport.]]>1https://s.turbifycdn.com/aah/optacticalgear/tnvc-nvg-pouch-padded-expandable-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/tnvc-nvg-pouch-padded-expandable-58.jpgTNVChttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-crosswind-jacket-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-crosswind-jacket-18.jpgcustom-itemoptacticalgear-pagejaveswXX-L400405200Tomahawk Performance Crosswind JacketTomahawk Performance111Low profile, quiet, featherweight and packable wind layer jacket that provides protection from inclement weather. FIT
Snug fit to accomodate a light mid-layer DESIGN
Wind resistant 4-way stretch material with DWR treatment to protect from precipitation. Low profile hood storage and adjustable soft hood brim allow for helmet range of movement. PRODUCT FEATURES
• Stows in own integrated stuff pouch
• Helmet compatible with soft hood brim and adjustable hood drawcords
• Low profile hood storage that doesn’t interfere with helmet range of movement
• Full front zip with storm flap
• Dropped back seat with routed hem drawcords for additional wind protection and coverage
• Laminated die-cut cuff
• Chest stow pocket with attachment point
• 200g / 6.9oz (L) PRINCIPAL MATERIALS
• 20D Nylon 4-Way Stretch 53 GSM with DWR]]>1https://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-crosswind-jacket-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-crosswind-jacket-30.jpgTomahawk Performancehttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-instructor-jacket-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-instructor-jacket-21.jpgcustom-itemoptacticalgear-pageinoulal7XX-L500500375Tomahawk Performance Instructor JacketTomahawk Performance111A tough, breathable and weather shedding insulated softshell jacket that can also be worn as a mid-layer in conjunction with a layering system. FIT
Limited bulk with athletic fit block DESIGN
For extended days on the range in colder temperatures, the Instructor Jacket provides the right amount of warmth while protecting from the elements. Dynamic drills mean high-energy output - it’s built to effectively vent heat and minimize moisture built up. The stretch woven face fabric can withstand the abuse from hard training. PRODUCT FEATURES
• Dropped back seat with routed hem drawcords for additional wind protection and coverage
• Adjustable helmet compatible hood
• Tappered insulation allowing for donning under duty belt
• Full zip opening with weather backflap
• Zippered Bicep pockets with integrated stash pockets
• 4”x4.5” velcro for IFF
• Zippered hand warmer pockets
• Internal zippered stash pocket
• Laser perforated lining to vent heat
• Weight: 82g / 31.5oz (L) PRINCIPAL MATERIALS
• Self: 70/40D Nylon Spandex 4-Way Stretch 321 GSM with DWR
• Insulation: Primaloft® Silver 60 GSM
• Lining: 20D Nylon 4-Way Stretch 53 GSM]]>1https://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-instructor-jacket-32.jpghttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-instructor-jacket-33.jpgTomahawk Performancehttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-overlayer-anorak-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-overlayer-anorak-12.jpgcustom-itemoptacticalgear-pagejaveswXX-86861260Tomahawk Performance Overlayer Anorak111Compactible and lightweight to fit in stuff sack Helmet compatible with soft hood brim and adjustable hood drawcords Adjustable wrist to seal out elements Reverse U-Zip to access chest rig or cold weather layer Dropped back seat with drawcords for additional wind protection and coverage when on snowmobiles. Vertical bicep zippered opening for access to lower layered clothing 1/3 zip chest opening and side zipper for ease of donning and doffing Laser perforated back panel ventilation Patterned to fit with cold weather layer FIT
Adjusted fit over cold weather layering system PRINCIPAL MATERIALS
Face Fabric: 20D Nylon 4-Way Stretch 53 GSM with DWR SPECIFICATIONS
Weight: 7.42 oz Trade: Trade Agreement Act Compliant]]>1https://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-overlayer-anorak-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-overlayer-anorak-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-overlayer-pant-8.jpgcustom-itemoptacticalgear-pagejaveswXX-86862240Tomahawk Performance Overlayer Pant111Wind-blocking, light 4-way stretch over garment with laser perforated panels to vent heat during dynamic movements in arctic/subarctic conditions. Compactable and light weight to fit in stuff sack Adjustable belt with securing buckle designed for use with cold weather gloves Zippered pass-through pocket access to lower levels, including outer leg cargo pockets No exposed loops on zippers 4-way stretch with DWR overlayer Laser perforated heat ventilation just below belt line Lower leg zipper opening for ease of donning and doffing FIT
Patterned to fit cold weather layering system with added room in legs, groin and seat PRINCIPAL MATERIALS
Face Fabric: 20D Nylon 4-Way Stretch 53 GSM with DWR SPECIFICATIONS
Weight: 6.12 oz Trade: Trade Agreement Act Compliant]]>1https://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-overlayer-pant-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/tomahawk-performance-overlayer-pant-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/armorer-s-tools-46.jpgitem.optacticalgear-pageveir55haTools1krrecatoforskrdegrsualrofixitstwofixitstar15mfixitstaltodfixitst65452fixitstaltod1fixitstgltoksunandshtrtamuna2munatomutwnoname1maarwrarrfixitstscjaardeopleco1https://s.turbifycdn.com/aah/optacticalgear/armorer-s-tools-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/armorer-s-tools-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/tough-hook-hanger-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/tough-hook-hanger-57.jpgcustom-itemoptacticalgear-pagefigemi147TH19.9516.95Tough Hook Hanger Tough Hook111
If for any reason you are ever dissatisfied with the product Tough Hook Brand will refund your purchase.
Photos courtesy of ITS and Tough Hook UPS SHIPPING OPTIONS ONLY. No $5 Flat Rate for this item (due to the size of item).]]>1https://s.turbifycdn.com/aah/optacticalgear/tough-hook-hanger-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/tough-hook-hanger-69.jpgTough Hookhttps://s.turbifycdn.com/aah/optacticalgear/tough-hook-hanger-xl-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/tough-hook-hanger-xl-46.jpgcustom-itemoptacticalgear-pagefigemi147THXL16.9514.95Tough Hook Hanger XLTough Hook111Features:
- Durable, heavy-duty design
- Large, full-shoulder area for stability
- Built-in carry handle for easy transportation of heavy equipment
- I-beam construction and impact-resistant resin
- Up to 150lb load capacity
- Proudly manufactured in the USA
- Backed with a 100% lifetime warranty UPS SHIPPING OPTIONS ONLY. No $5 Flat Rate for this item (due to the size of item).]]>1https://s.turbifycdn.com/aah/optacticalgear/tough-hook-hanger-xl-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/tough-hook-hanger-xl-58.jpgTough Hookhttps://s.turbifycdn.com/aah/optacticalgear/tourniquets-and-accessories-53.jpgitem.optacticalgear-pagemesuhyTourniquets and Accessories1nargen7coaptsoeabemotohosoeabmv3tacmedsosototitaeltohonarcuchoelel10sositqpoel10ritqcahojtsomotopoblfogehanarctohonarrigen7catsotocoavsooctacattrtohmsmshpoplmatoreblfogetonost1https://s.turbifycdn.com/aah/optacticalgear/tourniquets-and-accessories-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/tourniquets-and-accessories-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/trident-concepts-tacost-pistol-1-21.jpgcustom-itemoptacticalgear-pageweapons133TACOSTP19.99Trident Concepts TACOST Training Card Set - Pistol 1Trident Concepts111• Four different training groups
• Thirteen training sessions per group
• Safety and evolution briefs
• Easy to follow training instructions
• Clearly defined objectives and scoring
• Suggested tracking protocol
• Portable, rugged and convenient Training program is broken down into four different groups:
• Marksmanship (Hearts) groups will focus on the principle understanding of marksmanship skills. The drills vary from extreme distance, to extremely small targets and various drills in between.
• Speed (Spades) groups will focus on pushing the boundaries of speed safely while at the same time maintaining a minimum hit ratio. The drills vary in number of rounds fired, positions and added complexities such as manipulations.
• Baseline (Clubs) groups will focus on establishing performance in a predefined series of drills. These baselines will set the tone for the rest of the groups and chart progress over time.
• Dry fire (Diamonds) groups will combine both dry fire and at times live fire to increase the number of correct repetitions. Practicing to ensure that movements are smooth and precise. TRICON the driving force in combat performance.]]>1https://s.turbifycdn.com/aah/optacticalgear/trident-concepts-tacost-pistol-1-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/trident-concepts-tacost-pistol-1-28.jpgTrident Conceptshttps://s.turbifycdn.com/aah/optacticalgear/trident-concepts-tacost-training-card-set-rifle-1-29.jpgcustom-itemoptacticalgear-pageweapons133TACOSTR19.99Trident Concepts TACOST Training Card Set - Rifle 1Trident Concepts111• Four different training groups
• Thirteen training sessions per group
• Safety and evolution briefs
• Easy to follow training instructions
• Clearly defined objectives and scoring
• Suggested tracking protocol
• Portable, rugged and convenient Training program is broken down into four different groups: • Marksmanship (Spades) groups will focus on the principle understanding of marksmanship skills. The drills vary from extreme distance, to extremely small targets and various drills in between.
• Speed (Hearts) groups will focus on pushing the boundaries of speed safely while at the same time maintaining a minimum hit ratio. The drills vary in number of rounds fired, positions and added complexities such as manipulations.
• Dry fire (Diamonds) groups will combine both dry fire and at times live fire to increase the number of correct repetitions. Practicing to ensure that movements are smooth and precise.
• Baseline (Clubs) groups will focus on establishing performance in a predefined series of drills. These baselines will set the tone for the rest of the groups and chart progress over time. TRICON the driving force in combat performance.]]>1https://s.turbifycdn.com/aah/optacticalgear/trident-concepts-tacost-training-card-set-rifle-1-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/trident-concepts-tacost-training-card-set-rifle-1-39.jpgTrident Conceptshttps://s.turbifycdn.com/aah/optacticalgear/trijicon-rmr-hd-reflex-sight-3-25moa-dot-r-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/trijicon-rmr-hd-reflex-sight-3-25moa-dot-r-17.jpgcustom-itemoptacticalgear-pagemrmireddotsi43TRRMHD2-C849685Trijicon RMR HD Reflex Sight - 3.25MOA Dot (R)Trijicon111This is the 3.25MOA Dot reticle model of the Trijicon RMR HD The Trijicon RMR® HD is an innovative red dot pistol optic specifically designed for the evolving needs of Law Enforcement and the Military. Built on the foundation of the Trijicon RMR® Adjustable LED model, the RMR HD features the same patented housing shape made from forged aluminum, robust electronic system, and quality lenses. Adding a long-lasting, top-loading battery, larger window, an innovative forward looking light sensor, multiple reticle options, market leading illumination adjustability, and it’s clear the RMR HD is designed and built for duty use. The innovative forward looking light sensor gauges the brightness at target in auto mode and adjusts reticle brightness to be effective in any lighting scenario. A new reticle allows you to switch between a complex reticle or single crisp dot, both of which include a new super bright setting and an additional night vision setting. The RMR HD also allows the operator to adjust the Auto Illumination as well as the dot/circle contrast. Additional features include larger, more tactile buttons, new adjusters with greater audible and tactile feedback, and an expanded field of view. Offering the same footprint as the RMR and designed to fit most existing optics-ready duty holsters*, the Trijicon RMR HD is ready for those needing a feature-rich optic with high performance and ultra-reliability. Features
• 55 MOA Segmented Circle with 3.25 MOA Dot
• Adjustable Red LED
• Forward Facing Light Sensor
• 4 Year Continuous Use at Brightness 5
• 9 Brightness Settings
• Night Vision Compatible
• Aluminum Housing
• Top Load Battery DETAILS
• TOP-LOADING BATTERY: Battery changes are easy, with no need to dismount the optic; Uses common CR2032 battery with up to 3 years of battery life.
• UPGRADED WINDAGE AND ELEVATION ADJUSTERS: More tactile and audible clicks for tool-less zeroing.
• RUGGED, DURABLE CONSTRUCTION: 7075-T6 forged aluminum housing; waterproof up to 66 ft. (20 m).
• LARGE, UNOBSTRUCTED FIELD OF VIEW: Find the reticle with ease; parallax free.
• RELIABILITY FOR EVERYDAY CARRY: Unique shape diverts impact force to protect lens from drops and bumps.
• COMPLETE USER CONTROL ILLUMINATION SETTINGS: Nine brightness settings with multiple modes for excellent visibility in any lighting condition.
• CLEAR TARGET VISIBILITY: Advanced lens technology provides crisp field of view.
• IDENTICAL FOOTPRINT AS RMR: Mounts easily on popular red-dot-ready pistols using the same base as Trijicon RMR
• IMPROVED CONTROLS: More tactile and audible controls provide positive feedback when used with duty gloves.
• INDEX RIDGE ALIGNMENT AID: Unique housing design provides built-in index point for fast sight picture acquisition even from atypical positions.
• BUTTON LOCK-OUT MODE: Secures the Auto-Brightness Setting which is Ideal for Everyday Carry
• MANUAL BRIGHTNESS LOCK-IN MODE: Secures the User-Chosen Brightness Setting Indefinitely
• BRIGHTNESS RESPONSE SETTING: Choose amongst Normal Auto (default), High Auto, and Low Auto adjust settings
• FORWARD MOUNTED LIGHT SENSOR: Enables the RMR HD Automatic Brightness mode to read the lighting conditions at the target, rather than just at the user. This is the 3.25MOA Dot reticle model of the Trijicon RMR HD This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/trijicon-rmr-hd-reflex-sight-3-25moa-dot-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/trijicon-rmr-hd-reflex-sight-3-25moa-dot-r-30.jpgTrijiconhttps://s.turbifycdn.com/aah/optacticalgear/trijicon-rmr-3-25-moa-adjustable-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/trijicon-rmr-3-25-moa-adjustable-r-47.jpgcustom-itemoptacticalgear-pagemrmireddotsi43TJRM06708539.99Trijicon RMR Type 2 - 3.25 MOA - Adjustable LED (R)Trijicon111Type 2 model features 2 battery contact points opimized for use as a micro red dot sight on pistols, ensuring proper contact with the battery at all times. (see small picture). With eight available brightness settings, the RM06 reticle can be manually adjusted by pressing the plus or minus buttons on either side of the unit. An additional Button Lockout mode prevents the brightness setting buttons from being changed due accidental bumps, a useful feature when carrying a pistol concealed. To switch to auto adjust mode simply press both buttons simultaneously and release. To save battery life turn the optic off by pressing both buttons simultaneously and holding for 3 seconds. The Trijicon RMR Type 2 is tougher than any alternative and suitable for military, law enforcement and hunting applications. Magnification: 1x
Bullet Drop Compensator: No
Length: 45mm
Weight: 1.2 oz w/Battery
Illumination Source: LED
Reticle Pattern: 3.25 MOA Dot
Day Reticle Color: Red
Night Reticle Color: Red
Bindon Aiming Concept: No
Adjustment @ 100 yards (clicks/in): 1.0
Housing Material: Forged Aluminum
Batteries: 1 CR2032 Lithium Battery
Battery Life: Over 4 years of continuous use (when used at 70ºF (21ºC)) at setting 4 of 8. *Extreme temperatures (high or low) will affect lithium battery performance ]]>1https://s.turbifycdn.com/aah/optacticalgear/trijicon-rmr-3-25-moa-adjustable-r-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/trijicon-rmr-3-25-moa-adjustable-r-57.jpgTrijiconhttps://s.turbifycdn.com/aah/optacticalgear/tro-unobtanium-gear-modular-vest-adapter-mva-27.jpghttps://s.turbifycdn.com/aah/optacticalgear/tro-unobtanium-gear-modular-vest-adapter-mva-25.jpgcustom-itemoptacticalgear-pagechrigacXX-UNOBMVA29TRO-Unobtanium Gear Modular Vest Adapter (MVA)Unobtanium Gear111• MSV - XS, S-S, S, S-L, M, L
• IOTV GEN 3 - XS, S, M, L
• IOTV GEN 4 - XS, S, M, L
1.55oz / 44g
100% American Made
Lifetime Warranty through Manufacturer ]]>1https://s.turbifycdn.com/aah/optacticalgear/tro-unobtanium-gear-modular-vest-adapter-mva-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/tro-unobtanium-gear-modular-vest-adapter-mva-38.jpgUnobtanium Gearhttps://s.turbifycdn.com/aah/optacticalgear/tru-spec-ranger-beads-42.jpgitem.optacticalgear-pagelandnavigation4459410.958.95Tru-Spec Ranger BeadsTru-Spec1111https://s.turbifycdn.com/aah/optacticalgear/tru-spec-ranger-beads-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/tru-spec-ranger-beads-50.jpgTru-Spechttps://s.turbifycdn.com/aah/optacticalgear/tru-spec-tactical-response-uniform-tru-boonie-hat-32.jpgcustom-itemoptacticalgear-pagemilitaryhats4322933.9526.95Tru-Spec Tactical Response Uniform® (TRU) Boonie HatTru-Spec111-Brass screen vents
-Adjustable chin strap
-Built in internal map pocket
-Loops around crown for adding additional camouflage or to secure small items
-Breathable 50/50 Nylon/Cotton RipStop Material Fabrics are US Made, Sewing done overseas]]>1https://s.turbifycdn.com/aah/optacticalgear/tru-spec-tactical-response-uniform-tru-boonie-hat-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/tru-spec-tactical-response-uniform-tru-boonie-hat-42.jpgTru-Spechttps://s.turbifycdn.com/aah/optacticalgear/tru-spec-tru-1-4-zip-combat-shirt-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/tru-spec-tru-1-4-zip-combat-shirt-59.jpgcustom-itemoptacticalgear-pagecombatshirts4253X103.9589.95Tru-Spec TRU 1/4 Zip Combat ShirtTru-Spec111• Body constructed from No Melt, No Drip CORDURA® Baselayer fabric, a 60/40 cotton nylon blend
• 1/4 zip front mandarin collar; zipper has a cover hood for comfort
• Seamless, reinforced shoulders to minimize rubbing and chafing
• Velcro flap sleeve storage pockets
• Loop on sleeve pockets for attaching name, rank and flag patches
• Glint tape holder for IR tape
• Reinforced elbow patches, capable of holding pad inserts (sold separately)
• Gusseted sleeves
• Pen/pencil stalls
• Hook & loop cuff closures Colors: Traditional Woodland Pattern, Original Multicam, Multicam Tropic (Jungle/Woodland Pattern), Multicam Arid (Desert/Arid Pattern) ]]>1https://s.turbifycdn.com/aah/optacticalgear/tru-spec-tru-1-4-zip-combat-shirt-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/tru-spec-tru-1-4-zip-combat-shirt-73.jpgTru-Spechttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-gripstop-standard-length-m-lok-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-gripstop-standard-length-m-lok-r-44.jpgcustom-itemoptacticalgear-pagemamsyXXGSS0X51.99True North Concepts GripStop - Standard Length M-LOK (R)True North Concepts111• Fits the Magpul M-LOK mounting interface
• Weight : 2 oz with hardware
• Rugged 6061-T6 Aluminum construction
• MilSpec Type III anodized finish Application:
• Increased ergonomics and control on all M-LOK compatible Carbines, Submachine guns and Shotguns
• Works with all shooting techniques
• Built-in barrier stop for added accuracy
• Legal for use on AR Pistols. MADE WITH PRIDE IN THE USA. ]]>1https://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-gripstop-standard-length-m-lok-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-gripstop-standard-length-m-lok-r-58.jpgTrue North Conceptshttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-gripstop-k-m-lok-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-gripstop-k-m-lok-r-46.jpgcustom-itemoptacticalgear-pagemamsyXXGSK0X51.99True North Concepts GripStop-K M-LOK (R)True North Concepts111• Fits the Magpul M-LOK mounting interface
• Weight : 2 oz with hardware
• Rugged 6061-T6 Aluminum construction
• MilSpec Type III anodized finish Application:
• Increased ergonomics and control on all M-LOK compatible Carbines, Submachine guns and Shotguns
• Works with all shooting techniques
• Built-in barrier stop for added accuracy
• Legal for use on AR Pistols. MADE WITH PRIDE IN THE USA. ]]>1https://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-gripstop-k-m-lok-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-gripstop-k-m-lok-r-60.jpgTrue North Conceptshttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-mha-leg-strap-kit-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-mha-leg-strap-kit-45.jpgcustom-itemoptacticalgear-pagesahoandacXXMHALS38.49True North Concepts MHA Leg Strap KitTrue North Concepts111litomohoad• High Strength Polymer Multi-positional attachment Bracket
• Adjustable 36″ long mil-w-5664 type 2 class 1 nylon and elastic webbing strap
• Color matched bracket, ITW Fastex buckle and Triglide
• Milspec Components & Berry Compliant sewn, 100% Made in America
• 1.9 oz overall weight
• Leg Strap bracket cross-compatibility with other popular straps MHA Leg Strap Kit Only. Modular Holster Adapter and Holster Sold Separately. This product holds a lifetime, “No questions asked” free replacement guarantee.]]>1https://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-mha-leg-strap-kit-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-mha-leg-strap-kit-58.jpgTrue North Conceptshttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-modular-holster-adapter-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-modular-holster-adapter-71.jpgcustom-itemoptacticalgear-pagesahoandacXXMHA85.5True North Concepts Modular Holster AdapterTrue North Concepts111litomhalegstNOTE: This item CANNOT be returned once the sealed packaging has been opened. This is due to multiple screws and pieces included with the Adapter. Designed to eliminate the unwanted movement, flex and sliding common to factory polymer belt adapters. The Modular Holster Adapter is made from rugged, non-ferrous DFARS grade 6061-T6 aluminum and is Type 3 MIL-SPEC hard coat anodized. Features
- It supports Mid-ride mode of carry allowing the holster to clear body armor and pouches
- Fits all “three hole” pattern Safariland™ type holsters
- Supports QLS, MLS, ELS, and other adapters
- 10° of forward cant and 10° of negative cant for a total range of 20° degrees.
- Three height mounting points, set 1/2" apart, descending from the top mid-ride mounting point.
- Belt mounting bars sized and spaced for MOLLE type battle belts
- Directly bolts to any standard gun belt up to 2”
- No unwanted movement, slipping and sliding on belt Includes top mounting points for using a wide array of popular quick release belt mounts such as the Tek-Lok™ and polymer MOLLE type hardware Includes
- Complete hardware kit of various sized screws, posts, spacers and threadlocker for mounting.
- Top mounting points for using quick release belt mounts such as the Tek-Lok™ and polymer MOLLE type hardware Modular Holster Adapter Only. Holsters, QLS Mounting Components, and Optional Leg Strap sold separately. Colors: Black, Earth Brown This product holds a lifetime, “No questions asked” free replacement guarantee. NOTE: This item CANNOT be returned once the sealed packaging has been opened. This is due to multiple screws and pieces included with the Adapter.]]>1https://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-modular-holster-adapter-83.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-modular-holster-adapter-84.jpgTrue North Conceptshttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-picatinny-rail-gripstop-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-picatinny-rail-gripstop-r-44.jpgcustom-itemoptacticalgear-pagepiraandgesmrXXGSP0X59.99True North Concepts Picatinny Rail Gripstop (R)True North Concepts111• Rugged 6061 Aluminum
• Lightweight (1.7 ounces)
• Milspec anodized finish
• Corrosion resistant Black Nitride hardware
• Flat-tip screw head for mounting with a common screwdriver or multitool, no more hunting for an Allen wrench at the Armory!
• Works on all U.S. Issued firearms utilizing 1913 Picatinny rail
• Legal for use on AR Pistols. Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-picatinny-rail-gripstop-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-picatinny-rail-gripstop-r-58.jpgTrue North Conceptshttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-polymer-gripstop-standard-length-m-lok-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-polymer-gripstop-standard-r-25.jpgcustom-itemoptacticalgear-pagemamsyXXGSSP17.95True North Concepts Polymer Gripstop - Standard Length M-LOK (R)True North Concepts111Specs:
-Fits the Magpul M-LOK mounting interface
-Weight: 0.7 oz with hardware
-Rugged reinforced polymer construction
-Comes with mounting hardware and Allen wrench
-Available in Black or Earth Brown Application:
-Provides increased ergonomics and control on all M-LOK compatible Carbines, Submachine guns and Shotguns.
-Works with all shooting techniques
-Built-in barrier stop for added accuracy MADE WITH PRIDE IN THE USA]]>1https://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-polymer-gripstop-standard-r-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-concepts-polymer-gripstop-standard-r-32.jpgTrue North Conceptshttps://s.turbifycdn.com/aah/optacticalgear/true-north-raven-true-north-raven-raven-wrap-kitraven-wrap-kit-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-raven-true-north-raven-raven-wrap-kitraven-wrap-kit-36.jpgcustom-itemoptacticalgear-pagerangegear67TNRRW300True North Raven Wrap KitTrue North Raven111Kit Includes:
(1) Primary Accessory Pouch
(3) Leg Sleeves
(1) MOLLE Panels (Additional MOLLE Panels available for purchase)
(3) Accessory Straps
(1) Hammock
(3) Adhesive-backed Hook Strips to ensure the sleeves don’t shift or rotate once installed. Product is compatible with:
Really Right Stuff – TFCT-24L
Really Right Stuff – TFCT-34L
Manfrotto – 055 Carbon Fiber and Aluminum
Shadow Tech LLC – 0311PIG Aluminum Specifications:
Material – 500D Cordura Made in the USA]]>1https://s.turbifycdn.com/aah/optacticalgear/true-north-raven-true-north-raven-raven-wrap-kitraven-wrap-kit-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/true-north-raven-true-north-raven-raven-wrap-kitraven-wrap-kit-46.jpgTrue North Ravenhttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-belt-skin-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-belt-skin-59.jpgcustom-itemoptacticalgear-pagemowebe86BELTSKIN39.9934.99Twin Needle Belt SkinTwin Needle111• Medium: 11 columns x 2 rows of MOLLE webbing
• Large: 14 columns x 2 rows of MOLLE webbing
• XLarge:17 columns x 2 rows of MOLLE webbing Belt Skin is not intended to cover the entire belt. It is made to add MOLLE/PALS webbing for pouches where needed and leave space for holsters/leg rigs. NOTE - Belt Skins are made to tightly fit a rigger belt (1.75-inch belt). If using a rigger belt with a plastic stiffener, such as the First Spear Assaulter Gun Belt, it will be a very tight fit and may require use of common tools to help slide the belt skin onto the belt. Belt Skin only, actual belt sold separately. Made in New Zealand.]]>1https://s.turbifycdn.com/aah/optacticalgear/twin-needle-belt-skin-71.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-belt-skin-72.jpgTwin Needlehttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-bino-pouch-v2-harness-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-bino-pouch-v2-harness-46.jpgcustom-itemoptacticalgear-pagespscmobi86BINOV2179169Twin Needle Bino Pouch V2 and HarnessTwin Needle111Features:
- Dual closure system - Magnets on the top panel for quick silent access, with side zips to ensure your binos are protected when crawling through the bush.
- New design rear harness with air mesh padding and rear hidden elastic for stretch, comfort and full adjustment. Strap management stowed by elastic loops to tie up the loose webbing.
- 500D Cordura shell, internal 210D oxford nylon pack cloth
- EVA foam padding throughout
- Internal rear sleeve pouch
- Internal loops to retain binos (retention not provided)
- Front and side MOLLE for additional pouches
- Front and side velcro loop for quick attach round cards and patches
- MOLLE on the bottom of the pouch with elastic loops in between
- New rear open pocket sleeve for quick access items
- ITW Mil Spec buckles Made in New Zealand Available in Coyote, Ranger Green, Multicam Weight: 330 grams including harness Case and harness only; pouches and accessories sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/twin-needle-bino-pouch-v2-harness-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-bino-pouch-v2-harness-56.jpgTwin Needlehttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-comms-cable-retention-strap-vertical-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/comms-cable-retention-strap-vertical-33.jpgcustom-itemoptacticalgear-pageradiopouchesCCRSV12.959.95Twin Needle Comms Cable Retention Strap (Vertical)Twin Needle111Does NOT take away access to any MOLLE/PALS webbing on your vest/pack. Pouches can be placed directly over the strap. Strap only. No cables or comms equipment included.]]>1https://s.turbifycdn.com/aah/optacticalgear/comms-cable-retention-strap-vertical-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/comms-cable-retention-strap-vertical-40.jpgTwin Needlehttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-low-profile-shoulder-straps-for-mini-map-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-low-profile-shoulder-straps-for-mini-map-71.jpgcustom-itemoptacticalgear-pagecaac186STRAPS34.9932.49Twin Needle Low Profile Shoulder Straps for Mini MAPTwin Needle111linktominimap• Slim design ideal for use with armor carriers.
• Now includes mini sternum strap to keep shoulder straps pulled in tight.
• 500D Cordura outer face with 3D Spacer Mesh padding underneath for comfort and ventilation.
• Large webbing loops down the outer face for securing hydration tubes, chest straps, wiring etc.
• Mil-Spec fastex release buckles to quickly and easily ditch the pack if needed.
• Upper attachment via 1-inch webbing and included triglide; lower attachment via 1-inch webbing girth hitch loop. Made in New Zealand by Twin Needle Tactical Gear, a company who designs and produces kit for New Zealand and Australian Special Forces. See link below for Mini MAP.]]>1https://s.turbifycdn.com/aah/optacticalgear/twin-needle-low-profile-shoulder-straps-for-mini-map-84.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-low-profile-shoulder-straps-for-mini-map-85.jpgTwin Needlehttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-mini-map-modular-assault-pack-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-mini-map-modular-assault-pack-66.jpgcustom-itemoptacticalgear-pagecaac186MINIMAP129.99119.99Twin Needle Mini MAP - Modular Assault PackTwin Needle111litolowprshsNew Design: The Mini MAP now features 4 x polymer D-rings to convert into a stand alone back pack!
(Straps sold separately, see link below) A miniature assault pack that is the size same or smaller than the back plate pocket of most armor carriers! The main compartment features a sleeve to secure a 2 liter bladder and a light clothing item. A hanger tab makes sure your bladder stays up right. 3 exit ports (one on the top and one on each side) allow the user to place their hydration hose in the preferred spot, and compression straps allow the load to be cinched down and stop any “pouch bounce”. The webbing tabs on the base that cover the drain holes can be utilized to strap external loads to the bottom. Two columns by three rows of MOLLE/PALS webbing on each side allow the user to fit more pouches to the sides. Additional storage pouch on the front is sized to fit NVGs and other ancillary items. 4 columns by 3 rows of MOLLE/PALS webbing combined with a large section of velcro loop on the upper-front of the Mini MAP allows for attaching velcro patches, IFF, and additional pouches as needed. Approximate Dimensions: 13 x 8.5 x 3.5 inches (main compartment)
-Add 2.5 inches in depth for front storage pouch Weight: approximately 1 lb Material: 500D Cordura Made in New Zealand by Twin Needle Tactical Gear, a company who designs and produces kit for New Zealand and Australian Special Forces. Mini MAP only. Straps, pouches and accessories sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/twin-needle-mini-map-modular-assault-pack-79.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-mini-map-modular-assault-pack-80.jpgTwin Needlehttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-ptt-offset-push-to-talk-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-ptt-offset-push-to-talk-56.jpgcustom-itemoptacticalgear-pagecaac186PTT76.49Twin Needle PTT Offset - Push to TalkTwin Needle111PTT Offset only, no other equipment included. Made in New Zealand.]]>1https://s.turbifycdn.com/aah/optacticalgear/twin-needle-ptt-offset-push-to-talk-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-ptt-offset-push-to-talk-70.jpgTwin Needlehttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-putties-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-putties-56.jpgcustom-itemoptacticalgear-pagesoandin86PUTTIES59.9952.99Twin Needle PuttiesTwin Needle111Cordage not included, any type of cordage can be used. The camo printed putties are all made in 500D Cordura fabric with no reinforcing panel to help keep weight down and breathability up. Sizing: (US) Small: size 5-8 boots Medium: size 8-10 boots Large: size 10-13 boots Made in New Zealand.]]>1https://s.turbifycdn.com/aah/optacticalgear/twin-needle-putties-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-putties-69.jpgTwin Needlehttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-shoulder-pad-sleeves-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-shoulder-pad-sleeves-44.jpgcustom-itemoptacticalgear-pageruandac86SHLDRPAD36.29Twin Needle Shoulder Pad SleevesTwin Needle111 Fed up of your shoulder pads not doing what they are meant to do? Need some extra padding? Our shoulder pad sleeves are the answer. A simple dual lined, EVA foam padded sleeve that will fit onto most existing shoulder pads, including the Terminator. Slide the pads onto the top shoulder point and feel the difference. Features a small square of velcro hook material in the center of the pad to help keep them in place. 500D Cordura, 4mm Airmesh and 10mm EVA foam insert. Made in New Zealand.1https://s.turbifycdn.com/aah/optacticalgear/twin-needle-shoulder-pad-sleeves-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/twin-needle-shoulder-pad-sleeves-58.jpgTwin Needlehttps://s.turbifycdn.com/aah/optacticalgear/two-three-point-slings-63.jpgitem.optacticalgear-pagetagslingsTwo Point Slings1edshdeesdsl1fecosl1si2poadpaslspsysinoslgbgrsebeslvitapaliweupvitasl1vitawislvitavitawipafrprslpafrprslmamsduqdslgevicoapslblfogevcpadohastd3slkslhastd3slblfogeslsl1https://s.turbifycdn.com/aah/optacticalgear/two-three-point-slings-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/two-three-point-slings-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-comp-series-mount-r-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-comp-series-mount-r-39.jpgcustom-itemoptacticalgear-pagerdsreddotsia94FST-COM189172Unity Tactical FAST Comp Series Mount (R)Unity Tactical111The FAST™ Comp Series Mount comes with a standard rail-grabber clamp, but is designed to readily accept a drop-in FAST™ QD Lever (sold separately). This mounting option will provide quick detach capability. SPECS:
• DIMENSIONS: 3.12″(L) x 1.01″(W) x 1.58″(H)
• WEIGHT: 3.2 oz.
• MATERIAL: 7075-T6 Aluminum
• COATING: Type III Hardcoat Anodized
• MOUNT TYPE: Rail Grabber COMPATIBILITY:
• Direct Mounted: Aimpoint CompM4, Comp M4s
• Mounted w/ Aimpoint 30mm Top Ring P/N 12194: Aimpoint PRO, ACO, CompM3, CompML3, CompM2, CompML2 Made in the USA. Mount Only. Optics sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-comp-series-mount-r-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-comp-series-mount-r-53.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-scope-mount-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-scope-mount-48.jpgcustom-itemoptacticalgear-pagelplowpovaopa94FST-S369335Unity Tactical FAST LPVO Scope Mount (R)Unity Tactical111litofalpmoof2• Weight: 0.4 lbs
• Dimensions: 2 × 1.3 × 2 in
• Material: 7075-T6 Aluminum and Type III Hardcoat Anodized Made in the USA. ]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-scope-mount-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-scope-mount-58.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-44.jpgcustom-itemoptacticalgear-pagewelilasw94-AXNSL140Unity Tactical AXONUnity Tactical111 This is the Surefire/Crane/7-inch variant of the Unity AXON.
The pinnacle of remote switch design for weapon-mounted accessories, AXON™ provides complete control of lights and lasers in a single, compact and rugged housing. AXON™ is the direct result of operational feedback from professional end-users on our industry-leading switch technology. Lights and lasers can be fired from individual buttons with versions available for popular issued devices. Its unique design provides tactile differentiation between the two buttons to eliminate confusion in dark, cold and high-stress situations. The light (angled) button features a switch that allows for both momentary and constant activation, while the laser button features a momentary-only button that supports the laser’s double-click-for-constant-on feature. Standard AXON™ models feature each button firing devices independently. SYNC models fire the laser independently, while the light button will fire both light and laser simultaneously. Standard configuration is 7” cable length. AXON™ mounts directly to M1913 Rail, taking up just seven rail slots, while the Rail Clamps feature pass-throughs for zip ties. It also mounts directory to an M-LOK® rail with optional AXON™ M-LOK® Mounting Kit (sold separately). RAIL MOUNT
MIL-STD M1913
M-LOK® (Separate AXON™ M-LOK® Mounting Kit Required) DIMENSIONS (W X L X H)
IN: 1.16 X 2.70 X 0.96
CM: 2.95 X 6.86 X 2.44 WEIGHT
OZ: 1.6
G: 45.5 MATERIAL
High-Impact Polymer This is the Surefire/Crane/7-inch variant of the Unity AXON.]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-58.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-m-lok-mounting-kit-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-m-lok-mounting-kit-17.jpgcustom-itemoptacticalgear-pagewelilasw94AXN-M1816Unity Tactical AXON M-LOK Mounting KitUnity Tactical111AXON SWITCH NOT INCLUDED. COMPATIBILITY
AXON RAIL MOUNT
M-LOK DIMENSIONS (W X L X H)
IN: 0.68 X 2.54 X 0.24
CM: 1.73 X 6.45 X 0.61 WEIGHT
OZ: 0.20
G: 5.70 MATERIAL
High-Impact Polymer CONTENTS
One (1) M-LOK Spacer Plate
One (1) M-LOK Screw
One (1) M-LOK Nut ]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-m-lok-mounting-kit-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-m-lok-mounting-kit-30.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-sl-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-sl-17.jpgcustom-itemoptacticalgear-pagewelilasw94AXN-SL114104Unity Tactical AXON SLUnity Tactical111SureFire®
NATO Crane-Spec Port RAIL MOUNT
MIL-STD M1913
M-LOK® (Separate AXON™ SL M-LOK® Mounting Kit Required) MATERIAL
High-Impact Polymer WEIGHT
OZ: <1.5
G: <42.5 DIMENSIONS (W X L X H)
IN: < 1.3 X 1.7 X 1.1
CM: < 3.3 X 4.3 X 2.8 CABLE LENGTH 7 in]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-sl-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-sl-30.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-sl-m-lok-mounting-kit-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-sl-m-lok-mounting-kit-17.jpgcustom-itemoptacticalgear-pagewelilasw94AXN-SL-M2018Unity Tactical AXON SL M-LOK Mounting KitUnity Tactical111AXON SL SWITCH NOT INCLUDED. COMPATIBILITY
AXON SL RAIL MOUNT
M-LOK DIMENSIONS (W X L X H)
IN: < 1.1 X 3.0 X 0.5 WEIGHT
OZ: <0.5
G: <14.2 MATERIAL
High-Impact Polymer CONTENTS
One (1) AXON™ SL M-LOK® Mounting Kit Frame
Two (2) M-LOK® Screws
Two (2) M-LOK® Nuts ]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-sl-m-lok-mounting-kit-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-axon-sl-m-lok-mounting-kit-30.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-clutch-belt-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-clutch-belt-47.jpgcustom-itemoptacticalgear-pagemowebe94CL-BLT169129.99Unity Tactical Clutch BeltUnity Tactical111litoclbeinkiMade in the USA, Berry Compliant. The Unity Tactical CLUTCH belt is a modular multi-purpose belt designed to work for a wide range of missions. It can be used covertly in non-permissive environments under civilian clothes to conceal and secure a wide variety of gear. The belt may also be used overtly as a battle belt, training belt, active shooter response kit, or just about any other capacity. It is constructed of a durable two-way stretch fabric to allow it to fit comfortably over a wide range of clothes or IWB gear while holding its contents close to your body. Each cell contains padding for long-term comfort, internal Velcro to retain inserts securely, and is backed with textured Slip-Not material to keep it in place. Slots in the Slip-Not material allow for the use of belt keepers if desired for an extra secure hold. The belt is highly-configurable for any mission requirement. INCLUDES: Belt, velcro strips, and alcohol wipes to adapt existing gear to the CLUTCH system. Carriage Options: Handgun, Hand/Flex Cuffs, Credentials, Knife, Baton, Pistol Mags, Rifle Mags, Flash Light, Multi Tool, Radio and more. Any pictured pouches and accessories are sold separately. Suggested Uses: Undercover/Non Permissive Environment Use, Active Shooter Response Kit, Low Profile, Range/Bugout, Battle Belt (Non Load Bearing), SAR/Security, Everyday Carry (with the right cover garment). Inserts: You can easily adapt existing gear to the CLUTCH system. Works with most low-profile kydex and injection-molded holsters and mag carriers up to 4.5″ wide, simply remove any existing mounting hardware and apply the included high-strength velcro according to the included instructions. Also available from UNITY is the low-profile and highly adaptable CLUTCH Insert Kit (sold separately). Made in the USA, Berry Compliant. Sizing: See small inset picture for sizing info. The more loaded up with kit, the tighter the fit of the belt. See link below for CLUTCH Belt Insert Kit. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-clutch-belt-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-clutch-belt-60.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-clutch-insert-kit-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-clutch-insert-kit-43.jpgcustom-itemoptacticalgear-pagemowebe94CL-A-KIT4439.99Unity Tactical Clutch Insert KitUnity Tactical111(1) Rifle Mag / TQ / Radio / Medium General Use Pouch
(1) Double Pistol Mag / Flashlight / Tool Pouch
(1) IFAK / Large General Use Pouch Made in the USA. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-clutch-insert-kit-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-clutch-insert-kit-56.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-cold-weather-liner-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-cold-weather-liner-45.jpgcustom-itemoptacticalgear-pageopheandac94CWL119108Unity Tactical Cold Weather LinerUnity Tactical111The CWL is designed to work with both rail-attached, and under-helmet headsets. Compatible with ACH and most MICH-style helmets, Ops-Core FAST series, and Crye Precision Airframe. The Cold Weather Liner is the best addition you can make to your helmet when temperatures cool off. Exponentially increase your comfort and capabilities by staying warm with the Unity Tactical CWL. Materials:
• Upper Crown: UBL Fabric 93% Nylon / 7% Poly Spandex, 440grams (weight)
• Lower: Loop Terry Spandex w/ DWR 94% Polyester / 6% Spandex, 8-8.5oz linear / 4.5-4.7oz square Made in the USA, 100% Berry Compliant.]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-cold-weather-liner-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-cold-weather-liner-58.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-4x-magnifier-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-4x-magnifier-11.jpgcustom-itemoptacticalgear-pagerdsreddotsia94FST-M4710649Unity Tactical FAST FTC 4X Magnifier111• MAGNIFICATION 4X FIELD OF VIEW AT 100 YARDS
• FEET: 30.1
• METERS: 9.2 FIELD OF VIEW
• 5.75° EXIT PUPIL DIAMETER
• MM: 5.5 EYE RELIEF
• IN: 2.6
• MM: 67 HEIGHT
• 2.26″ TO OPTICAL CENTERLINE MECHANISM
• FORCE-TO-OVERCOME RAIL MOUNT
• FAST™ QD LEVER MATERIAL
• 7075-T6 ALUMINUM COATING
• TYPE III HARDCOAT ANODIZED WEIGHT
• OZ: <12.0
• G: <340.2 DIMENSIONS (W X L X H)
• IN: < 2.4 X 1.5 (RAIL COVERAGE) OR 3.5 (OVERALL) X 3.2 (RAISED) OR 2.0 (STOWED)
• CM: < 6.1 X 3.8 (RAIL COVERAGE) OR 8.9 (OVERALL) X 8.1 (RAISED) OR 5.1 (STOWED) MANUFACTURE OF ORIGIN
• GLASS: SOUTH KOREA
• BASE: USA
• FINAL ASSEMBLY: USA]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-4x-magnifier-12.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-4x-magnifier-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-aimpoint-mag-mount-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-aimpoint-mag-mount-35.jpgcustom-itemoptacticalgear-pagerdsreddotsia94FST-MAPB259241Unity Tactical FAST FTC Aimpoint Magnifier Mount (R)Unity Tactical111• Weight: 0.2 lbs
• Dimensions: 1.45 × 2.38 × 3.2 inches Made in the USA. FAST Magnifier Mount Only. FAST Micro Mount and Optics sold separately. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-aimpoint-mag-mount-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-aimpoint-mag-mount-45.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-omni-magnifier-mount-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-omni-magnifier-mount-52.jpgcustom-itemoptacticalgear-pagerdsreddotsia94FST-OM265241Unity Tactical FAST FTC OMNI Magnifier Mount (R)Unity Tactical111FAST FTC OMNI Magnifier Mount Only. Magnifiers sold separately. The FAST™ OMNI Flip-To-Center Magnifier Mount is compatible with a host of popular magnifiers from EOTech, Vortex Optics, Trijicon, and Sig Sauer. See description below for a complete list. FAST™ FTC Magnifier Mounts come complete with American Defense Manufacturing® patented QD Auto-Lock™ Lever. FAST™ is a series of optic mounts and platforms that provide end users with a quicker sight picture than standard height mounts. A 2.26” optical centerline height provides faster/easier reticle acquisition while wearing electronic earpro/communications headsets, night vision goggles and gas masks and allows for more rapid visual processing of the battlefield by promoting a heads-up posture. A heads-up posture also helps users maintain a neutral spine position which is more comfortable while wearing helmets, plate carriers, and other heavy gear. FAST™ FTC Magnifier Mounts feature the first ever Flip-To-Center (FTC) mechanism (patent-pending), providing stowage completely within the footprint of the weapon’s receiver while not occluding the host optic’s sight picture. This provides the most optic capability with the lowest profile during all modes of operation. The revolutionary FTC function completely solves the problem posed by legacy flip-to-side magnifier mounts (when disengaged, the magnifier hangs off the side of the gun, creating a major snag hazard). FAST™ FTC Magnifier Mounts completely eliminate this danger and utilize a force-to-overcome mechanism for rapid transition. Specs:
• DIMENSIONS: 2.25″(L) x 2.64″(W) x 3.42″(H)
• WEIGHT: 4.4 oz.
• MATERIAL: 7075-T6 Aluminum
• COATING: Type III Hardcoat Anodized
• MOUNT TYPE: QD Lever Compatibility:
• EOTech G23, G30, G33, G43, G45
• Vortex Optics VMX-3T, Micro3X, Micro6X
• Trijicon 3X MAG-C
• Sig Sauer Juliet3X, Juliet4X, Juliet Micro3X Made in the USA. FAST FTC OMNI Magnifier Mount Only. Magnifiers sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-omni-magnifier-mount-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-ftc-omni-magnifier-mount-62.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-mount-offset-optic-adapter-plate-r-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-mount-offset-optic-adapter-plate-r-39.jpgcustom-itemoptacticalgear-pagelplowpovaopa94FSTSOP3935Unity Tactical FAST LPVO Mount Offset Optic Adapter Plate (R)Unity Tactical111litofalpmoofFAST™ is a series of mounts and platforms that provide end users with a quicker sight picture than standard height mounts. A taller optical centerline (mechanical) height provides faster/easier reticle acquisition while wearing electronic ear pro/communication headsets, night vision goggles, gas masks, and plate carriers that can impede a natural shooting position. It allows for more rapid visual processing of the battlefield by promoting a heads-up posture. The FAST™ LPVO Offset Optic Adapter Plates place mini red dot sights on the FAST™ LPVO Offset Optic Base. Each plate comes with a specific optic footprint and uses the optic manufacturer’s hardware. Each plate footprint will accept any mini red dot with that footprint pattern. Plates can mount in three positions on the Offset Optic Base (forward cantilever, centered, rearward cantilever) for a customized fit. The FAST™ LPVO Offset Optic Adapter Plates are only compatible with the FAST™ LPVO Scope Mount and require a FAST™ Offset Optic Base to function. The FAST™ LPVO Offset Optic Base is built from 7075-T6 Aluminum and Type III Hardcoat Anodized Black or FDE*. Weight: 0.1 lbs Dimensions: 2 × 1.3 × 2 in Optic not included1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-mount-offset-optic-adapter-plate-r-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-mount-offset-optic-adapter-plate-r-53.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-mount-offset-optic-base-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-mount-offset-optic-base-43.jpgcustom-itemoptacticalgear-pagelplowpovaopa94FSTSO6963Unity Tactical FAST LPVO Mount Offset Optic Base (R)Unity Tactical111litofalpmoof1FAST™ is a series of mounts and platforms that provide end users with a quicker sight picture than standard height mounts. A taller optical centerline (mechanical) height provides faster/easier reticle acquisition while wearing electronic ear pro/communication headsets, night vision goggles, gas masks, and plate carriers that can impede a natural shooting position. It allows for more rapid visual processing of the battlefield by promoting a heads-up posture. The FAST™ LPVO Offset Optic Base attaches to either the forward or rearward mounting holes in the FAST™ LPVO Scope Mount. Together with a FAST™ LPVO Offset Optic Adapter Plate, it provides a base for attaching any number of mini red dot sights directly to the scope mount. The Offset Optic Base places mini red dot sights at a 35 degree offset from the scope tube for faster transitions. When used with the Optic Adapter Plates, the mini red dot will have a mechanical centerline of 2.05” above the rail. The FAST™ LPVO Offset Optic Base is only compatible with the FAST™ LPVO Scope Mount and requires a FAST™ Offset Optic Adapter Plate to function. The FAST™ LPVO Offset Optic Base is built from 7075-T6 Aluminum and Type III Hardcoat Anodized Black or FDE*. Weight: 0.1 lbs Dimensions: 2 × 1.3 × 2 in Optic not included 1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-mount-offset-optic-base-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-lpvo-mount-offset-optic-base-53.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-micro-mount-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-micro-mount-r-46.jpgcustom-itemoptacticalgear-pagerdsreddotsia94FST-MIC205186Unity Tactical FAST Micro Mount (R)Unity Tactical111FAST Micro Mount Only. FAST Magnifier Mount and Optics sold separately. FAST™ is a series of optic mounts and platforms that provide end users with a quicker sight picture than standard height mounts. A 2.26” optical centerline height provides faster/easier reticle acquisition while wearing electronic earpro/communications headsets, night vision goggles and gas masks and allows for more rapid visual processing of the battlefield by promoting a heads-up posture. A heads-up posture also helps users maintain a neutral spine position which is more comfortable while wearing helmets, plate carriers, and other heavy gear. The FAST™ Micro Mount features built-in standard height back up iron sights that keep weapons uncluttered, without reducing capability. Both front and rear BUIS are completely adjustable for windage and elevation. The front sight post can be removed so that the rear BUIS aperture can be used with a traditional front sight such as our FUSION fixed or folding sights (if present), creating a more conventional sight radius. However, the built in front/rear BUIS is perfect for backup on super short PDW/SMG platforms where rail space is critical for mounting lights and lasers. Designed for Aimpoint® Micro (H1, H2, T1, T2, CompM5) and other optics with Aimpoint® Micro footprint, such as those found on many Sig Sauer®, Holosun®, Primary Arms®, and Vortex Optics® platforms. The FAST™ Micro Mount comes with a standard rail-grabber clamp mount, but is designed to readily accept a drop-in American Defense Manufacturing® patented QD Auto-Lock™ Lever (sold separately). This mounting option will provide quick detach capability. The FAST™ Micro Mount is built from super strong 7075-T6 Aluminum and Type III Hardcoat Anodized Black or FDE*. *Due to the chemical process that takes place during Type III Hardcoat, the final finish can vary slightly from part to part (even parts done in the same batch). Therefore, your FDE FAST Mount may vary from one to the next, and may vary slightly from the photos shown online. Specs:
• Weight: 0.2 lbs
• Dimensions: 2 × 1.3 × 2 inches Made in the USA. FAST Micro Mount Only. FAST Magnifier Mount and Optics sold separately. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-micro-mount-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-micro-mount-r-60.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-qd-lever-17.jpgcustom-itemoptacticalgear-pagerdsreddotsia94LA3854541Unity Tactical FAST QD LeverUnity Tactical111FAST™ Micro
FAST™ Micro-S
FAST™ Optic Riser (as of Aug. 2023)
FAST™ Absolute Riser
FAST™ Comp Series
FAST™ MRO
FAST™ MRDS
FAST™ MicroPrism
FAST™ FTC OMNI, FAST™ FTC 30mm and FAST™ FTC PA magnifier mounts come with this lever pre-installed NOT compatible with the FAST™ COG Series and FAST™ LPVO mounts. DIMENSIONS (W X L X H):
IN: < 2.0 X 2.1 X 0.6
CM: < 5.1 X 5.3 X 1.5 WEIGHT:
OZ: <2.0
G: <56.7 MATERIAL:
7075-T6 Aluminum COATING:
Type III Hardcoat Anodized MANUFACTURER:
American Defense MFG ]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-qd-lever-25.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-qd-lever-26.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-riser-r-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-riser-r-53.jpgcustom-itemoptacticalgear-pagerdsreddotsia94FST-ORB10595Unity Tactical FAST Riser (R)Unity Tactical111A Flip-Up Offset Backup Rear Iron Sight module can be purchased separately. This feature will provide fast-transition BUIS capability to the FAST™ Riser. The Offset Rear Iron Sight Module is 100% compatible with existing Offset Front Sights such as those available from MAGPUL, Dueck Defense, Midwest Industries, and Knights Armament Company. The FAST™ Riser is built from 7075-T6 Aluminum and Type III Hardcoat Anodized Black or FDE. Due to the chemical process that takes place during Type III Hardcoat, the final finish can vary slightly from part to part (even parts done in the same batch). Therefore, your FDE FAST Mount may vary from one to the next, and may vary slightly from the photos shown online. Made in the USA. Riser Only, back up sights, additional mounts and optics sold separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-riser-r-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-fast-riser-r-67.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-knuckl-helmet-mount-kit-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-knuckl-helmet-mount-kit-45.jpgcustom-itemoptacticalgear-pageheliandac92KNUFK5449.99Unity Tactical KNUCKL Helmet Mount KitUnity Tactical111Kit Includes:
-KNUCKL Mount
-Arc Adapter
-Team Wendy Adapter
-MPLS Adapter
-Contour Camera Adapter
-Rail Section
-Mounting Hardware Compatible Accessories:
-Surefire Scout Lights (No adapter required)
-Contour Camera (Adapter included)
-PrincetonTec MPLS Lights (Adapter included)
-Rail-Mounted Lights (Adapter included)
-Ring Lights (FUSION Ring Mount required)
-Ring Cameras (FUSION Ring Mount required)
-Millenium Series Lights (FUSION Millennium Adapter required) Weight: 0.24 lbs Dimensions: 1.0 x 7.2 x 8.0 in Color: Black, FDE This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-knuckl-helmet-mount-kit-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-knuckl-helmet-mount-kit-58.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-mark-2-0-amp-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-mark-2-0-amp-36.jpgcustom-itemoptacticalgear-pageteweheandpa94HLMMA7972Unity Tactical MARK 2.0 for Ops-Core AMP HeadsetUnity Tactical111Designed to work exclusively with the Ops-Core AMP™ headset ONLY. A different MARK Kit is available for Peltor headsets. The Modular Attached Rail Kit (MARK) 2.0 allows the end user to seamlessly integrate their hearing protection and/or integrated communications into their headborne systems and improve the consistent seal of ear protection. The MARK 2.0 is compatible with most major helmet types and the most popular electronic hearing protection. The MARK 2.0 Kit comes with all hardware for attachment to Ops-Core ARC™ (and similar) and Team Wendy EXFIL™ Gen 2 and 3 rails. An M-LOK™ Adapter Kit is sold separately for compatibility with MTEK and Hard Head Veterans brand helmets. The wider ARC™ backers allow for more compatibility with non-standard ARC-type rails than the previous model. MARK 2.0 is the lowest profile headset helmet mount on the market. Rather than using a traditional pop-in/pop-out mechanism, MARK2.0 is simply pulled away from the ears and rotated backwards for stowage. The aggressive wire forms ensure the strongest ear cup seal when engaged. Constructed of impact-resistant polymer, the MARK 2.0 is designed for use in the most austere environments. This variant of the MARK 2.0 is designed to work exclusively with the Ops-Core AMP™ headset. It is available in two configurations. Full kits come complete with OEM Ops-Core AMP™ Cradle Clamp assemblies and are ready to rapidly attach to headsets out of the box MARK Only kit does not come with the OEM Cradle Clamp assembly and relies on end-users to supply their own Ops-Core AMP™ Cradle Clamps PLEASE NOTE: The wire forms for the AMP™ version are different than the legacy wire forms. Legacy MARK 2.0 wire forms are incompatible with the AMP™ Cradle Clamps due to length and crimp direction. The MARK 2.0 AMP™ offers another option for mounting the popular Ops-Core AMP™ headset to helmets. It attaches at the traditional 12 o’clock position and allows for broader helmet acceptance of AMP™ headsets. The OEM helmet mount attaches from the rear of the rail. If a helmet does not have a rear rail, the MARK 2.0 AMP™ will still allow users to attach to helmets. WEIGHT: 2.0 oz. (pair) MATERIAL: Polymer MARK 2.0 Kit Includes:
-(1 Pair) Unity MARK 2.0 Adapter Assembly
-(1 Pair) ARC™ Style Backer Plates + Hardware
-(1 Pair) EXFIL™ Hardware
-(1 Pair) AMP™ Cradle Clamp Assembly (FULL KIT MODEL ONLY) Ear Pro Compatibility:
-Ops-Core AMP™ Headset Helmet Rail Compatibility:
-Ops-Core FAST™ Series Helmets
-Ops-Core ACH-ARC™ Rails
-Crye Precision AirFrame™ Rails
-Galvion Caiman™ Rails
-Galvion/Revision Viper™ Rails
-Team Wendy EXFIL™ Rails (Gen2 / Gen3) ]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-mark-2-0-amp-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-mark-2-0-amp-46.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-mark-kit-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-mark-kit-52.jpgcustom-itemoptacticalgear-pagehepr94HLM-MOD7972Unity Tactical MARK Kit 2.0Unity Tactical111litosasoadThis mounting kit is significantly smaller than the Peltor ARC Adapter Set. The MARK 2.0 (Modular Rail Kit) provides seamless integration if electronic hearing protection and/or communication headsets with head-borne systems. The 2.0 model is updated with increased modularity and compatibility with various non-spec rail manufacturers. Designed to reduce the overall profile of helmets and improve the seal of ear protection, MARK 2.0 is compatible with every major helmet rail type and popular electronic hearing proctection. Constructed of impact-resistant polymer, MARK 2.0 is ready for hard use in the most austere environments. Adapts 3M Peltor Headsets (MSA /Sodrin with SARA System - sold separately). MARK 2.0 Kits come with all hardware for Ops-Core ARC and similar rails, plus Team Wendy EXFIL 2.0 and 3.0 Rail systems. M-LOK adapters are sold separately for other helmet mounting options like M-TEK models. MARK Kit Includes:
• (1 Pair) Unity MARK Mount
• Rail/Helmet Adapters for Ops-Core ARC and Team Wendy EXFIL 2.0 and 3.0 Rails
• (1 Pair) Headset Mounting Wireforms, Swaged Ends to hold the headset on
• Mounting Hardware
• Installation Instructions Ear Pro Compatibility:
• Most 3M Peltor models
• Most Howard Leight models
• Most MSA Sordin models (requires Unity Tactical SARA adapters, sold separately) Specs:
• Weight 1.5 oz Compatible Helmet Types:
• Ops-Core FAST and Crye Airframe ARC Rails
• Team Wendy 2.0 and 3.0 Rails Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-mark-kit-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-mark-kit-62.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-platform-adapter-for-team-wendy-helmets-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-platform-adapter-for-team-wendy-helmets-43.jpgcustom-itemoptacticalgear-pagehepr94HLMP2926Unity Tactical Platform Adapter for Team Wendy HelmetsUnity Tactical111- Compatible with: EXFIL Rail (Team Wendy)
- Material: Reinforced Polymer
- Breakaway: 8 ft lbs.
- Country of Origin: U.S.A. ]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-platform-adapter-for-team-wendy-helmets-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-platform-adapter-for-team-wendy-helmets-56.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-remora-for-peltor-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-remora-for-peltor-43.jpgcustom-itemoptacticalgear-pageopheandac94HLMREMP2927Unity Tactical Remora for PeltorUnity Tactical111Remora™ for 3M Peltor™ provides mount interface for M1913 Picatinny, Surefire Scout™ footprint, and Unity FUSION™ accessory footprint; giving users tons of options. Positive click detents allow the assembly to be rotated into several positions to direct the accessory orientation. Positioning the Remora™ assembly will not affect the stance of the headset rail adapter hub. Installation of Remora™ for 3M Peltor™ requires no permanent modification to the OEM product. Injection molded in the U.S.A. Can be angled up or down to point any mounted accessories in a certain direction. Compatible with: OEM 3M Peltor™ ARC™ Rail Adapters / Team Wendy™ EXFIL™ Rail Back Plate / Crye Precision™ ARC™ Rail Back Plate / Busch Protection™ Rail Back Plate / MTEK™ M-LOK™ Rail Back Plate Material: Impact Resistant Polymer Interface: M1913 Picatinny | Surefire™ Scout Footprint | Unity Tactical FUSION™ Footprint Package only includes mount 1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-remora-for-peltor-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-remora-for-peltor-56.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-sara-sordin-adapters-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-sara-sordin-adapters-45.jpgcustom-itemoptacticalgear-pageteweheandpa94HLM-SAR6963Unity Tactical SARA Sordin AdaptersUnity Tactical111• (4) Unity SARA adapters
• (4) Mounting Set Screws
• (2) ESS studs for compatibility with both Over The Head and Behind The Head models
• Installation Instructions Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-sara-sordin-adapters-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-sara-sordin-adapters-58.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-spark-marker-light-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-spark-marker-light-36.jpgcustom-itemoptacticalgear-pageheliandac94SPVR11816.99Unity Tactical SPARK Marker Light - Multi-ModeUnity Tactical111Now featuring a low and high LED output mode, plus blink mode. SPARK is a personal identification/marking light in a small footprint. Originally designed for industrial safety applications, SPARK is a practically unnoticeable addition to helmets, plate carriers, chest rigs, or virtually any item requiring illuminated visual identification. Purposely simple, SPARK’s bright LED is easily activated by pressing its center to cycle between constant-on low, constant-on high, blink, and off. Features a positive click for tactile feedback. SPARK is fully encapsulated in a flexible silicone body, making it water and damage resistant and backed with Velcro for ready placement. SPARK is perfect for active IFF on helmets, vehicles, K9’s, and other kit. It is affordable enough to be issued by large agencies and units. Disposable with 200+ hour runtime. IR model has a very low emitting red dot visible when activated, allowing you to tell if it's on without the use of Night Vision when close enough to the SPARK. IR Model is restricted to USA Addresses only. Features:
• Mode Cycle: Low / High / Blink / Off
• Dimensions: 1.625″ x 1.625″ x 0.5″
• Velcro Hook Backing
• Includes a separate adhesive-backed velcro loop section to aid in securing the SPARK to any hard surface.
• Flexible silicon body that's water and damage resistant
• Run Time: approx 200+ Hours THIS ITEM CAN SHIP TO APO ADDRESSES. IR Model CANNOT ship international.]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-spark-marker-light-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-spark-marker-light-46.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-summit-shroud-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-summit-shroud-18.jpgcustom-itemoptacticalgear-pagenvgmoso94HLM-SH-UT8981Unity Tactical Summit ShroudUnity Tactical111Most helmet shells utilizing a standard three-hole pattern, including but not limited to: ArmorSource™, Avon Protection™ Ceradyne (Bolted Models), Busch PROtective®, Galvion™, MTEK™, Ops-Core® and others DIMENSIONS (W X H):
IN: 4.2 X 3.8
CM: 10.6 X 9.6 WEIGHT:
OZ: <1.0
G: <27.0 MATERIAL:
Shroud: High-Impact Polymer
Insert: Machined Stainless Steel INCLUDED HARDWARE:
Three (3) 4-40 x 5/16-in; Cap Screws
Three (3) 4-40 x 1/2-in; Cap Screws
Three (3) 4-40 x 5/8-in; Cap Screws
Three (3) #4 Washers
Three (3) Shroud Nuts
One (1) T8 Torx Wrench NOTE: Bungee not included ]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-summit-shroud-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-summit-shroud-30.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-direct-mount-vfg-80.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-direct-mount-vfg-79.jpgcustom-itemoptacticalgear-pagemamsy94UT-MS-VFGX2624Unity Tactical VFG - Updated (R)Unity Tactical111• Weight: 0.18 lbs
• Dimensions: 1.6 × 4.3 × 6.8 in ]]>1https://s.turbifycdn.com/aah/optacticalgear/unity-tactical-direct-mount-vfg-88.jpghttps://s.turbifycdn.com/aah/optacticalgear/unity-tactical-direct-mount-vfg-89.jpgUnity Tacticalhttps://s.turbifycdn.com/aah/optacticalgear/us-flag-cotton-3-x-5-fully-sewn-24.jpgcustom-itemoptacticalgear-pageflagpatches1363511100039.38US Flag Cotton 3 x 5 ft Fully SewnUS Flag111This 3'x5' cotton U.S. flag comes with brass grommets. This flag has sewn stripes and embroidered stars. Flag is 100% made in the U.S.A. 3 foot x 5 foot 1.25 lbs1https://s.turbifycdn.com/aah/optacticalgear/us-flag-cotton-3-x-5-fully-sewn-30.jpghttps://s.turbifycdn.com/aah/optacticalgear/us-flag-cotton-3-x-5-fully-sewn-31.jpgUS Flaghttps://s.turbifycdn.com/aah/optacticalgear/us-flag-cotton-3-x-5-economy-polycotton-25.jpgcustom-itemoptacticalgear-pageflagpatches1363543100014.95US Flag Cotton 3 x 5 ft SentinelUS Flag111This printed Poly Cotton U.S. flag comes with brass grommets. Flag is 100% made in the U.S.A. 3 foot x 5 foot 0.37 lbs Flag Only, no accessories included1https://s.turbifycdn.com/aah/optacticalgear/us-flag-cotton-3-x-5-economy-polycotton-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/us-flag-cotton-3-x-5-economy-polycotton-32.jpgUS Flaghttps://s.turbifycdn.com/aah/optacticalgear/us-flag-nylon-22.jpgcustom-itemoptacticalgear-pageflagpatches13635211000LK34.62US Flag Nylon 3 x 5 ft Fully SewnUS Flag111This 3'x5' nylon U.S. flag comes with brass grommets. This flag has sewn stripes and embroidered stars. Flag is 100% made in the U.S.A. 3 foot x 5 foot 0.9 lbs1https://s.turbifycdn.com/aah/optacticalgear/us-flag-nylon-28.jpghttps://s.turbifycdn.com/aah/optacticalgear/us-flag-nylon-29.jpgUS Flaghttps://s.turbifycdn.com/aah/optacticalgear/usts-modular-sniper-data-book-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/usts-modular-sniper-data-book-66.jpgitem.optacticalgear-pageriteinrain89DGMDB39.95USTS Modular Sniper Data BookU.S. Tactical Supply1111https://s.turbifycdn.com/aah/optacticalgear/usts-modular-sniper-data-book-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/usts-modular-sniper-data-book-79.jpgU.S. Tactical Supplyhttps://s.turbifycdn.com/aah/optacticalgear/usts-sniper-data-book-spiral-bound-69.jpghttps://s.turbifycdn.com/aah/optacticalgear/usts-sniper-data-book-spiral-bound-67.jpgitem.optacticalgear-pageriteinrain89DB__42USTS Sniper Data Book - Spiral BoundU.S. Tactical Supply111Already in operational use. Mil-Spec materials and construction. Printed 20 lb. bond, tactical green "Rite-in-the-Rain" paper. Cover made of polydura plastic with black plastic spiral ring. 128 leaves, 256 pages (double the size of most competitors' books). 14 pages of formulas, conversion tables, and charts on range estimation, wind, moving targets, and angle fire. Data sheets for zero summaries, cold bore shots, zeroes, bullseye, stationary, unknown distance, and moving targets. Various mission sheets and a barrel log are also included. For 7.62 mm NATO/.308 and .300 Win. rifles.1https://s.turbifycdn.com/aah/optacticalgear/usts-sniper-data-book-spiral-bound-79.jpghttps://s.turbifycdn.com/aah/optacticalgear/usts-sniper-data-book-spiral-bound-80.jpgU.S. Tactical Supplyhttps://s.turbifycdn.com/aah/optacticalgear/usts-sniper-template-38.jpgitem.optacticalgear-pageriteinrain89BA7316USTS13.811USTS Sniper TemplateU.S. Tactical Supply111The template was custom designed for U.S. Tactical Supply to fit in our standard Data Book Cover along with a Mildot Master Slope doper etc. It will also fit in the New Modular Sniper Data Book and JL Darling 9200 Six Ring Field Binder Pocket. Designed to be used by anyone who records their target shooting sessions. The cut outs allow recording shot placement for a variety of targets. In addition, there are handy tables for wind deflection and bullet path at various wind velocities and distances respectively. Metric and English scales and a protractor are also provided. The template is designed for use with either a medium ball point pen or a pencil. The template comes in a sturdy black leatherette case. Actual size: 4" X 7".1https://s.turbifycdn.com/aah/optacticalgear/usts-sniper-template-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/usts-sniper-template-47.jpgU.S. Tactical Supplyhttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4414.jpglink.frprsl1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4225.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4226.jpghttps://s.turbifycdn.com/aah/optacticalgear/velcro-attach-holsters-and-accessories-11.jpglink.keltyslingbag1https://s.turbifycdn.com/aah/optacticalgear/velcro-attach-holsters-and-accessories-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/velcro-attach-holsters-and-accessories-10.jpghttps://s.turbifycdn.com/aah/optacticalgear/velcro-brand-sticky-back-tape-2-inch-x-12-inch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/velcro-brand-sticky-back-tape-2-inch-x-12-inch-54.jpgitem.optacticalgear-pageveir55ha9720__P1.65VELCRO® Brand Sticky Back Tape, 2 Inch X 12 InchVELCRO111For those who don't know the nomenclature: Pile portion is the type that is softer and resembles hair (found on the ACU for hooking patches to). Hook portion is very coarse and is shaped like little hooks (found on the back of patches for the ACU). This item is stocked in bulk. If not in stock, lead time is 2-3 business days.]]>1https://s.turbifycdn.com/aah/optacticalgear/velcro-brand-sticky-back-tape-2-inch-x-12-inch-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/velcro-brand-sticky-back-tape-2-inch-x-12-inch-68.jpgVELCROhttps://s.turbifycdn.com/aah/optacticalgear/velcro-brand-sticky-back-tape-4-inch-x-12-inch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/velcro-brand-sticky-back-tape-4-inch-x-12-inch-55.jpgitem.optacticalgear-pageveir55ha9740__P2.97VELCRO Brand Sticky Back Tape, 4 Inch X 12 InchVELCRO111For those who don't know the nomenclature: Pile portion is the type that is softer and resembles hair (found on the ACU for hooking patches to). Hook portion is very coarse and is shaped like little hooks (found on the back of patches for the ACU). This item is stocked in bulk. If not in stock, lead time is 2-3 business days.]]>1https://s.turbifycdn.com/aah/optacticalgear/velcro-brand-sticky-back-tape-4-inch-x-12-inch-68.jpghttps://s.turbifycdn.com/aah/optacticalgear/velcro-brand-sticky-back-tape-4-inch-x-12-inch-69.jpgVELCROhttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-8-round-capacity-40mm-insert-for-the-helium-whisper-assault-back-panel-type-1-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-8-round-capacity-40mm-insert-for-the-helium-whisper-assault-back-panel-type-1-49.jpgcustom-itemoptacticalgear-pagecocavebaho98MF-40mmInsert35Velocity Systems 8 Round Capacity - 40MM Insert for the Helium Whisper Assault Back Panel Type 1Velocity Systems111litomaasbapa40MM Insert ONLY, Back Panel Sold Separately. The 8 Round Capacity, 40MM Insert was designed to fit in the upper-zipper pouch of the Helium Whisper® Assault Back Panel Type 1. To increase modularity, the design includes carry handles and loop flaps on the sides that can be opened to allow the user to lay the insert flat. Hook and loop fasteners are located on the front and back to secure the insert inside the upper-zipper pouch of the Helium Whisper® Assault Back Panel Type 1. The 8 Round Capacity, 40MM Insert is designed to fit standard size 40 mm ammunition or similar sized less than lethal/incendiary devices. All hook and loop material used is color matching VELCRO® Brand Fasteners. All materials and workmanship are 100% made in the USA.
-Designed to fit in the upper-zipper pouch of the Helium Whisper Assault Back Panel Type 1
-Fit standard-size 40 mm ammunition or similar sized less than lethal, or incendiary devices
-Attachment: VELCRO® Brand fastener
-Design includes carry handles and loop side flaps, allowing insert to open and lay flat
-Dimensions (WxHxD): 7”x4.75”x5”
-Color: Coyote Brown
-100% Made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-8-round-capacity-40mm-insert-for-the-helium-whisper-assault-back-panel-type-1-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-8-round-capacity-40mm-insert-for-the-helium-whisper-assault-back-panel-type-1-63.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-basha-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-basha-79.jpgcustom-itemoptacticalgear-pagesleepingbags98VS-BASHA-XX156139Velocity Systems BashaVelocity Systems111• Measures 8' by 6' 8"
• Camouflage on both sides
• Taped seams along the body and water resistant finish to help block out wind and rain
• Reinforced button holes around the edges every 2' for attachment
• Easily folds for smaller use
• Hood in one corner for use as a personal poncho
• Compacts very small into included 8" by 6" drawstring bag.
• Weight: approximately 15 oz or less Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-basha-91.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-basha-92.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-boss-rugby-long-sleeve-91.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-boss-rugby-long-sleeve-89.jpgcustom-itemoptacticalgear-pagetshirts98RUGBYLS8176Velocity Systems BOSS Rugby Long SleeveVelocity Systems111BOSS Rugby Long Sleeve The Velocity Systems BOSS Rugby Long Sleeve is a lightweight, rugby influenced shirt that can be utilized as a hot weather range shirt, or a moisture managing base layer under armor. The rugby style collar keeps a weapon sling off the base of neck. It is an outstanding polo replacement for a department’s relaxed uniform or training day standard. The active cut is athletic and mobile; the material is comfortable and quick to dry. The two envelope pockets on the sleeve accept hook backed patches. 83% Nylon 17% Spandex. All materials and workmanship are 100% made in the USA. Features:
• Modern Rugby Style Collar
• Two Envelope Pockets on the Sleeves
• Loop on Sleeve Pockets
• Highly Breathable
• Enhanced wicking chemistry
• Dynamic Stretch and Recovery
• Non-chafing Heat Seal Tagless Label
-Made in the USA Sizing Guide:
Sm / Md / Lg / XL / 2X / 3X
38 / 40 / 44 / 46 / 52 / 56 (Chest)
30 / 32 / 34 / 38 / 44 / 48 (Waist)]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-boss-rugby-long-sleeve-101.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-boss-rugby-long-sleeve-102.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systemc-boss-rugby-shirt-104.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systemc-boss-rugby-shirt-103.jpgcustom-itemoptacticalgear-pagetshirts98VS-BR-XX-X7165Velocity Systems BOSS Rugby ShirtVelocity Systems111-Modern rugby style collar, helps prevent chafing from rifle sling.
-Two low-profile envelope pockets on the sleeves featuring VELCRO® Brand Loop fastener for patches
-Highly Breathable
-Enhanced wicking chemistry
-Soil release treatment
-Dynamic stretch and recovery for comfortable fit even when sweaty
-Odorexx™ Antimicrobial good for 25 washes
-Short sleeve construction
-Non-chafing heat seal labels
-Made in the USA Sizing: Athletic fit
Sm / Md / Lg / XL / 2X / 3X
38 / 40 / 44 / 46 / 52 / 56 (Chest)
30 / 32 / 34 / 38 / 44 / 48 (Waist)]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systemc-boss-rugby-shirt-111.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systemc-boss-rugby-shirt-112.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-gas-mask-pouch-for-the-helium-whisper-assault-back-panel-type-1-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-gas-mask-pouch-for-the-helium-whisper-assault-back-panel-type-1-45.jpgcustom-itemoptacticalgear-pagecocavebaho986955Velocity Systems Gas Mask Pouch for the Helium Whisper Assault Back Panel Type 1Velocity Systems111litomaasbapa1Gas Mask Pouch ONLY, Back Panel Sold Separately. The Gas Mask Pouch was designed as a removable pouch option for the Helium Whisper® Assault Back Panel Type 1. The bottom section of the back panel features a VELCRO® Brand fastener for modularity and quick attach/detach. For easy access the pouch mounts horizontally with a side opening. This allows the end user to have the ability to quickly reach back and grab their gas mask on the move. To ensure the Gas Mask Pouch is secured, the Helium Whisper® Assault Back Panel Type 1 design includes a security strap that fastens using GTSR 3/4" side release buckles. The Gas Mask Pouch fits AVON FM53 or similar sized mask. -Removable pouch option for the Helium Whisper® Assault Back Panel Type 1
-Fits AVON FM53 or similar sized masks
-Mounts horizontally with a side opening for easy access on the move
-Attachment: VELCRO® Brand Fastener
-Security strap on the Helium Whisper® Assault Back Panel Type 1 that fastens using GTSR 3/4" side release buckles
-Dimensions (HxWxD):10”x7”x 4-5” (Approx) *Depth is variable depending on the type of gas mask being utilized
-Weight 5.66oz
-100% Made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-gas-mask-pouch-for-the-helium-whisper-assault-back-panel-type-1-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-gas-mask-pouch-for-the-helium-whisper-assault-back-panel-type-1-60.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-helium-whisper-micro-diddie-pouch-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-helium-whisper-micro-diddie-pouch-63.jpgcustom-itemoptacticalgear-pagedupoevba98VHW-DUMP-XX27Velocity Systems Helium Whisper Micro Diddie PouchVelocity Systems111Not designed to be used as a dump pouch according to the manufacturer. The Helium Whisper® Micro Diddie Pouch is a small diddie bag or SSE pouch that can be very compactly stored when not in use. The bag measures 8.75” x 9.5” with a shock cord lined opening and cord lock synch. The entire bag rolls or stuffs into attached elastic pocket to stow when not in use. A webbing pull tab at the bottom allows for easy and quick deployment. Helium Whisper® Attachment. All materials and workmanship are 100% made in the USA. Features:
• 8.75" x 9.5" Bag which has a shock cord lined opening and cord lock to synch closed
• Entire bag rolls or stuffs into attached elastic loop pouch to stow when not in use
• Webbing tab at the bottom for easy and quick deployment from the elastic pouch
• Takes up minimal space, 4"x2", when in elastic pouch
• Helium Whisper® style attachment, ultra lightweight and thin Weight: 1.75 oz Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-helium-whisper-micro-diddie-pouch-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-helium-whisper-micro-diddie-pouch-77.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-helium-whisper-motorola-radio-pouch-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-helium-whisper-motorola-radio-pouch-44.jpgcustom-itemoptacticalgear-pageradiopouches98VS-MRP-XX37Velocity Systems Helium Whisper Motorola Radio PouchVelocity Systems111• Holds Motorola SABER Radio or similar sized radio
• Shock cord retainer with small ITW Nexus quick release buckle
• Grommet on bottom for drainage
• Helium Whisper® style attachment
• Weight: 2.5 oz. (0.07 kg)
• All materials and workmanship are 100% made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-helium-whisper-motorola-radio-pouch-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-helium-whisper-motorola-radio-pouch-58.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-law-enforcement-plate-carrier-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-law-enforcement-plate-carrier-47.jpgcustom-itemoptacticalgear-pagemaveclqaco98MF-LEPC215199.99Velocity Systems LEPC with Divider Cummerbund Velocity Systems111litoswplandrNow includes the Low-Profile Elastic Cummerbund with Dividers (2 Divider Pockets per side)! The Velocity Systems Law Enforcement Plate Carrier (LEPC) was designed for ultimate modularity. The vest was designed with limited Molle and elastic cummerbunds for a sleek and clean look. The vest has large Velcro loop blocks on the front and back for ID as well as a drag handle on the rear panel. The front kangaroo pouch that accepts our magazine inserts found on the LEPC was modeled after the APC. Optional removable front Molle flaps and quarter flaps allow you to scale this carrier as needed. Features:
• Features 3D spacer mesh padding along the inner face of the plate pockets for comfort and ventilation
• Compatible with SwiftClip Chest Rigs and Placards (SwiftClips on the front of the LEPC are removable). See link below for SwiftClip compatible rigs and parts.
• Low-Profile Elastic Cummerbund with Dividers for quick don/doff and secure fit while moving/fighting, also ensures no interference with duty belt access. Cummerbund features 2 x Divider Pockets per side to fit M4 sized mags, radios, medical and other similar sized items. Can be replaced with the Mayflower MOLLE Cummerbund (sold separately) for load and armor carriage.
• Upper front portion of the LEPC contains an integral admin pouch with internal elastic loops to retain pens, pencils, chemlites or similar items
• Integrated Drag Handle
• MOLLE webbing along the lower rear portion of the carrier for attaching IFAK/Medical Kit and other mission essentials
• Stretchable shoulder pads made from soft Tweave material offer greater range of motion and less chafing along the neck line. Foam padding for comfort on the underside of the pad, with the ability to run wiring and tubes through the pad itself Sizing: NOTE - Cummerbund has a wide range of adjustment
• Small/Medium with Medium Cummerbund - will fit Small and Medium SAPI/ESAPI plates (use this one for ideal fit of 10x12 plates)
• Large/XLarge with Large Cummerbund - will fit Large or XLarge SAPI/ESAPI plates Made in the USA. LEPC only, all other accessories sold separately. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-law-enforcement-plate-carrier-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-law-enforcement-plate-carrier-59.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-level-iiia-kevlar-soft-armor-for-mayflower-vests-r-56.jpgitem.optacticalgear-pagedysoar98VS-LPAC33A625494.99Velocity Systems Level IIIA Soft Armor for Mayflower Vests (Pair) (R)Velocity Systems111UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. LIMIT 2 SETS PER ORDER DUE TO DEMAND. Sold as a pair. Level IIIA Soft Armor panels, made by Velocity Systems LLC.
• Ballistic inserts for Mayflower Low-Profile Armor and Assault Carriers.
• Ballistic components are hermetically RF heat sealed and encapsulated in order to maintain ballistic integrity in wet and/or sandy environments.
• NIJ Certified: Yes - Type/Level III-A
• Ballistic Material: 100% Dyneema
• Ballistic Panel Thinness: approximately .22 inches
• Fragmentation: Meets/Exceeds USSOCOM & IOTV requirements This soft armor is designed to fit proprietary LPAC or LPAAC vests. Some other brands of vests may fit depending on size. Approximate dimensions of front and back panels:
Medium:
• Front Panel: Height Lowest part of the V portion of the neck = 14”, Height Tallest part of the V portion = 15.5”
• Front Panel Thinnest Width = 11", Widest Width = 22.5”
• Back Panel: Height = 16"
• Back Panel: Thinnest Width = 12", Widest Width =” x 22.5” Large:
• Front Panel: Height Lowest part of the V portion of the neck = 14.5”, Height Tallest part of the V portion = 16”
• Front Panel Thinnest Width = 11", Widest Width = 24.5”
• Back Panel: Height = 17"
• Back Panel: Thinnest Width = 12.5", Widest Width = 24.5” XL:
• Front Panel: Height Lowest part of the V portion of the neck = 15”, Height Tallest part of the V portion = 17”,
• Front Panel Thinnest Width = 11.5", Widest Width = 25.5”
• Back Panel: Height = 18"
• Back Panel: Thinnest Width = 13", Widest Width = 25.5” O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. There are no returns or exchanges on body armor items UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. LIMIT 2 SETS PER ORDER DUE TO DEMAND. Sold as a pair. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-level-iiia-kevlar-soft-armor-for-mayflower-vests-r-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-level-iiia-kevlar-soft-armor-for-mayflower-vests-r-63.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-level-iiia-kevlar-soft-armor-inserts-for-cummerbund-pair-r-48.jpgitem.optacticalgear-pagedysoar50VS-CAI-13A195139Velocity Systems Level IIIA Soft Armor Inserts for Cummerbund - Pair (R)Velocity Systems111Sold as a pair. Velocity Systems Cummerbund Soft Armor Inserts are cut to fit our various different models of cummerbunds allowing the end user to upgrade his protection level based on threat analysis. All materials and workmanship are 100% made in the USA. Ballistic Specifications:
• NIJ Certified: Yes - Type/Level III-A
• Ballistic Material: 100% Dyneema
• Ballistic Panel Thinness: approximately .22 inches
• Fragmentation: Meets/Exceeds USSOCOM & IOTV requirements Sizing:
• Small: 5 x 7 inches
• Medium: 5 x 9 inches
• Large: 5 x 11 inches
• XLarge: 5 x 14 inches O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. There are no returns or exchanges on body armor items Sold as a pair. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-level-iiia-kevlar-soft-armor-inserts-for-cummerbund-pair-r-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-level-iiia-kevlar-soft-armor-inserts-for-cummerbund-pair-r-55.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-level-iiia-kevlar-soft-armor-plate-backers-pair-r-47.jpgitem.optacticalgear-pagedysoar98VS-SAPPB-13A437294.99Velocity Systems Level IIIA Soft Armor SAPI-cut Plate Backers (Pair) (R)Velocity Systems111UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. LIMIT 2 SETS PER ORDER DUE TO DEMAND. Sold as a pair. Level IIIA Soft Armor panels, made by Velocity Systems LLC. They meet or exceed the USASOC Fragmentation requirements. Features:
• Ballistic Material: 100% Dyneema
• Ballistic plate backers for Stand Alone use or In Conjunction With Hard Armor
• Ballistic components are hermetically RF heat sealed and encapsulated in order to maintain ballistic integrity in wet and/or sandy environments.
• Ballistic Panel Thinness: approx .22 inches
• NIJ Certified: Yes, Level IIIA
• Fragmentation: Meets/Exceeds USSOCOM & IOTV requirements Sizes: Made to fit same size SAPI/ESAPI Plate, slightly larger to ensure full coverage
Medium - Approximately 10 x 12.9 inches
Large - Approximately 10.6 x 13.5 inches O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. There are no returns or exchanges on body armor items UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. LIMIT 2 SETS PER ORDER DUE TO DEMAND. Sold as a pair. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-level-iiia-kevlar-soft-armor-plate-backers-pair-r-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-level-iiia-kevlar-soft-armor-plate-backers-pair-r-54.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-lower-abdomen-pouch-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-lower-abdomen-pouch-47.jpgcustom-itemoptacticalgear-pagedysoar98VS-LAP59Velocity Systems Lower Abdomen PouchVelocity Systems111• Main zipper pocket opens wide enough to easily access contents, and the zipper is easy to pull closed one-handed
• VELCRO® Brand fastener flap allowing connection to a plate carrier
• Internal VELCRO® Brand fasteners for organization
• Exterior horizontal zippered pouch
• Built in sleeve for optional Level IIIA Dyneema abdominal soft armor insert
• Material: 500 Denier Cordura
• Pouch Size: 9” x 7”
• Holds Armor Size: 8” x 5”
• Approximate Weight Without Armor: 4.8oz
• Approximate Weight With Armor: 9.5oz All materials and workmanship are 100% made in the USA. O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. There are no returns or exchanges on body armor items This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-lower-abdomen-pouch-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-lower-abdomen-pouch-60.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-mbav-cut-level-iiia-soft-armor-pair-r-81.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-mbav-cut-level-iiia-soft-armor-pair-r-79.jpgcustom-itemoptacticalgear-pagedysoar98VS-13A-MBAV-XX483324.99Velocity Systems MBAV-cut Level IIIA Soft Armor - Pair (R)Velocity Systems111UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. LIMIT 2 SETS PER ORDER DUE TO DEMAND. Sold as a pair. Level IIIA Soft Armor panels (Front and Back sold together), Model # VS-MBAV, made by Velocity Systems LLC. They meet or exceed the USASOC Fragmentation requirements. Ballistic components are hermetically RF heat sealed and encapsulated in order to maintain ballistic integrity in wet and/or sandy environments. NOTE: Main picture shows MBAV Small/Medium size, smaller (inset) picture shows MBAV Large/XLarge size. Features:
• Made for MBAV-style plate carriers like the Crye Precision AVS, First Spear MBAV Strandhogg and OPT-Mayflower MBAV APC.
• NIJ Certified: Yes - Type/Level III-A
• Ballistic Material: 100% Dyneema
• Ballistic Panel Thinness: approximately .22 inches O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. There are no returns or exchanges on body armor items UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. LIMIT 2 SETS PER ORDER DUE TO DEMAND. Sold as a pair. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-mbav-cut-level-iiia-soft-armor-pair-r-91.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-mbav-cut-level-iiia-soft-armor-pair-r-92.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-molle-placard-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-molle-placard-64.jpgcustom-itemoptacticalgear-pagemaveclqaco98VS-MOLLEPLAC5849.99Velocity Systems MOLLE PlacardVelocity Systems111• The back face of the placard is a Hook face to mate with a Loop face of the front of a carrier or vest
• The height of the buckles from the top of the placard can be adjusted by Hook and Loop straps on the back of the placard. Allows for proper height on Crye Precision JPC 2.0 and similar vests.
• There are also two additional Hook and Loop tabs at the top of the placard to secure placard in place
• Pull tabs at the bottom of placard for quick separation of the placard Hook face from vest Loop face
• The placard comes in two sizes. Both sizes have 6x3 MOLLE webbing on the front Size: 11" x 6.5" Placard w/ 6x3 MOLLE webbing, works with Mayflower and Velocity Systems Carriers, and similar designed carriers. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-molle-placard-77.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-molle-placard-78.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-operators-utility-belt-oub-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-operators-utility-belt-oub-49.jpgcustom-itemoptacticalgear-pagemowebe98XXX110105Velocity Systems Operator Utility BeltVelocity Systems111-Slotted opening on the sides for using belt-mounted gear like holsters or drop-rigs.
-Contoured shape that fits your lower-back better than other belts.
-Narrow profile and 25% lighter than other utility belts.
-Passive cooling and ventilation.
-Can be worn with your existing riggers belt (inner belt is not included)
-Helmet-style Velcro Hook lined inner portion for securing to inner belts (not required). Velcro type is non-abrasive style used inside helmets.
-Velcro Strap on the inner back portion to secure rear of belt to the rear belt loop on your pants. Sizing: Measurements below are overall length of OUB belt. Measure your sizing with clothing you will be wearing under the OUB belt (usually at least 1 pants size bigger for most people). Normally you want about 6 inches specing between ends of the belt when wrapped around your waist.
Small: 31-inches - 16 columns of MOLLE/PALS, 4 slotted openings per side Medium: 34.5-inches - 18 columns of MOLLE/PALS, 5 slotted openings per side Large: 38.5-inches - 20 columns of MOLLE/PALS, 6 slotted openings per side Inner belt not included.]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-operators-utility-belt-oub-58.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-operators-utility-belt-oub-59.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-patch-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-patch-65.jpgcustom-itemoptacticalgear-pagegrpa98VS-V-PATC-XX54Velocity Systems PatchVelocity Systems111• Yellow/Orange on Black
• Gray on Black
• Brown on Tan
• 2"H x 2.5"W
• Hook backing Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-patch-78.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-patch-79.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-light-plate-carrier-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-light-plate-carrier-64.jpgcustom-itemoptacticalgear-pagevesyscplcaan98VS-SLT338309.99Velocity Systems Scarab Light Plate CarrierVelocity Systems111Kangaroo Pocket is wide enough to fit a triple 7.62 NATO magazine insert. The plate pockets hold Plates of corresponding sizes to the carrier, and there are adjustable plate hanger straps inside the plate pockets. Cummerbund can be adjusted at 3 points for exact fit around the user. Includes:
(1) SCARAB™ Light Carrier Front and Rear Panel
(1) Set of ULTRAcomp™ Shoulder Straps & Stretch Padded Sleeves
(1) Front Flap (Quick-detachable velcro)
(1) Size Appropriate Cummerbund for Front Flap Entry Weigh as configured above: approximately 2 lbs Made in the USA.]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-light-plate-carrier-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-light-plate-carrier-77.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-lt-zip-on-back-panel-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-lt-zip-on-back-panel-47.jpgcustom-itemoptacticalgear-pagevesyscplcaan120109.99Velocity Systems Scarab LT Zip-On Back PanelVelocity Systems111Designed to work with the Velocity Systems Scarab LT Plate Carrier only. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-lt-zip-on-back-panel-60.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-lt-zip-on-back-panel-61.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-plate-carrier-and-accessories-67.jpgcustom-itemoptacticalgear-pagemaveclqacoVelocity Systems Scarab Plate Carrier and Accessories1vesyscliplcaopsyaszipatyvesyscltzibamaveclqaco1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-plate-carrier-and-accessories-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-scarab-plate-carrier-and-accessories-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-special-threat-ceramic-plate-green-tip-rated-r-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-special-threat-ceramic-plate-green-tip-rated-r-48.jpgcustom-itemoptacticalgear-pagespthar98VS-PTBL-1012340332Velocity Systems Special Threat Ceramic Plate - Green Tip Rated (R)Velocity Systems111lito6x6spthsUPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. Price shown is for a single plate. Features:
Multi-Curve
SAPI Cut
Standalone
Thickness: approx 0.61 inches
Materials: Ceramic Composite
Made in USA Special Threat Ratings:
• 7.62x39mm-M43/Mild Steel Core
• 5.45 x 39 PS Ball/Mild Steel Core 7N6
• 5.56 x 45 M193
• 5.56x45mm-M855 / SS109 Green Tip
• 7.62 x 51 M80 Ball Size and Specs:
• Medium SAPI: 9.5 x 12.5 inches, 5 lb
• Large SAPI: 10.25 x 13.25 inches, 5.8 lb O P Tactical Inc. Body Armor Policy: Purchaser is solely responsible for complying with all applicable laws. Purchaser assumes all responsibility for their purchase, to include knowing local laws regarding body armor. Law Enforcement or Military only for New York and Connecticut residents per State law. Email or call us regarding sales to New York or Connecticut residents. OPT assumes no responsibility for body armor purchases made in violation of federal, state or local laws. (R)= No Export Sales, Restricted to US orders ONLY, if where you are requires a customs label, we cannot ship armor items there, this includes APO/FPO addresses. There are no returns or exchanges on body armor items UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. This is to properly insure it. If you choose the wrong shipping method it will delay your order. Price shown is for a single plate. This Item is Excluded from Limited Sale Coupon Codes ]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-special-threat-ceramic-plate-green-tip-rated-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-special-threat-ceramic-plate-green-tip-rated-r-60.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-triple-5-56-swiftclip-placard-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-triple-5-56-swiftclip-placard-46.jpgcustom-itemoptacticalgear-pagemaveclqaco98VS-TRIM47869.99Velocity Systems Triple 5.56 SwiftClip PlacardVelocity Systems111The height of the buckles from the top of the placard can be adjusted by Hook and Loop straps on the back of the placard. Allows for proper height on Crye Precision JPC 2.0 and similar vests. The front face of the placard also has 6 coloumns x 2 rows of Molle webbing. Size: 9.75" x 6.5" All materials and workmanship are 100% made in the USA. NOTE: Your carrier must have Swift Clip/QASM attachment points on the front panel and Velcro Loop on the front flap portion in order to secure the placard in place effectively.]]>1https://s.turbifycdn.com/aah/optacticalgear/velocity-systems-triple-5-56-swiftclip-placard-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/velocity-systems-triple-5-56-swiftclip-placard-58.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/mayflower-velcro-padded-shoulder-sleeve-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-velcro-padded-shoulder-sleeve-38.jpgcustom-itemoptacticalgear-pagecaac150CPADV39.99Velocity Systems Velcro Padded Shoulder SleeveVelocity Systems111• 1.75-inch Velcro adjustable to fit most armor carriers including vests from Mayflower, Velocity Systems, Crye Precision and Blue Force Gear.
• Stretchable Tweave material allows for slings and communications wiring to fit through the pad easily.
• Slim design for greater range of motion and less chafing along neck line.
• Thin foam padding for comfort on the underside of pad. Sold as a set of 2 shoulder pads. Made in the USA. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/mayflower-velcro-padded-shoulder-sleeve-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/mayflower-velcro-padded-shoulder-sleeve-48.jpgVelocity Systemshttps://s.turbifycdn.com/aah/optacticalgear/carrier-accessories-68.jpgcustom-itemoptacticalgear-pagemollevestsrigs1trgemoveadmaxladeqcuaxladsttuadsmisycamimisycamid4x6misycasp1initwnebuagmimapbapagrghgesmcaspgrghgesmc1tocrprzipaadgrghgesmctazfecoadbapamofecoadbapabafecoadbapadofecoadbapawateweesnotrplkapoincotaqudeadcucotaqudejpcuarrekitfecoshpacrprrseshpadspsyshcotrshcoarcshpavaxladstshpafecopastsomavepashslopmbshpaspsyrehafisprecukiturabrpaforfisfecoad3ascufeco3acfitubfecocaelcumacupawi6x6ptohohatohohaxlwashpacrpravspashctwnepttofputcocaresttwnemimapmoatwnelowprshsmaasbapaty1emmmdrst1None of the items in this section come with body armor in any form (unless otherwise noted on the item's page), they are not designed to stop bullets, have no ballistic rating and are not to be employed as life-support equipment.]]>1https://s.turbifycdn.com/aah/optacticalgear/carrier-accessories-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/carrier-accessories-67.jpglink.crprpeadset1https://s.turbifycdn.com/aah/optacticalgear/viking-tactics-cobra-belt-74.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-cobra-belt-72.jpgitem.optacticalgear-pageriggersbelts8752873 89.99Viking Tactics Cobra BeltViking Tactics111The Cobra Buckle on the Viking Tactics® Belt may not meet requirements for life support, all Unit regulations should be followed with regard to this belt and it’s Emergency Use. Belt is 1.75-inch width. NOTE: If ordering this belt to use with a Battle Belt/MOLLE Padded Belt, please order 1 size larger than the Battle Belt to ensure enough length. Your belt size is not the same as your pant or waist size. Please forget everything you know about your pants size and take out a tape measure and measure around your waist so we are talking about the same sizing. SIZING:
Usable lengths, there is about 4" of play in each belt:
• M (34 ½ -37")
• L (37 ½ - 41")
• XL (41 ½ - 45")
• 2XL (45 ½ - 49 ½ ") Made in the USA. ]]>1https://s.turbifycdn.com/aah/optacticalgear/viking-tactics-cobra-belt-84.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-cobra-belt-85.jpgViking Tacticshttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-combat-suspenders-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-combat-suspenders-61.jpgcustom-itemoptacticalgear-pagesuspenders87-SS-XX49.95Viking Tactics Combat SuspendersViking Tactics111suviUsing the time tested Army scissor suspenders as inspiration, we designed the VTAC Combat Suspenders. These suspenders connect with an easy on and off “G Hook” allowing the user to connect to normal belt loops for daily wear as well as quickly configuring to be used with your duty belt. The provided velcro adapter allow the user to configure belts and molle for suspender integration. Unlike other suspenders, the low profile VTAC suspenders will not catch on gear and do not pull belts up or down as you bend. You will find that these suspenders also work nice when carrying concealed helping hold your belt exactly where you want it. These suspenders also fit nicely under body armor for extended use. Includes 2 x Velcro connectors for attaching to belts or MOLLE platforms. Other accessories sold separately.1https://s.turbifycdn.com/aah/optacticalgear/viking-tactics-combat-suspenders-73.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-combat-suspenders-74.jpgViking Tacticshttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-lpsm-low-profile-sling-mount-r-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-lpsm-low-profile-sling-mount-r-63.jpgitem.optacticalgear-pageramoslat87LPSM39.95Viking Tactics LPSM (Low Profile Sling Mount) (R)Viking Tactics111The Low Profile Sling Mount (LPSM) presents a lower profile on your weapon. VTAC-LPSM is designed to make the Heavy Duty Quick Detach (HQD) Swivel lock in and limit the rotation. The LPSM attaches to Picatinny rail. HQD sold separately.1https://s.turbifycdn.com/aah/optacticalgear/viking-tactics-lpsm-low-profile-sling-mount-r-76.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-lpsm-low-profile-sling-mount-r-77.jpgViking Tacticshttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-sling-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-sling-57.jpgitem.optacticalgear-pagetwopointslings87VTACMK144.95Viking Tactics SlingViking Tactics111Viking Tactics Sling for collapsible stock (AR-15 type rifles). The Viking Tactics Sling is quick, versatile, dynamic and most importantly simple! The VTAC sling is instantly adjustable to improve your shooting position, allows shooting from weak side shoulder, secures the carbine during handgun transitions, and allows hands-free movement in difficult surroundings. Unlike most slings, the Viking Tactics slings are fully adjustable while in use. You won’t have to take a break from the action to adjust your sling. The Viking Tactics sling isn’t just a carry strap, it’s full range of adjustability will enhance retention when you need your hands free, it is also one of the only tactical slings that can be used as an adjustable shooting sling. A tight sling will enhance any shooting position. Colors: Black, Coyote, Olive1https://s.turbifycdn.com/aah/optacticalgear/viking-tactics-sling-70.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-sling-71.jpgViking Tacticshttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-target-40.jpgitem.optacticalgear-pagetargets87VTACTRGT1.25 25 25 50 42.5 100 80Viking Tactics TargetViking Tactics111V-Tac Double Sided Target The VTAC Target Double sided to provide the most cost efficient versatile target. Target Size - 25" x 35" Paper Target thickness Durable 70 lb gauge Marksmanship Side •Four SR-1c bulls eye targets gridded with 1” squares •Numbered Precision Shooting Shapes •Center Of Gravity Impact Boxes Pricing Silhouette Side •Silhouette with visible skeleton •Visible Center Of Gravity Impact Zones (vital organ and central nervous system areas) •Competition target to scale with scoring zones •White silhouette on black background for long distance recognition These targets have a graded price scale:
1 Target: $1.25/piece
25 Targets: $1.00/piece
50 Targets: $0.85/piece
100 Targets: $0.80/piece Targets are normally in stock for quantities of 100 or less. If out of stock, lead time is approximately 2-3 business days. UPS OR INTERNATIONAL SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. CONTACT US FOR SHIPPING COST IF ORDERING MORE THAN 100 TARGETS. This Item is Excluded from ALL Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/viking-tactics-target-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-target-50.jpgViking Tacticshttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-padded-light-weight-upgrade-sling-hybrid-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-padded-light-weight-upgrade-sling-hybrid-47.jpgcustom-itemoptacticalgear-pagetwopointslings87VTACMK2HB59.95Viking Tactics Wide (Padded) Sling - HyduraViking Tactics111The Viking Tactics Hydura Sling incorporates quick adjustment and comfort with decreased weight. The VTAC Hydura sling has a Cordura wrapped shoulder pad and rubber pull tab to give you a tactile feel when making quick adjustments. Lightweight and ready for wherever your mission may take you. (VTAC Hybrid Sling + Cordura = VTAC Hydura Sling) **Please note the Black/MCAM does NOT have a rubberized pull tab. Made in the USA.1https://s.turbifycdn.com/aah/optacticalgear/viking-tactics-padded-light-weight-upgrade-sling-hybrid-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-padded-light-weight-upgrade-sling-hybrid-57.jpgViking Tacticshttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-wide-padded-sling-upgraded-39.jpgitem.optacticalgear-pagetwopointslings87VTAC-MK2-XX-UG59.95Viking Tactics Wide Padded Sling (Upgraded)Viking Tactics111The Upgraded Viking Tactics Wide (Padded) Quick Adjust sling comes with two new great features. We have added a textured rubber pull tab, which allows the user to quickly adjust the sling. We have also replaced the plastic buckles with metal hardware and elastic stow bands to allow easy mounting and adjustment, with increased strength and durability.1https://s.turbifycdn.com/aah/optacticalgear/viking-tactics-wide-padded-sling-upgraded-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-wide-padded-sling-upgraded-49.jpgViking Tacticshttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-wide-sling-61.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-wide-sling-59.jpgitem.optacticalgear-pagetwopointslings87VTACMK249.95Viking Tactics Wide SlingViking Tactics111Viking Tactics Wide Padded Sling - added comfort for heavier firearms. Same great features as original sling. The Viking Tactics, Inc. Wide (padded) Sling was developed after listening to feedback from our customers. Customers with heavier firearms who wanted a wider, more comfortable sling with the same great features of the original Viking Tactics, Inc. sling. The Viking Tactics Wide Sling is made with a shoulder strap with closed cell foam for increased comfort. The forward adjustable portion of the sling remains the same as the original sling, giving you quick, easy adjustments from any position. Colors: Black, Coyote, Olive, Multicam1https://s.turbifycdn.com/aah/optacticalgear/viking-tactics-wide-sling-72.jpghttps://s.turbifycdn.com/aah/optacticalgear/viking-tactics-wide-sling-73.jpgViking Tacticshttps://s.turbifycdn.com/aah/optacticalgear/vortex-razor-hd-gen-ii-e-1-6x24-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/vortex-razor-hd-gen-ii-e-1-6x24-r-46.jpgcustom-itemoptacticalgear-pagelplowpovaopaXX160XX2399.991499.99Vortex Razor HD Gen II-E 1-6x24 (R)Vortex Optics111Optical Features:
• APO System Index-matched lenses correct color across the entire visual spectrum.
• Optically Indexed Lenses Optimize image sharpness and brightness from edge to edge.
• HD Lens Elements Premium extra-low dispersion glass delivers the ultimate in resolution and color fidelity, resulting in high-definition images.
• XR™ Plus Fully Multi-Coated Ultimate anti-reflective coatings on all air-to-glass surfaces provide maximum light transmission for peak clarity and the pinnacle of low-light performance.
• Plasma Tech Cutting edge coating application process provides unparalleled coating durability and performance
• Second Focal Plane Reticle Scale of reticle maintains the same ideally-sized appearance. Listed reticle subtensions used for estimating range, holdover and wind drift correction are accurate at the highest magnification.
• Illuminated Center Dot Daylight bright illuminated center dot provides a precise point-of-aim in all lighting conditions.
• Locking Illumination Locks illumination at preferred setting. Construction Features:
• Tube Size 30 mm diameter provides maximized internal adjustment and strength.
• Single-Piece Tube Maximizes alignment for improved accuracy and optimum visual performance, as well as ensures strength and waterproofness.
• Aircraft-Grade Aluminum Constructed from a solid block of aircraft-grade aluminum for strength and rigidity.
• Waterproof O-ring seals prevent moisture, dust and debris from penetrating for reliable performance in all environments.
• Fogproof Argon gas purging prevents internal fogging over a wide range of temperatures.
• Shockproof Rugged construction withstands recoil and impact.
• Hard Anodized Finish Highly durable hard-coat anodization provides a low-glare matte surface and helps camouflage the shooter's position.
• ArmorTek ® Ultra-hard, scratch-resistant coating protects exterior lenses from scratches, oil and dirt.
• Large Diameter Turrets Provide fast, accurate and easily read elevation and windage adjustments. Caps provide external protection for turret. Internal Mechanism Design Features:
• Friction Reduction System Heat-treated, hardened-steel pad floats on the end of the turret screw and interfaces with a hardened steel ring on the erector tube for steel-on-steel contact. Prevents galling or deformation of the erector screw contact point for superior durability.
• Turret Screws Provides low-friction, wear-resistant performance: precision-machined from a silicon-brass alloy and treated with an advanced dry-film lubricant. Turret screw threads are precision machined to sub-2 micron tolerances (less than 78-millionths of an inch).
• Erector Tube System Precision-machined from aircraft grade aluminum with anti-galling properties for a lighter weight, strong, durable tube. Stainless Steel offset coil spring erector biasing system withstands much higher stresses than traditional flat erector springs. Convenience Features:
• Fast Focus Eyepiece Allows quick and easy reticle focusing.
• Locking Side Illumination Easily accessible and lockable illumination dial is located on the left side of turret housing.
• Features eleven intensity levels of illumination with off positions between each setting. Specs:
• Magnification 1-6x
• Objective Lens Diameter 24 mm
• Eye Relief 4 inches
• Field of View 115.2-20.5 ft/100 yds
• Tube Size 30 mm
• Turret Style Low Capped
• Adjustment Graduation .2 MRAD, 1/2 MOA
• Travel Per Rotation 20 MRAD, 50 MOA
• Max Elevation Adjustment 43 MRAD, 150 MOA
• Max Windage Adjustment 43 MRAD, 150 MOA
• Parallax Setting 100 yards
• Length 10.1 inches
• Weight 21.5 oz Included in the Box:
• CR2032 battery
• Lens cloth Types:
• MRAD Reticle
• MOA Reticle This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/vortex-razor-hd-gen-ii-e-1-6x24-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/vortex-razor-hd-gen-ii-e-1-6x24-r-60.jpgVortex Opticshttps://s.turbifycdn.com/aah/optacticalgear/vortex-razor-hd-gen-iii-1-10x24-ffp-r-36.jpghttps://s.turbifycdn.com/aah/optacticalgear/vortex-razor-hd-gen-iii-1-10x24-ffp-r-35.jpgcustom-itemoptacticalgear-pagelplowpovaopaXX1100X3999.992499.99Vortex Razor HD Gen III 1-10x24 - Throw Lever Included (R)Vortex Optics111Optical Features:
• HD Optical System Optimized with select glass elements to deliver exceptional resolution, cut chromatic aberration and provide outstanding color fidelity, edge-to-edge sharpness and light transmission.
• XR™ Fully Multi-Coated Proprietary coatings increase light transmission with multiple anti-reflective coatings on all air-to-glass surfaces.
• APO System Index-matched lenses correct color across the entire visual spectrum.
• Optically Indexed Lenses Optimize image sharpness and brightness from edge to edge.
• First Focal Plane Reticle Scale of reticle remains in proportion to the zoomed image. Constant subtensions allow accurate holdover and ranging at all magnifications.
• Glass-Etched Reticle Allows for intricate reticle design. Protected between two layers of glass for optimum durability and reliability.
• Daylight Bright Illumination Daylight bright, illuminated reticle aids in faster target acquistion in bright daylight conditions. Construction Features:
• ArmorTek ® Ultra-hard, scratch-resistant coating protects exterior lenses from scratches, oil and dirt.
• Shockproof Rugged construction withstands recoil and impact.
• Waterproof - IPX7 Designed to meet IPX7 waterproofing standards.
• Fogproof Argon gas purging prevents internal fogging over a wide range of temperatures.
• Tube Size 34 mm diameter provides maximized internal adjustment and strength.
• Hard Anodized Stealth Shadow Finish Highly durable anodization provides a low-glare matte surface and helps camouflage the shooter's position.
• Aircraft-Grade Aluminum Constructed from a solid block of aircraft-grade aluminum for strength and rigidity. Convenience Features:
• L-Tec™ Tool Included with your scope for precise adjustments to the turret.
• Locking Side Illumination Easily accessible and lockable illumination dial is located on the left side of turret housing. Features eleven intensity levels of illumination with off positions between each setting. Specs:
• Magnification: 1-10x
• Objective Lens Diameter: 24 mm
• Eye Relief: 3.6 inches
• Field of View: 116-11.7 ft @100 yds
• Tube Size: 34 mm
• Turret Style: Low Capped
• Adjustment Graduation: .1 MRAD, 1/4 MOA
• Travel Per Rotation: 10 MRAD, 25 MOA
• Max Elevation Adjustment: 30 MRAD, 120 MOA
• Max Windage Adjustment: 30 MRAD, 120 MOA
• Parallax Setting: Fixed @100 yds
• Length: 10.1 inches
• Weight: 21.5 oz
• Color: Hard Anodized Stealth Shadow Finish (FDE/Bronze color) Included in the Box:
• Sunshade
• Lens cloth
• CR2032 Battery
• SV-5 Throw lever
• L-TEC Tool Backed by a Lifetime Warranty. This Item is Excluded from ALL Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/vortex-razor-hd-gen-iii-1-10x24-ffp-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/vortex-razor-hd-gen-iii-1-10x24-ffp-r-45.jpgVortex Opticshttps://s.turbifycdn.com/aah/optacticalgear/vortex-viper-pst-gen-ii-1-6x24-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/vortex-viper-pst-gen-ii-1-6x24-r-44.jpgcustom-itemoptacticalgear-pagelplowpovaopaXX160X899.99599.99Vortex Viper PST Gen II 1-6x24 (R)Vortex Optics111Optical Features:
• XD™ Lens Elements Extra-low dispersion (XD) glass increases resolution and color fidelity, resulting in crisp, sharp images.
• XR™ Fully Multi-Coated Proprietary coatings increase light transmission with multiple anti-reflective coatings on all air-to-glass surfaces.
• Second Focal Plane Reticle Scale of reticle maintains the same ideally-sized appearance. Listed reticle subtensions used for estimating range, holdover and wind drift correction are accurate at the highest magnification.
• Illuminated Reticle Provides precise aiming under low-light conditions Construction Features:
• Tube Size 30 mm diameter provides maximized internal adjustment and strength.
• Single-Piece Tube Maximizes alignment for improved accuracy and optimum visual performance, as well as ensures strength and waterproofness.
• Aircraft-Grade Aluminum Constructed from a solid block of aircraft-grade aluminum for strength and rigidity.
• Waterproof O-ring seals prevent moisture, dust and debris from penetrating for reliable performance in all environments.
• Fogproof Argon gas purging prevents internal fogging over a wide range of temperatures.
• Shockproof Rugged construction withstands recoil and impact.
• Hard Anodized Finish Highly durable hard-coat anodization provides a low-glare matte surface and helps camouflage the shooter's position.
• ArmorTek ® Ultra-hard, scratch-resistant coating protects exterior lenses from scratches, oil and dirt. Internal Mechanism Design Features:
• Precision-Force Spring System Uses premium components in the erector-spring system to ensure maximum repeatability and ease of adjustment.
• Precision-Glide Erector System This system ensures the components in the zoom lens mechanism glide smoothly and cleanly through all magnification ranges. Convenience Features:
• Fast Focus Eyepiece Allows quick and easy reticle focusing.
• Built-In Accuracy Features Matching (MRAD or MOA) turrets and reticles facilitate fast and accurate shooting at extended ranges. The patented fiber optic Radius Bar visually assists tracking turret rotations. Specs:
• Magnification 1-6x
• Objective Lens Diameter 24 mm
• Eye Relief 3.8 inches
• Field of View 112.5-18.8 ft/100 yds
• Tube Size 30 mm
• Turret Style Capped
• Adjustment Graduation 1/2 MOA
• Travel Per Rotation 50 MOA
• Max Elevation Adjustment 160 MOA
• Max Windage Adjustment 160 MOA
• Parallax Setting 100 yards
• Length 10.83 inches
• Weight 22.7 oz Included in the Box:
• CR2032 battery
• Lens cloth Type:
• MRAD Reticle
• MOA Reticle]]>1https://s.turbifycdn.com/aah/optacticalgear/vortex-viper-pst-gen-ii-1-6x24-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/vortex-viper-pst-gen-ii-1-6x24-r-58.jpgVortex Opticshttps://s.turbifycdn.com/aah/optacticalgear/wallets-45.jpgcustom-itemoptacticalgear-pagemollepouchesWallets1madaevwamadaeswa1https://s.turbifycdn.com/aah/optacticalgear/wallets-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/wallets-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/warrior-glotape-infrared-ir-us-flag-patch-r-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/warrior-glotape-infrared-ir-us-flag-patch-r-47.jpgcustom-itemoptacticalgear-pageflagpatches137AF-20XX15.9512.5Warrior GloTape Infrared IR US Flag Patch (R)IR. Tools111Full color Red, White and Blue American flags reflect both IR and visible light. Per ITAR regulations, IR flags are NOT AVAILABLE FOR EXPORT. USA Addresses Only. ]]>1https://s.turbifycdn.com/aah/optacticalgear/warrior-glotape-infrared-ir-us-flag-patch-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/warrior-glotape-infrared-ir-us-flag-patch-r-60.jpgIR. Toolshttps://s.turbifycdn.com/aah/optacticalgear/watch-caps-45.jpgitem.optacticalgear-pageunclWatch Caps / Balaclavas / Neck Gaiters1arrholtwbecrprskourewiprohacxgohepewacapoptenwacapxgomifrbafarasbafrarlecowxnegauntacoweli1https://s.turbifycdn.com/aah/optacticalgear/watch-caps-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/watch-caps-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/water-bottle-pouches-54.jpgitem.optacticalgear-pagehysyWater Bottle / Jetboil Pouches1spsynawabopoplacsmfl152whsgisofttacosobl1qucanaghsmo2qtutpomsmboco1https://s.turbifycdn.com/aah/optacticalgear/water-bottle-pouches-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/water-bottle-pouches-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/water-bottles-accessories-66.jpgitem.optacticalgear-pagehysy1caprpewadekicapr20ljecancapr1li1qudecaprca1li1qupl1liflnatrwm1qtgrwna32ozgrlenasamisqwafisysamiwafisyospsamughaancapcapeoana1qtcacogi1qucaavsocanteencup1https://s.turbifycdn.com/aah/optacticalgear/water-bottles-accessories-64.jpghttps://s.turbifycdn.com/aah/optacticalgear/water-bottles-accessories-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/watertight-map-case-46.jpgcustom-itemoptacticalgear-pageadminpouches261479716.455.99Watertight Map CaseMap Case111Weight: 2 oz. ]]>1https://s.turbifycdn.com/aah/optacticalgear/watertight-map-case-53.jpghttps://s.turbifycdn.com/aah/optacticalgear/watertight-map-case-54.jpgMap Casecustom-itemoptacticalgear-pageindexWeapon / Breach1opticsmaincostweliandmocoupregrm4arupreandpm4arupgradesm4arbuttstocksm4accessoriesbaupirsibmamsypiraandgesmrotweclkiknandshbrtokibrtoacNO EXCEPTIONS]]>1https://s.turbifycdn.com/aah/optacticalgear/weapon-lasers-42.jpgcustom-itemoptacticalgear-pageniviandacWeapon Lasers / IR Illuminators1bmemawiec2thwiraxelowpowijuboxcrcorbmeaaenforecbemeyerskijirstdbdubeailasuxvircwer1https://s.turbifycdn.com/aah/optacticalgear/weapon-lasers-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-lasers-41.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-light-mounts-upgrades-41.jpgcustom-itemoptacticalgear-pagelightslasersWeapon Light Mounts1ardesiscmomrardesiscmopiardeinscmopiardeofscmomrardeofscmopiardeinscmomrardemtomadrarde600selibarde300selibardeofscmogemo18bopa1https://s.turbifycdn.com/aah/optacticalgear/weapon-light-mounts-upgrades-39.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-light-mounts-upgrades-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-lights-64.jpgcustom-itemoptacticalgear-pagelightslasersWeapon Lights and Parts1modlitepl350rmoplliparmopllipar1susclipro10lsudufuscliprsukminwhlihemomookliparmooklipaarde18seliblardemasclihemopllihemookwlihesux3ulledwewsux3ulledhaosux3ledwewhasuxvircwersum1miscprorsuz68tamo18bopaarde300selibarde600selibar18seliboonehucolionehucosh1https://s.turbifycdn.com/aah/optacticalgear/weapon-lights-62.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-lights-63.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-maintenance-51.jpgitem.optacticalgear-pageweacWeapon Maintenance1ot2cal59mmdeotridekitotriforripiotserodclkitslewl304ozboslexwelue4ozslexwelue1ozslextaclsy4oalgdegolu4ozm16clkiolemdomkitmatm1arshoffmuc1https://s.turbifycdn.com/aah/optacticalgear/weapon-maintenance-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-maintenance-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-mounted-sling-attachments-53.jpgitem.optacticalgear-pagetagslingsWeapon Mounted Sling Attachments1maasqdamslatkrdegranqdmokrdegrmlqdmomamqdslmor1ardeqdmomrmarsaqdraslamarsraslatvitalplprslm1https://s.turbifycdn.com/aah/optacticalgear/weapon-mounted-sling-attachments-50.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-mounted-sling-attachments-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-painting-46.jpgitem.optacticalgear-pageaboutgearWeapon Painting Updated 20 Jan 2015]]>1step1step2step3step4step5step6step7step8step9step10First posted OCT 2003. Since the first posting of this numerous advances in weapon camouflage and decoration have occurred, from Cerakoting, to more robust weapon specific paints. However the basics have not changed, masking, color blending, finalizing etc. Hence we will keep this here, but OPT also recommends that anyone doing this do some research on their options and the alternatives that exist such as dipping and custom camo services available. This is a step by step guide to painting your weapons. This can be tailored to the environment you are in and is only a GUIDELINE, if you have better ideas, by all means use them. OPT is posting this for informational purposes only, we are not a dealer of Springfield Armory, Sig Sauer, Harris Bipods, Hunter Specialties, or Krylon. please do not inquire about purchasing any of the equipment in this section.]]>1https://s.turbifycdn.com/aah/optacticalgear/weapon-painting-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-painting-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-retention-53.jpgitem.optacticalgear-pagebeltsWeapon Retention1t3wecabemot3bemoweca215gemuweresowereca1https://s.turbifycdn.com/aah/optacticalgear/weapon-retention-51.jpghttps://s.turbifycdn.com/aah/optacticalgear/weapon-retention-52.jpghttps://s.turbifycdn.com/aah/optacticalgear/new-items-18-july-2013-133.jpgitem.optacticalgear-pageindexNew Items, Updated 18 OCTOBER 20241fecorapofecowifecoraba20pafecopttrewh7fichplwh7alpahsreifsyfecochrigwivmohochfaprmohochduprmohobestprliedhodetanhuntafaftc4xmeoggafo60wrshspododetav2luhapokrdegrsualrotopeovantopeovpaliedhodedihagwaminovaludupomregiantsucltiflhifokidegrmredogcrprrsesimopotdelonubmodcaprca1li1quteweepspbahefispasarcav2spsybigfasaspsybrboxmrecrackersaralltjagen2crpradpocrprrsezipaprtecchxkrrecatoforskrdegranqdmohsgen2hatahsgen2ritahsgen2dodetahsgen2expitahsgen2pitahsgen2dopitahep1leiiiastcrprrsem4jufcrprrsejpcpacrprrse3bastcrprrseshpadcrprrsem4sipcrprrserasipcrprjpcrsesnpelotispplbuecpav4wispsymeslspsylbvexkitshcosikiv2hoshcoarcplv3shcoramelin1el10etteawenel10ritqcahosoli2trl2srfecobapo1crprrdrgppo8onehucorulihodefrskpahahoderagrpahahodekhpahatedshdegrgroptbudocostaxladgeniirauntafaqdleuntasushboprsunshsunandshcachsunandshtrtasunandshbigdcaprpewadekicapr20ljecancapr1li1qudeavc50airpurediapxrecadiumoapxm11sukminwhlihesuz68tafispstv3sacuboprrashbopropaspaboprloslrashplsialjafecodofrflfecokaintr55fecokaintr76fecokainhapofecokainlapofecoadmopafecofrflbukifecoshpatrrmrhdresirtopecrjatopeinjaagmimapbapaPricing is subject to change once inventory arrives based on what manufacturers dictate.]]>1https://s.turbifycdn.com/aah/optacticalgear/new-items-18-july-2013-131.jpghttps://s.turbifycdn.com/aah/optacticalgear/new-items-18-july-2013-132.jpghttps://s.turbifycdn.com/aah/optacticalgear/whiskey-7-alpha-panel-9.jpghttps://s.turbifycdn.com/aah/optacticalgear/whiskey-7-alpha-panel-10.jpgcustom-itemoptacticalgear-pagemaveclqacoXX-W7ALPHA153.99Whiskey 7 Alpha Panel111Designed and refined through rigorous use and reevaluation, the Alpha Panel is ideal for Ground Force Commanders, Tactical Leaders, CCTs/SOTACs, SWAT Assaulters, Medics, or anyone else needing to bring specialty equipment to a gun fight. Years of real-world application across the globe have proven it to be the perfect combination of rapid access to magazines, specialty tools, mission critical documentation and other like sized equipment. The Alpha Panel is a hybrid between a 6-mag chest placard and a ruggedized admin fold out. Built with streamlined access while not adding additional bulk or requiring additional admin pouches. Constructed with 500d Cordura and 1000d Laminate Fits up to 6 M-4 Mags Elastic mag slots are expandable enough to fit 40mm grenades, Flash-Bangs, TQs, initiators, handheld GPS units and like sized items. Ride height adjustable FASTEX clips (compatible with most modern plate carriers) Admin fold out board has adjustable/ lockable drop angle Removable single cord elastic retention tab folds and tucks out of the way when not needed Bottom MOLLE slits for TQ/Flashbang/Pistol mag or other single row MOLLE pouch attachment *Made with pride in FWB Florida1https://s.turbifycdn.com/aah/optacticalgear/whiskey-7-alpha-panel-11.jpghttps://s.turbifycdn.com/aah/optacticalgear/whiskey-7-alpha-panel-12.jpghttps://s.turbifycdn.com/aah/optacticalgear/whiskey-7-filo-chest-placard-24.jpghttps://s.turbifycdn.com/aah/optacticalgear/whiskey-7-filo-chest-placard-12.jpgcustom-itemoptacticalgear-pagemaveclqacoXX-W7FILO96Whiskey 7 FILO Chest Placard111Introducing the First In Last Out (FILO), the ultimate solution for assaulters who prioritize fast and efficient access to kinetic equipment. If you need a kit that is optimized for clearing buildings, working in vehicles, and maintaining a low profile while going prone, the FILO is the perfect choice. We have meticulously calculated every layer to eliminate unnecessary bulk and maximize functionality. Features: Designed to accommodate up to 6 M4 magazines, the FILO also features 3 expandable elastic sleeves that can securely hold flashbangs, initiators, tourniquets, or 40mm grenades. Additionally, we have included twin elastic slots specifically crafted to fit essentials like a Jimmy tool and other lock bypass tools. Similar to our Alpha Panel, the FILO is right height adjustable, allowing you to customize the fit to your plate carrier. The bungee top retainers are easily removable, offering versatility and convenience. SPECS: We have incorporated an envelope-style admin panel into the base layer of the FILO, providing a dedicated space for small items such as a notepad, GRG, or similarly sized essentials. Furthermore, laser-cut MOLLE slots have been strategically positioned at the bottom, enabling you to attach extra flashbangs, pistol magazines, white lights, or other single-column MOLLE pouches. Crafted from bomb-proof laminated Cordura® nylon, the FILO ensures exceptional durability and longevity. This placard is built to withstand the toughest conditions, guaranteeing a lifetime of reliable performance. NOTES: *Compatible with most other harnesses and carriers. 1https://s.turbifycdn.com/aah/optacticalgear/whiskey-7-filo-chest-placard-13.jpghttps://s.turbifycdn.com/aah/optacticalgear/whiskey-7-filo-chest-placard-14.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-g69-nvg-mount-system-r-48.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-g69-nvg-mount-system-r-46.jpgcustom-itemoptacticalgear-pagenvgmosowiing69mnt637.41Wilcox G69 NVG Mount System (R)Wilcox Industries111The G69 does NOT have a detachable mount. The entire system is permanently assembled. It features all the same adjustment ranges found in traditional Wilcox designs, but sits closer to the helmet surface. Please note that the Wilcox G69 IS NOT compatible with USGI bayonet j-arms. Compatibility: AN/PVS-15 • AN/PVS-18 • AN/PVS-31 (L3Harris BNVD & BNVD1531) • GPNVG-18 (DOVETAIL) • AN/PSQ-36 FGS (DOVETAIL)
•*Other NVG/THERMAL devices are compatible but require additional accessories. Please call customer service for more information. SPECS
• Manufacturer: Wilcox Industries
• Materials: Lightweight Aerospace Aluminum, Polymer
• Height Adjust: 0.900in Total Vertical Travel
• View to Stow: 130º Travel
• Finite Tilt: 0-15º Tilt
• Travel: 1.300in Total Fore/Aft Travel
• Auto On-Off: Applicable w/ Wilcox Metal Interface Shoes
• Warranty: 5 Year Warranty Made in the USA. Export Restricted, USA Addresses Only. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/wilcox-g69-nvg-mount-system-r-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-g69-nvg-mount-system-r-60.jpgWilcox Industrieshttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-amber-filter-cover-assembly-r-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-amber-filter-cover-assembly-r-44.jpgcustom-itemoptacticalgear-pagenvgmoso14134000G0365.87Wilcox Industries Amber Filter Cover Assembly (R)Wilcox Industries111• Quickly Attaches and Detaches an array of Night Vision Goggles and Scopes
• Padded Rubber Eye Cup protects eye socket from impact injury
• Amber Filter reduces Green Eye Splash common to all NVG Devices
• Molded Rubber Eyepiece Eliminates NVG Light Pollution from Escaping the Eyepiece
• Flat Matte Finish Made in the USA. Export Restricted, USA Addressed Only. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-amber-filter-cover-assembly-r-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-amber-filter-cover-assembly-r-58.jpgWilcox Industrieshttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-an-pvs-14-arm-mount-with-nvg-interface-shoe-r-31.jpgcustom-itemoptacticalgear-pagenvgmoso14126300G01260.7Wilcox Industries AN/PVS-14 Arm Mount with NVG Interface Shoe (R)Wilcox Industries111• Weight: 2.08 oz.
• Material Construction: Lightweight Aluminum, Polymer
• Accommodates: AN/PVS-14
• Flip Mechanism: 110º Travel (Left or Right Eye)
• Auto On-Off Feature: No Made in the USA. Export Restricted, USA Addressed Only. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-an-pvs-14-arm-mount-with-nvg-interface-shoe-r-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-an-pvs-14-arm-mount-with-nvg-interface-shoe-r-41.jpgWilcox Industrieshttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-g24-low-profile-breakaway-mount-r-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-g24-low-profile-breakaway-mount-r-39.jpgcustom-itemoptacticalgear-pagenvgmoso14128300G24527.31484.95Wilcox Industries G24 Mount - Updated Model (R)Wilcox Industries111Current model features the same fore/aft length adjustment as the G22 mount. The Wilcox L4 G24 Low Profile Breakaway Mount allows firm attachment of a variety of NVGs to a MICH/ACH helmet using an Ops-Core VAS or standard Army shroud. This NVG mounting system allows the mount to "break away" from the base under a stressed condition, such as when prompted by interference during fast roping, maritime operations, hard impact or when entering or exiting mobility platforms. Without the Wilcox breakaway feature, the potential for induced neck injury and NVG breakage are increased. The Wilcox L4 G24 NVG Mounting Systems Product Line is featured with a wide range of adjustments to customize the position of the Night Vision Goggle for proper eye position, and provide a maximum low profile position to the helmet. Features:
• Lock Release Lever allows NVG height to be easily adjusted up or down, then secured.
• A Mount Release Lever allows the operator to easily set the desirable mode (breakaway or locked), depending upon operational needs.
• An ergonomically placed Flip Release Button allows the Mount to “"ip up” to a stowed position when the goggle is attached. This pivot mechanism is simple and robust by design and cannot loosen over time.
• A Tilt Adjustment Knob allows the operator to fine adjust the tilt angle of the NVG.
• A Fore/Aft Release Lever allows for fore/aft travel of the goggle. Releasing the lever allows the operator to set the fore/aft position of the goggle.
• An ergonomically placed NVG Release Button allows for one handed release of the NVG Specs:
• Materials: Lightweight Aerospace Aluminum, Polymer
• Height Adjust: 0.900″ Total Vertical Travel
• View to Stow Adjustment: 130º Travel
• Tilt Adjustment: 0-15º
• Fore/Aft Travel: 1.4″ Total
• Auto On-Off: Applicable w/ Wilcox Metal Interface Shoes Made in the USA. Export Restricted, USA Addressed Only. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-g24-low-profile-breakaway-mount-r-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-g24-low-profile-breakaway-mount-r-50.jpgWilcox Industrieshttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-g70-nvg-mount-system-r-40.jpgcustom-itemoptacticalgear-pagenvgmoso14128300G70664.15Wilcox Industries L4 G70 NVG Mount System (R)Wilcox Industries111Current model G24 mount features the same fore/aft length adjustment as the G22 mount. The Wilcox L4 G70 Low Profile Breakaway Mount System includes a G24 NVG Mount with 3-Hole Shroud and Lanyard Assembly, allowing the user to attachment of a variety of NVGs to a MICH/ACH helmet using a three-hole shroud. This NVG mounting system allows the mount to “break away” from the base under a stressed condition, such as when prompted by interference during fast roping, maritime operations, hard impact or when entering or exiting mobility platforms. This reduces the risk of neck injury and potential damage to the NVGs. Lanyard Assembly ensures that your night vision is tehthered and will not fall to the ground if knocked loose. The Wilcox L4 G70 option features a Wilcox three-hole shroud, and provides easy attachment of the mount to any helmet drilled with a standard three-hole configuration. Features:
• Dimensions (Operational) 3.98" L x 2.60" W x 2.40" H
• Weight (G24 Mount Only) .36 lb (5.76 oz)
• Weight (Three Hole Shroud Only) .10 lb (1.6 oz)
• Material Construction Light Weight, Aerospace Grade Metal
• Vertical Height Adjustment .900" Total Travel
• Fore/Aft Travel 1.40" Total Travel Made in the USA. Export Restricted, USA Addressed Only. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-g70-nvg-mount-system-r-49.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-g70-nvg-mount-system-r-50.jpgWilcox Industrieshttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-series-hybrid-3-hole-1-hole-shroud-r-31.jpgcustom-itemoptacticalgear-pagenvgmoso14156100G38129.27Wilcox Industries L4 Series Hybrid 3 Hole / 1 Hole Shroud (R)Wilcox Industries111• 1 Hole or 3 Hole mounting capability
• Made from lightweight Aerospace Aluminum and Polymer
• Includes mounting hardware with long and short bolts
• 4 molded recesses provide mounting points for bungees such as those found on the Ops Core FAST Helmets and the Crye Precision Airframe.
• Rubber gripping pad for mounting between the shroud and helmet provides stability and vibration deadening. Made in the USA. Export Restricted, USA Addressed Only. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-series-hybrid-3-hole-1-hole-shroud-r-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-series-hybrid-3-hole-1-hole-shroud-r-41.jpgWilcox Industrieshttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-series-three-hole-shroud-23.jpgcustom-itemoptacticalgear-pagenvgmoso14156100G3573.8Wilcox Industries L4 Series Three Hole Shroud (R)Wilcox Industries111• Accommodates: Wilcox G24 NVG Mount, Wilcox G22 Mount, Wilcox ANVIS/ PVS-23 Mount, Wilcox G11 Mount,
• Norotos AKA2 Mount, Norotos INVG Mount, U.S. Army Standard Rhino Arm
• Material Construction: Lightweight Aluminum, Polymer
• Weight: 2.2 oz
• Includes mounting hardware with long and short bolts Made in the USA. Export Restricted, USA Addressed Only. This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-series-three-hole-shroud-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-industries-l4-series-three-hole-shroud-30.jpgWilcox Industrieshttps://s.turbifycdn.com/aah/optacticalgear/wilcox-junction-box-crane-connector-r-19.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-junction-box-crane-connector-r-17.jpgcustom-itemoptacticalgear-pageweaponlasers1416533G0798.22Wilcox Junction Box - Crane Connector (R)Wilcox Industries111litowiraxeloJunction Box only - no other parts/lasers included ITAR Restricted. Continental USA Shipping Addresses Only. This Item is Excluded from All Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/wilcox-junction-box-crane-connector-r-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-junction-box-crane-connector-r-30.jpgWilcox Industrieshttps://s.turbifycdn.com/aah/optacticalgear/wilcox-raid-xe-low-power-r-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-raid-xe-low-power-r-18.jpgcustom-itemoptacticalgear-pageweaponlasers14126500G123599.993199.99Wilcox RAID Xe Low Power (R)Wilcox Industries111raxespshlitowijuboxc• One optical bench houses a VIS laser, NIR laser, and NIR VCSEL Illuminator
• Adjustable NIR VCSEL illuminator and wide angle NIR VCSEL Room illuminator project precise, speckle-free beams for extreme clarity and optimal combat identification
• NIR room illuminator provides 40º flood capabilities
• Optical bench is aligned to weapon by one windage and one elevation adjustment
• Powered by one (1) CR123 3V battery
• Multi-function keypads provide flexibility in programing custom options
• Five (5) selectable pulse modes on VIS/NIR lasers settings
• Remote port accepts Wilcox ERGOCTO Xe line of pressure pads and control grips
• User interchangeable modular visor/laser safety cover
• The Wilcox ERGOCTO Xe Activation Keypad is INCLUDED, featuring 3 fully programmable buttons including vis-override option SPECIFICATIONS - LOW POWER
• Immersion: 1 meter for 1 hour
• Boresight Retention: <.5 mrad
• Laser Type/Wavelength/Power*: Red Visible Laser/640nm/3mW
• Laser Type/Wavelength/Power*: Infrared Laser/850nm/3.5mW
• Laser Type/Wavelength/Power*: Infrared Illuminator/840nm/25mW
* Nominal Output Power is subject to +/-10% tolerance.
For Laser Safety use Nominal Output Power + 20%. ITAR Restricted. Continental USA Shipping Addresses Only. This Item is Excluded from All Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/wilcox-raid-xe-low-power-r-31.jpghttps://s.turbifycdn.com/aah/optacticalgear/wilcox-raid-xe-low-power-r-32.jpgWilcox Industrieshttps://s.turbifycdn.com/aah/optacticalgear/wogesirapa-jpg-23.jpghttps://s.turbifycdn.com/aah/optacticalgear/woobie-gear-silkies-ranger-panties-57.jpgcustom-itemoptacticalgear-pageshortsXX301X24.99Woobie Gear Silkies - Ranger PantiesWoobie Gear111• 100% Four-Way Stretch Polyester Fabric
• Internal Liner
• Internal key pocket Guarantee:
• We stand by our products. If you're unhappy, we will make it right. Portion of profits to organizations supporting Active Duty and Retired Millitary Personnel ]]>1https://s.turbifycdn.com/aah/optacticalgear/woobie-gear-silkies-ranger-panties-67.jpghttps://s.turbifycdn.com/aah/optacticalgear/woobie-gear-silkies-ranger-panties-68.jpgWoobie Gearhttps://s.turbifycdn.com/aah/optacticalgear/woobie-gear-woobie-hoodie-91.jpghttps://s.turbifycdn.com/aah/optacticalgear/woobie-gear-woobie-hoodie-89.jpgcustom-itemoptacticalgear-pagejaveswXXWGWH59.99Woobie Gear Woobie HoodieWoobie Gear111SIZING:
READ SIZE INFO BELOW BEFORE ORDERING The Woobie Hoodie utilizes the same material as the military’s Poncho Liner - originally issued to soldiers who needed a lightweight, packable, and insulating layer that dries quickly. The Woobie Hoodie is the perfect mid-layer to keep you comfortable on the move and in camp. Sizing:
These are generously sized to fit over clothing and have that Woobie feel. Go with your normal T-Shirt size or consider going down a size for best fit. Do not size up unless you want a billowing fit. For example: if you can wear a Medium or Large T-Shirt, go with a Medium Woobie Hoodie. Features:
• DWR coating protects from light valley rain and snow
• Active insulation keeps your body temp regulated and breathes while you move (designed for light movements and activity, NOT designed to be breathable during high intensity activities)
• Lightweight, compressible and packable Specs:
• 100% Polyester Insulation
• Durable Water Repellent (DWR) treated
• 100% Ripstop Nylon Shell
• NOTE: "Ranger Green" color looks similar to OD Green (see small photo above) Guarantee:
• We stand by our products, if you’re unhappy we will make it right
• Portion of profits to organizations supporting Active Duty and Retired Military Personnel ]]>1https://s.turbifycdn.com/aah/optacticalgear/woobie-gear-woobie-hoodie-102.jpghttps://s.turbifycdn.com/aah/optacticalgear/woobie-gear-woobie-hoodie-103.jpgWoobie Gearhttps://s.turbifycdn.com/aah/optacticalgear/woobie-gear-woobie-jacket-zippered-114.jpghttps://s.turbifycdn.com/aah/optacticalgear/woobie-gear-woobie-jacket-zippered-104.jpgcustom-itemoptacticalgear-pagejaveswXXWGWJ74.99Woobie Gear Woobie Jacket V2 - ZipperedWoobie Gear111SIZING:
READ SIZE INFO BELOW BEFORE ORDERING Note: This is a new V2 iteration of the Woobie Jacket featuring a zippered chest pocket, drawcord hem, with black interior and cuffs. The Woobie Jacket utilizes the same material as the military’s Poncho Liner - originally issued to soldiers who needed a lightweight, packable, and insulating layer that dries quickly. The Woobie Jacket is the perfect mid-layer to keep you comfortable on the move and in camp. Sizing:
These are generously sized to fit over clothing and have that Woobie feel. Go with your normal T-Shirt size or consider going down a size for best fit. Do not size up unless you want a billowing fit. For example: if you can wear a Medium or Large T-Shirt, go with a Medium Woobie Jacket. Features:
• DWR coating protects from light valley rain and snow
• Active insulation keeps your body temp regulated and breathes while you move
• Lightweight, compressible and packable
• Zippered Chest Pocket
• Drawcord Hem to adjust fit at the bottom
• black interior lining and cuffs Specs:
• 100% Polyester Insulation
• Durable Water Repellent (DWR) treated
• YKK Zipper
• 100% Ripstop Nylon Shell Guarantee:
• We stand by our products, if you’re unhappy we will make it right
• Portion of profits to organizations supporting Active Duty and Retired Military Personnel ]]>1https://s.turbifycdn.com/aah/optacticalgear/woobie-gear-woobie-jacket-zippered-105.jpghttps://s.turbifycdn.com/aah/optacticalgear/woobie-gear-woobie-jacket-zippered-106.jpgWoobie Gearhttps://s.turbifycdn.com/aah/optacticalgear/wrist-document-holders-45.jpgitem.optacticalgear-pagemollepouchesWrist Document Holders1maasarmbosohtswrpasunandshbigd1https://s.turbifycdn.com/aah/optacticalgear/wrist-document-holders-43.jpghttps://s.turbifycdn.com/aah/optacticalgear/wrist-document-holders-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/xgo-heavyweight-performance-watch-cap-ph4-12.jpgcustom-itemoptacticalgear-pagewatchcapsXGO4P54H2317.25XGO Heavyweight Performance Watch Cap (PH4)XGO111Gear Specs
- Fabric: 87% Acclimate® Dry Polyester /13% Spandex Tech Face Fleece
- Weight: 8.0 oz./sq. yd. / 226 grams
- Sizing: One Size Fits All
- Fit: Contoured Fit Features
- Tech Face Smooth Face - Easy For Layering
- Brushed Fleece Next-To-Skin - Traps In Body Heat
- Designed To Be Compatible With Helmets - Will Not Cause Bunching
- Acclimate® Dry Moisture Management (Superior Wicking / Drying)
- Ag47® Anti-Microbial / Anti-Odor Protection
- Clean Seam® Next-To-Skin Comfort
- UPF UV Protection - 50+
- Durable, Breathable & Won’t Shrink Made in the USA, 100% Berry Compliant ]]>1https://s.turbifycdn.com/aah/optacticalgear/xgo-heavyweight-performance-watch-cap-ph4-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/xgo-heavyweight-performance-watch-cap-ph4-21.jpgXGOhttps://s.turbifycdn.com/aah/optacticalgear/xgo-lightweight-assaulter-combat-t-shirt-fr-pocket-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/xgo-lightweight-assaulter-combat-t-shirt-fr-pocket-27.jpgcustom-itemoptacticalgear-pagecombatshirtsXGO1F16RPWP10075XGO Lightweight Assaulter Combat T-Shirt FR (Pocket)XGO111litosichSee Bottom of the Page for Link to Sizing Chart and Fit Guide. Lightweight Assaulter Combat T-Shirt (Pocket) FR Phase 1 is one of the lightest most durable FR fabrics on the market. FR Phase 1 is a lightweight patented blend of Modacrylic & FR Rayon, inherent at the yarn level, providing FR protection for the life of the garment. Superior Acclimate® Dry Moisture Management wicks sweat away from the body and dries rapidly. AG47® Silver Anti-Microbial fights and eliminates harmful bacteria from your sweat leaving you odor free. Clean Seam® provides unparalleled next-to-skin comfort. Gone are the days of uncomfortable FR base layers. Build your base with the best FR base layers on the market and worry less about your base layers and more about the mission at hand! Features
- Acclimate® Dry Moisture Management (Superior Wicking / Drying)
- Ag47® Anti-Microbial / Anti-Odor Protection
- High Rugby Collar Design that can fold down as needed for added neck protection from slings and straps
- Adjustable Velcro V-neck - Enhanced Ventilation When Needed
- Rolled Shoulders - Removes Seam Off Shoulder Eliminating Plate Carrier/Pack Friction/Irritation
- Under Arm Gussets - Increased Mobility / Reduced Irritation
- Extra Body Length - Stays Tucked In
- Clean Seam® Next-To-Skin Comfort
- UPF UV Protection - 25+
- Durable, Breathable & Won’t Shrink Made in the USA, 100% Berry Compliant ]]>1https://s.turbifycdn.com/aah/optacticalgear/xgo-lightweight-assaulter-combat-t-shirt-fr-pocket-40.jpghttps://s.turbifycdn.com/aah/optacticalgear/xgo-lightweight-assaulter-combat-t-shirt-fr-pocket-41.jpgXGOhttps://s.turbifycdn.com/aah/optacticalgear/xgo-midweight-fr-balaclava-fr2-11.jpgcustom-itemoptacticalgear-pagewatchcapsXGO2F54B4130.75XGO Midweight FR Balaclava (FR2)XGO111Gear Specs
- Fabric: a Patented blend of Modacrylic & FR Rayon
- Inherently FR At Yarn Level - FR Protection For Life Of Garment
- ASTM D6413 Standard
- Weight: 5.5 oz./sq. yd. / 155 grams
- Sizing: One Size Fits All
- Fit: Contoured Fit Features
- Acclimate® Dry Moisture Management (Superior Wicking / Drying)
- Ag47® Anti-Microbial / Anti-Odor Protection
- Clean Seam® Next-To-Skin Comfort
- UPF UV Protection - 25+
- Durable, Breathable & Won’t Shrink Made in the USA, 100% Berry Compliant]]>1https://s.turbifycdn.com/aah/optacticalgear/xgo-midweight-fr-balaclava-fr2-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/xgo-midweight-fr-balaclava-fr2-21.jpgXGOhttps://s.turbifycdn.com/aah/optacticalgear/xgo-multicam-performance-combat-shirt-nonfr-18.jpghttps://s.turbifycdn.com/aah/optacticalgear/xgo-multicam-performance-combat-shirt-nonfr-16.jpgcustom-itemoptacticalgear-pagecombatshirtsXGO190XGO MultiCam Performance Combat Shirt (NonFR)XGO111Specifications
- Fabric: 86% Acclimate® Dry Polyester / 14% Spandex (Sleeves - PH4)
- Fabric: 100% Acclimate® Dry Polyester (Body - PH1)
- Weight: 8.5 oz./sq. yd. / 241 grams (Sleeves - PH4)
- Weight: 4.0 oz./sq. yd. / 114 grams (Body - PH1)
- Sizing: Men's Sizing/Fit
- Fit: Athletic Fit Features
- Acclimate® Dry Moisture Management (Superior Wicking / Drying)
- Ag47® Anti-Microbial / Anti-Odor Protection
- Accessible Zipper Storage Pockets With External Velcro Loop (both arms)
- Reinforced Elbow And Forearm Protection
- Pencil Pocket
- Rolled Shoulders - Removes Seam Off Shoulder Eliminating Plate Carrier/Pack Friction/Irritation
- Under Arm Gussets - Increased Mobility / Reduced Irritation
- Zipper Cover - Under Chin Protection When Fully Zipped
- Extra Body Length - Stays Tucked In
- Clean Seam® Next-To-Skin Comfort
- Superior Hand/Feel
- UPF UV Protection - 35+
- Durable, Breathable & Won't Shrink Made in the USA, 100% Berry Compliant]]>1https://s.turbifycdn.com/aah/optacticalgear/xgo-multicam-performance-combat-shirt-nonfr-29.jpghttps://s.turbifycdn.com/aah/optacticalgear/xgo-multicam-performance-combat-shirt-nonfr-30.jpgXGOhttps://s.turbifycdn.com/aah/optacticalgear/xgo-ocp-dwr-poncho-nonfr-12.jpgcustom-itemoptacticalgear-pageinoulal7XGOPONCHOP89.9539.95XGO OCP DWR Poncho (NonFR)XGO111Specifications
- Fabric: 100% DWR Rip-Stop Nylon
- Fabric Weight: 2.0 oz./sq. yd. / 57 grams
- Fit: Loose Fit (Designed to wear over outer layers) Features
- DWR (Durable Water Repellent) Treated To Help Repel Wet Conditions
- PU (Polyurethane) Coated Next-To-Skin
- NIR Treated
- Wind and Water Repellant for Protection During Inclement Weather
- Large Front Cargo/Storage Pocket
- Poncho Can Be Stuffed Into Itself Via Large Front Cargo Pocket
- Chord with Stoppers Made in the USA, 100% Berry Compliant]]>1https://s.turbifycdn.com/aah/optacticalgear/xgo-ocp-dwr-poncho-nonfr-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/xgo-ocp-dwr-poncho-nonfr-21.jpgXGOhttps://s.turbifycdn.com/aah/optacticalgear/xgo-ocp-dwr-rain-suit-nonfr-12.jpgcustom-itemoptacticalgear-pageinoulal7XGORAIN3N1P169.9569.95XGO OCP DWR Rain Suit (NonFR)XGO111Specifications
- Fabric: 100% DWR Rip-Stop Nylon
- Fabric Weight: 2.0 oz./sq. yd. / 57 grams
- Jacket/Pant/Bag Weight: 1.25 lbs. / .57 kg
- Sizing: Men's Sizing/Fit
- Fit: Loose Fit (Designed to wear over outer layers) Features
- Includes - DWR Jacket, DWR Pant And DWR Standalone Stuff Sack
- DWR (Durable Water Repellent) Treated To Help Repel Wet Conditions
- PU (Polyurethane) Coated Next-To-Skin
- NIR Treated
- Wind and Water Repellant for Protection During Inclement Weather
- Large Jacket Cargo/Storage Pockets
- Large Pants Cargo/Storage Pockets
- DWR Zippers
- 15" DWR Side Pants Zippers Allow For Easy On/Off Over Outer Layers + Boots
- Chord with Stoppers Made in the USA, 100% Berry Compliant ]]>1https://s.turbifycdn.com/aah/optacticalgear/xgo-ocp-dwr-rain-suit-nonfr-20.jpghttps://s.turbifycdn.com/aah/optacticalgear/xgo-ocp-dwr-rain-suit-nonfr-21.jpgXGOhttps://s.turbifycdn.com/aah/optacticalgear/xmre-1300xt-case-of-12-frh-6-menus-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/xmre-1300xt-case-of-12-frh-6-menus-44.jpgcustom-itemoptacticalgear-pagexmretoeatme95XMRE12H199.99139.99XMRE 1300XT – CASE OF 12 FRH– 6 MENUSXMRE111UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. If ordering multiple boxes, additional shipping fees may apply. This is to due to item's size. NO RETURNS ON FOOD ITEMS The XMRE® 1300XT® provides 1,200 – 1,500 calories of US military grade, ready to eat meal components. All components are field tested and fully cooked so they can be eaten right out of the pouch. The 1300XT® is always freshly packed. The XMRE® 1300XT® is designed as a military MRE (MEAL -READY-TO-EAT) that can also meet the needs of the civilian market. Each XMRE® 1300XT® contains:
• Entrée: Variety of beef, chicken, turkey, pork, tuna, pizza or vegetarian options.
• Bread item: Crackers, breads or tortillas.
• Beverage: Single or assorted fruit flavored drink mixes or others available
• Snack Components: Variety of 2 or more of sweet and savory snacks including but not limited to: Dessert cookies, bars,spreads, side dishes, seeds, chickpeas, nut mixes, dry fruit, corn nuts, pound cakes or others available
• Accessory kit including: Utensil(s) , napkin and condiments and some may include moist towelette, single serve instant coffee non-dairy cream and sugar Flameless Ration Heater (FRH): Included All components are packed in high-density water and tamper proof XMRE XT Series outer bag FEATURES:
• All U.S. military grade components
• Fully cooked meals, no water required to reconstitute food
• No refrigeration required
• Lightweight, durable and waterproof packaging
• Extended Shelf life
• Lot number (pack date) embossed on bag and printed on case
• Case Weight: 18 lbs This item is one case of 12 meals, two each of six menus FRH VERSION = HEATER INCLUDED UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. If ordering multiple boxes, additional shipping fees may apply. This is to due to item's size. NO RETURNS ON FOOD ITEMS This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/xmre-1300xt-case-of-12-frh-6-menus-59.jpghttps://s.turbifycdn.com/aah/optacticalgear/xmre-1300xt-case-of-12-frh-6-menus-60.jpgXMREhttps://s.turbifycdn.com/aah/optacticalgear/xmre-3000xt-24hr-case-of-6-meals-frh-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/xmre-3000xt-24hr-case-of-6-meals-frh-44.jpgcustom-itemoptacticalgear-pagexmretoeatme95XM3000XTH6214.99169.99XMRE 3000XT 24HR – CASE OF 6 MEALS FRHXMRE111UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. If ordering multiple boxes, additional shipping fees may apply. This is to due to item's size. NO RETURNS ON FOOD ITEMS The XMRE® 24HR Ration provides a full day’s worth of US military grade, ready to eat meal components. Each ration provides 2500-3000 calories. The XMRE® 24HR Ration provides the nutrients and caloric value for 24 hours of intense activity. All components are field tested and fully cooked so they can be eaten right out of the pouch. The XMRE® 24HR Ration is always freshly packed and is designed as a military MRE that can also meet the needs of the civilian market. Each XMRE® 24 Hour Ration contains a variety of:
• Entrée:Variety of beef, chicken, tuna, pork or vegetarian options
• Bread Item:Crackers, breads or tortillas.
• Spread:Peanut butter, cheese spreads, fruit jellies, fruit jams or others
• Snack: Nut raisin mix, dry fruit mix, corn nuggets, chickpeas or others.
• Side: Wet packed fruit, side dishes, bars or others.
• Dessert: Brownies, dessert cookies, bars or others.
• Beverage: Single or assorted fruit flavored drink mixes or others available.
• Breakfast Beverage: Cappuccino, cocoa beverage, coffee, or others. Accessory kit including: Utensil(s), napkin and condiments and some may include moist towelette, single serve instant coffee non-dairy cream and sugar All components are packed in high-density water and tamper proof outer bag. FEATURES:
• All U.S. military grade components
• Fully cooked meals, no water required to reconstitute food
• No refrigeration required
• Lightweight, durable and waterproof packaging
• Extended Shelf life
• Lot number (pack date) embossed on bag and printed on case
• Case Weight: 17 lbs This item is one case of six full day meals FRH VERSION = HEATER INCLUDED UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. If ordering multiple boxes, additional shipping fees may apply. This is to due to item's size. NO RETURNS ON FOOD ITEMS This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/xmre-3000xt-24hr-case-of-6-meals-frh-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/xmre-3000xt-24hr-case-of-6-meals-frh-58.jpgXMREhttps://s.turbifycdn.com/aah/optacticalgear/xmre-blue-line-case-of-12-frh-46.jpghttps://s.turbifycdn.com/aah/optacticalgear/xmre-blue-line-case-of-12-frh-44.jpgcustom-itemoptacticalgear-pagexmretoeatme95XMREBL2H199.99139.99XMRE BLUE LINE – CASE OF 12 FRHXMRE111UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. If ordering multiple boxes, additional shipping fees may apply. This is to due to item's size. NO RETURNS ON FOOD ITEMS The XMRE BlueLine® provides 800 to 1,200 calories of high quality shelf stable components. All components are fully cooked so they can be eaten right out of the pouch. The XMRE Blue line® has been specifically engineered to meet the critical requirements of government institutions, medical facilities, educational institutions, municipal entities, Law Enforcement, public service entities, and emergency preparedness programs. Each XMRE Blue Line® contains:
Entrée, 2-3 side items, beverage, and an accessory kit including spoon, napkin condiment kit and a flameless ration heater (FRH). All components are packed in high density water and tamper proof XMRE Blue Line® outer bag and embossed with a lot number (pack date) on each bag and case. FEATURES:
• Fully cooked meals, no water required to reconstitute food
• No refrigeration required
• Lightweight, durable and waterproof packaging
• Extended Shelf life
• Lot number (pack date) embossed on bag and printed on case CONFIGURATION:
• 12 meals per case
• 6 menus per case COMPONENT DETAILS:
• Entrée: Variety of beef, tuna, chicken, pork, pizza or vegetarian options.
• Side Item: Crackers, breads or tortillas, peanut butter, cheese spread, fruit jellies, fruit jams, nut raisin mix, Peanuts, dry fruit mix, corn nuggets or others, wet packed fruit, side dishes, bars or others, puddings, pound cakes, brownies, dessert cookies or others.
• Beverage: Single or assorted fruit flavored drink mixes or others available.
• Accessory Kit Includes: Spoon, napkin and some may include condiments and /or moist towelette. Case Weight: 15.0 lbs FRH VERSION = HEATER INCLUDED UPS SHIPPING OPTIONS ONLY. No $7.95 Flat Rate for this item. If ordering multiple boxes, additional shipping fees may apply. This is to due to item's size. NO RETURNS ON FOOD ITEMS This Item is Excluded from Limited Sale Coupon Codes]]>1https://s.turbifycdn.com/aah/optacticalgear/xmre-blue-line-case-of-12-frh-57.jpghttps://s.turbifycdn.com/aah/optacticalgear/xmre-blue-line-case-of-12-frh-58.jpgXMREhttps://s.turbifycdn.com/aah/optacticalgear/xmre-ready-to-eat-meals-40.jpgcustom-itemoptacticalgear-pagehysyXMRE Ready to Eat Meals1xm13caof12frxmbllicaof12mregiantxm3024caof6m1https://s.turbifycdn.com/aah/optacticalgear/xmre-ready-to-eat-meals-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/xmre-ready-to-eat-meals-39.jpglink.irtoupthzeta1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4415.jpglink.jezipcosy1https://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4227.jpghttps://s.turbifycdn.com/aah/optacticalgear/this-product-can-expose-you-to-chemicals-including-lead-which-is-known-to-the-state-of-california-to-cause-cancer-and-other-reproductive-harm-4228.jpglink.irtounze25me1https://s.turbifycdn.com/aah/optacticalgear/zev-ar15-wedge-lock-9-25-inches-r-29.jpgcustom-itemoptacticalgear-pagem4arupreandp48HG556WEDGE9292279ZEV AR15 Wedge Lock 9.25 inches (R)ZEV Technologies111Technical Specs:
- Black type III hard anodized aluminum hand guard
- Black Nitride coated wedge system
- One piece free float design with continuous top rail
- Compatible with low profile gas bocks
- Integral anti-rotation pin compatible with ZEV billet upper ensures consistent alignment of the top rail
- M-LOK compatible accessory mounting points for user customization
- Internal diameter of 1.225”
- NOTE: The ZEV Wedge Lock is not designed for a suppressor to be mounted under the hand guard. Included Components
- Wedge System
- Titanium Barrel Nut
- Assembly Tools Material
- Aluminum with Titanium Barrel Nut Made in the USA ]]>1https://s.turbifycdn.com/aah/optacticalgear/zev-ar15-wedge-lock-9-25-inches-r-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/zev-ar15-wedge-lock-9-25-inches-r-39.jpgZEV Technologieshttps://s.turbifycdn.com/aah/optacticalgear/zev-combat-night-sight-set-215-tritium-front-with-orange-ring-tritium-rear-r-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/zev-combat-night-sight-set-215-tritium-front-with-orange-ring-tritium-rear-r-43.jpgcustom-itemoptacticalgear-pagestweliandmo48SIGHTSET215NSCOM3NSB142129.99ZEV Combat Night Sight Set - .215 Tritium Front with Orange Ring - Tritium Rear (R)ZEV Technologies111ZEV Combat Night Sights give shooters a durable high visibility iron sight option that works in all lighting conditions. Designed to be identical in form and function to ZEV's current fiber optic combat sight set but with the addition of tritium vials for low light illumination. The front sight has a narrow bright orange ring surrounding the tritium dot for daytime use. The rear sight has two tritium dots, has an angled edge to aid in one handed operation of the slide, and does not overhang the RMR optic cut. Due to the low mounting of an RMR with our patented optic cut, it still provides a lower 1/3 co-witness with an RMR mounted. Assembled in the USA with Swiss tritium for maximum brightness. NOTE: 12 year warranty coverage and service life of the tritium ZEV Night Sights contain tritium, which is a radioactive material for illumination during low light conditions. The radiation emitted by tritium is only a hazard if the tritium vial is broken and is ingested or inhaled. If you suspect that a sight containing a tritium vial has broken, do not attempt to disassemble the sight. Call ZEV Customer Service for return authorization.1https://s.turbifycdn.com/aah/optacticalgear/zev-combat-night-sight-set-215-tritium-front-with-orange-ring-tritium-rear-r-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/zev-combat-night-sight-set-215-tritium-front-with-orange-ring-tritium-rear-r-57.jpgZEV Technologieshttps://s.turbifycdn.com/aah/optacticalgear/zev-z19-duty-stripped-slide-with-rmr-cut-gen-5-black-r-37.jpghttps://s.turbifycdn.com/aah/optacticalgear/zev-z19-duty-stripped-slide-with-rmr-cut-gen-5-black-r-36.jpgcustom-itemoptacticalgear-pagestweliandmo48SLDZ195GDUTYRMRBLK330323.4ZEV Glock Gen 5 Duty Slide with RMR Cut - Stripped (R)ZEV Technologies111thprcanexyou2Replacement Slide for Glock Gen 5 Pistols. The Duty slides feature the same workmanship and quality that ZEV is known for with a functionally driven design and utilitarian coating for the no-nonsense shooter who is looking to complete a new frame build or to enhance the functionality of their Glock. The black nitride finish provides a durable coating and the patented ZEV RMR cut enables the use of red dot sights using an RMR installation footprint. ZEV reduced the cost, but not the quality. Machined from 17-4 Stainless steel billet Lowered ejection port to aid in ejection of brass Match grade, precision milled tolerances that are tighter than factory Improved accuracy and grouping performance upon installation Torx wrench and two sets of RMR screws (tall and short) included NOTE: ZEV RMR Cover Plate NOT included. Sold Separately.]]>1https://s.turbifycdn.com/aah/optacticalgear/zev-z19-duty-stripped-slide-with-rmr-cut-gen-5-black-r-45.jpghttps://s.turbifycdn.com/aah/optacticalgear/zev-z19-duty-stripped-slide-with-rmr-cut-gen-5-black-r-46.jpgZEV Technologieshttps://s.turbifycdn.com/aah/optacticalgear/zev-optimized-match-barrel-g19-gen-1-5-1-2-x-28-thread-dlc-r-29.jpgcustom-itemoptacticalgear-pagestweliandmo48BBL19OPTTHDLC303289ZEV Optimized Match Barrel - G19 - Gen 1-5 - 1/2 x 28 Thread - DLC (R)ZEV Technologies111thprcanexyou32ZEV Technologies Optimized Match Barrels have been redesigned for improved performance and Gen5 compatibility. Enhanced features include a recessed target crown, a new match chamber, and a stylized barrel hood with caliber and model engravings and a loaded chamber indicator. ZEV’s proprietary broach cut 1 in 14” left hand twist rifling was developed to create the most accurate Glock aftermarket barrel available, and testing confirms a significant increase in accuracy over factory barrels in all standard bullet weights. Manufactured from 416R stainless steel which is an ideal material for making match grade barrels because the material allows for the precise cutting of chambers and rifling which results in a more accurate barrel.1https://s.turbifycdn.com/aah/optacticalgear/zev-optimized-match-barrel-g19-gen-1-5-1-2-x-28-thread-dlc-r-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/zev-optimized-match-barrel-g19-gen-1-5-1-2-x-28-thread-dlc-r-39.jpgZEV Technologieshttps://s.turbifycdn.com/aah/optacticalgear/zev-optimized-match-barrel-g19-gen-1-5-dlc-r-35.jpgcustom-itemoptacticalgear-pagestweliandmo48BBL19OPTDLC261249ZEV Optimized Match Barrel - G19 - Gen 1-5 - DLC (R)ZEV Technologies111thprcanexyouZEV Technologies Optimized Match Barrels have been redesigned for improved performance and Gen5 compatibility. Enhanced features include a recessed target crown, a new match chamber, and a stylized barrel hood with caliber and model engravings and a loaded chamber indicator. ZEV’s proprietary broach cut 1 in 14” left hand twist rifling was developed to create the most accurate Glock aftermarket barrel available, and testing confirms a significant increase in accuracy over factory barrels in all standard bullet weights. Manufactured from 416R stainless steel which is an ideal material for making match grade barrels because the material allows for the precise cutting of chambers and rifling which results in a more accurate barrel.1https://s.turbifycdn.com/aah/optacticalgear/zev-optimized-match-barrel-g19-gen-1-5-dlc-r-44.jpghttps://s.turbifycdn.com/aah/optacticalgear/zev-optimized-match-barrel-g19-gen-1-5-dlc-r-45.jpgZEV Technologieshttps://s.turbifycdn.com/aah/optacticalgear/zev-optimized-match-barrel-thread-protector-1-2-x-28-threading-dlc-r-29.jpgcustom-itemoptacticalgear-pagestweliandmo48TPOPT12x28DLC3028.5ZEV Optimized Match Barrel Thread Protector 1/2 x 28 Threading - DLC (R)ZEV Technologies111thprcanexyou5ZEV's Optimized Barrel Thread Protector, 1/2×28 threading for compatible barrels. Manufactured from 416R stainless steel with hardened DLC finish. Color: Black1https://s.turbifycdn.com/aah/optacticalgear/zev-optimized-match-barrel-thread-protector-1-2-x-28-threading-dlc-r-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/zev-optimized-match-barrel-thread-protector-1-2-x-28-threading-dlc-r-39.jpgZEV Technologieshttps://s.turbifycdn.com/aah/optacticalgear/zev-pro-compact-gen-5-one-piece-glock-magwell-r-29.jpgcustom-itemoptacticalgear-pagestweliandmo48MWKCPTPRO5G10494.99ZEV PRO Compact Gen 5 One Piece Glock Magwell (R)ZEV Technologies111NOTE: Only fits early model Gen 5 G19 frames that have the half moon magwell cut out, and will not fit newer model Gen 5 G19 frames that do not have it.]]>1https://s.turbifycdn.com/aah/optacticalgear/zev-pro-compact-gen-5-one-piece-glock-magwell-r-38.jpghttps://s.turbifycdn.com/aah/optacticalgear/zev-pro-compact-gen-5-one-piece-glock-magwell-r-39.jpgZEV Technologieshttps://s.turbifycdn.com/aah/optacticalgear/zulu-m4-double-magazine-pouch-56.jpghttps://s.turbifycdn.com/aah/optacticalgear/zulu-m4-double-magazine-pouch-54.jpgitem.optacticalgear-pagecltopmapo96132Zulu M4 Double Magazine PouchZulu Nylon Gear111This is no ordinary double magazine pouch! The Zulu Nylon Gear M4 Double features a unique, ergonomic "reverse flap" design. This pouch combines the best of both worlds: the protection and security afforded by a flapped pouch AND the easy access of an "open top" style pouch. Simply rip the large two inch webbing tab downward and the flap will naturally secure itself, giving you a clear path to draw your magazine. -Fits standard USGI Aluminum, Magpul PMAG, and most other 5.56 magazines -Not intended for use with Ranger Plates -Bottom features grommet for drainage -Attaches with 2 Long MALICE Clips (not included) -Made with high quality MILSPEC components -Sewn in Chicago!1https://s.turbifycdn.com/aah/optacticalgear/zulu-m4-double-magazine-pouch-66.jpghttps://s.turbifycdn.com/aah/optacticalgear/zulu-m4-double-magazine-pouch-67.jpgZulu Nylon Gearhttps://s.turbifycdn.com/aah/optacticalgear/zulu-m4-reduced-signature-chest-rig-rscr-55.jpghttps://s.turbifycdn.com/aah/optacticalgear/zulu-m4-reduced-signature-chest-rig-rscr-53.jpgcustom-itemoptacticalgear-pagemaveclqaco96RSCR150Zulu M4 Reduced Signature Chest Rig (RSCR)Zulu Nylon Gear111 The M4 RSCR was designed to be a lightweight, minimalist system for carrying just the essentials. The rig features space for 3 M4, AR15 type magazines with adjustable retention in our unique reverse flap pouches. Across the front is a shock cord web intended for carrying items like a tourniquet on your centerline where it can be easily accessed with either hand. The sides feature elastic loops for chem lights, Sharpies, or similar items. The rear features a flat pocket for maps. The harness was designed to be as light and thin as possible in order to maximize comfort when wearing the rig under ruck straps or a cover garment. Both the shoulders and waist feature user replaceable shock cord which allows the rig to remain snug on your body but still allow easy breathing and movement. The buckles and Velcro hook on the back of the rig are intended to interface with most armor systems that are SwiftClip compatible. Made with high quality MILSPEC components. Made in USA 1https://s.turbifycdn.com/aah/optacticalgear/zulu-m4-reduced-signature-chest-rig-rscr-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/zulu-m4-reduced-signature-chest-rig-rscr-66.jpgZulu Nylon Gearhttps://s.turbifycdn.com/aah/optacticalgear/zulu-mega-admin-map-sleeve-insert-38.jpgitem.optacticalgear-pageadminpouches9620Zulu Mega Admin Map Sleeve InsertZulu Nylon Gear111MEGA ADMIN MAP SLEEVE INSERT -Hook backed folding vinyl map sleeve to attach inside the Mega Admin Pouch -9.5”x12”, approx 8.5” usable width (will fit an 8.5x11 sheet of paper) -Milspec hook/loop (not US made) -20mil Marine Grade Vinyl -Milspec binding tape -Sewn in USA Color: Coyote1https://s.turbifycdn.com/aah/optacticalgear/zulu-mega-admin-map-sleeve-insert-47.jpghttps://s.turbifycdn.com/aah/optacticalgear/zulu-mega-admin-map-sleeve-insert-48.jpgZulu Nylon Gearhttps://s.turbifycdn.com/aah/optacticalgear/zulu-mega-admin-pouch-w-4-large-malice-clips-54.jpghttps://s.turbifycdn.com/aah/optacticalgear/zulu-mega-admin-pouch-w-4-large-malice-clips-52.jpgitem.optacticalgear-pageadminpouches96165Zulu Mega Admin Pouch w/ 4 Large Malice ClipsZulu Nylon Gear111-Attaches w/ 4 Long MALICE clips -9”x6.25”x1.5” -Pocket for pens, markers, etc -Large loop area for patches -Pocket for radio/GPS/light -Elastic “ears” for chem lights -Drawbridge feature -Loop field interior front for various hook backed inserts -Multiple pockets and elastic interior organization, D rings -Milspec hook/loop (not US made) -Cordura 1000d, Mil-C 43734D, Cl-3 -Milspec webbing -#69 bonded nylon thread -Heavy duty elastic -Sewn in USA Colors: Coyote, Multicam1https://s.turbifycdn.com/aah/optacticalgear/zulu-mega-admin-pouch-w-4-large-malice-clips-65.jpghttps://s.turbifycdn.com/aah/optacticalgear/zulu-mega-admin-pouch-w-4-large-malice-clips-66.jpgZulu Nylon Gear